Mishawaka High School - Miskodeed Yearbook (Mishawaka, IN)

Text from Pages 1 - 208 of the 1971 volume:

Through times of apathy - Times of grave concern, © In a year crossed with shadows And torn with the search, | We laid the patterns of our lives, Becoming what we are. Olar-laapalepr-mexel0l emia lmany ] 0s Viet tel apanivcl acme) 0] am paliale (ce Making a first effort to see beyond _ The prisms of our selves, Following the white sunlight we diffused... From empty gray flowed all the colors— Crimson courage, sun-yellow friendship, deep purple knowledge, iaNcoalcxeu dj ale Mi ialal ] amore) Ce) e-melam-]i MA alomer-| Ue enaxelel aul ielana And warmed us with their own... No two prisms ever bent the light the same; Some have yet to catch the sunlight— ai ¢-lelsjey-laciahenvamalceiialem talcm ete) (e) ecm lolol .¢-ve mi altie(-m Although we lived in shadows of troubled times, MM al-mUralilelanam iii elanvial-remacelaomivinealia @-} [ li e [stele] eo) (omere) Cols mala ace)ii-10 mcelacay From the sunlight of our individuality. © cop l Mishawaka High School LOCKED Miskodeed...1971 | CASE R 374 i M67 cop Lk Mishawaka High School Miskodeed...1971 Mishawaka-Penn Public Library Mishawaka, Indiana 1971 Miskodeed © Mishawaka High School | ie | Mishawaka: Indiana ae Volume 56 (We Se € Vcd O Ye GN 15 YVLVe GaN ra me VInG UAMWe 8 Kool “te t Bvd wha FUN ws Be “TOK 4 : c ee es 4a a a 4 © bi «Ce X¢ ey we c ea Ww 0 ae (VE = ey SA wit (ANE Poh C2 LprAaene AY, Arushy | pt Q ‘Ol preven for Bra arn QL 4 BE ake he « yoo Hirer Wh f ) y |, tote of HA MISHAWAKA-PEN val ATT 102 2144 Me oka os VP 5) ‘ Bit oe PN ie OS Identity xe ma 5 4 ee o mat ag isc Say ee as oh eer ee i | Two thousand together, on ms Ae Oth Each unique EO OO ND Opa In interest, opinions, pee eo, ee ee and } Appearance, friends; Pee | C No two the same... os ¢ Identity formed ie eae Each time we spoke, r=. y ( Acted, reacted, Me Accomplished; In everything-we did a MJ )Or dug; [wz kdentity could be | “The way others saw us, Or how wéll we knew ourselves; Searching for identity, We found DRUM MAJOR TOM GRAYSON scrutinizes action on the field after a tiring performance. Musicians found identity in expression, rhythm, accuracy, and technique. 2—Individuality DRAWING AND PAINTING CLASSES took advantage of warm days to sketch outside. Martha Needham interprets her view of MHS on the pages of a sketch pad. LOST IN A SEA of faces, individuais merge in the identity of the crowd, each maintaining his unique appearance and life. BITTERSWEET Contents Living “ee s ‘ A116 Expan@ig; oy, AN ans 56 78 102 166 186 104 4 DESIRING IDENTITY, athletes compete. The runner is driven to contend with the record, his coach, his opponent, and himself. Winning or losing, identity is gained. BITTERSWEET BRANCH LIBRARY MISHAWAKA, INDIANA LOST IN A WORLD of their own, Don and Brenda find eachother, as two distinct personalities shared together in ONG EMONWON EVAPORATES into another in an instant. Gat . lyn CurPey shows a meldtng.of moods and expressions. p) 4—Individuality ns Crying out from within, A kaleidoscope of feelings Reflected the moods Of each individual .. . Tender first love, Painful rejection— Something overheard; Sheer, unashamed happiness— Getting paid, Feeling needed, Knowing real appreciation; Bitter-sweet sadness, All-aloneness, Tears of relief; Tense anticipation Before a first date, All-important game, or final exam. Erratic, soaring, crashing, Emotions are the constant expression Within each Pe HAPPINESS BURSTS FORTH sometimes like sunlight, re- flecting on everyone who shares it. Laughter is the music of happiness and happiness is the core of life. CAUGHT IN AN INTENSE MOMENT, Fran Pringle tosses her hair. Long hair is an emotional outlet, as well as a beauty. Individuality—5 G THE SERENITY of a quiet meal, the Severs family enjoys the food and each other at the faculty picnic. VAL MYERS AND CHERYL KELLETT share the securities of fashion and friendship. Individuality was evident in varied lengths of skirts, slacks and pantsuits. : is ; 6—I ndividuality Securities Screaming cries of independence, Yet striving for acceptance, Who among us didn’t condemn conformity? Yet who among us didn’t want the security Of the accepted conformities? Family, church, boyfriends, girlfriends, These were the necessary securities, Midis, long hair, peer group, ego tripping, These were the accepted conformities. Family gave us a place to go home to, Church taught us faith, but also left Unanswered questions, personal ponderings; Secure in these conformities, We could then be ourselves, Asserting our freedom As unique incivicuais INTERRUPTED IN THEIR SONG and conversation, Bob Groves and Chuck Giszewski appear insecure. Music and laughter were securities for many Mishawaka students. SECURITY COULD BE sharing a locker with a turtle, just as Karen McLane and Jeanne Scheibelhut did with ‘‘Dean. ’ Individuality—7 () V ) : P | RYO ) OAL GY YK a Dowie 0 � Gupdl (J prea v Ce YOU WH Lth_ DALTO CK A | iy wl ( ju QO. ytl 7 fo OV beg rice LA: NOUGA V3 Lid, Qs GH USO WA AES AI JIM JORDAN, MISKODEED 47 (4 k Ahtin, dnol wal alk “oe vis 7, PHOTOGRAPHER, captures fo pad) ftp ( Yh5ach Fr |} 9? ACh) (Qn ea PL ete the mood of downtown Misha- ant 4 Hw (OS Se a C = yy 7 lan a ye Ne waka with a trick camera shot. 2) os 2 ae Pie ae ; V, p Q 5 : 2) 5) AMV FOUR PANO NT MEME — SUMAN Escapes ©’, ou, re L tldtLer du) We all knew the needki, L ma For escape sometimes; yea)|| Uouw-yor Escaping to the someone, xh | You Something, somewhere Good lixte ner Jil(— That made us forget the Problems, ANULIMZ LOU. | Achieve temporary peace. . .wead, Soy nohodu — Our escapes were as varied “ar we were; is alfou | A Book, : a movie, U) eve @ Nad Some yest +, I J ly — o | | Daydreaming in SES. Wa ont. | | Riding, rapping, hpiey | : aos ; i Even sleeping... ane) | ; CONG. Escaping for the moment see But always aware That reality was never Far away; Even our escapes were an Integral part of our ESCAPING HER POST as hall guide, Bridgette Laughlin goes into a daydream, probably to be brought back to reality by a bell or a messenger. SPEED, WIND, POWER, free- dom came when escaping on a at. bike. Mark Skene takes ad- vantage of a sunny fall day to hit the road on his chopper. Individuality—9 VOLUNTEERING THREE EVENINGS a week as a candy striper, Cindy Dare serves her community. Feeding patients is one of the duties she does gladly. TEACHING SPECIAL EDUCATION classes at St. Bavo’s every afternoon, Becky Semenak prepares for a career in this field, working with handicapped students. JUNIOR ANN POZWILKA teaches a nursery day class at the Mishawaka ‘‘Y'’. Several MHS students started ine project last summer and continued throughout the year. 10—Individuality Involvement Moved by the needs of many Im our community, Students left the isolation Of MHS to do what they could... Volunteering evenings to work With mentally handicapped, Visiting the old in nursing homes, Building a school for foreign children Tutoring underprivileged children, Giving to Share... Each doing his Small part, Reaching out in Awareness of others, Deepening our involvement Through individuality f | i ¥ : MARLENE HUSTON AIDS a patient at Golden Age Manor, where she worked every morning. Marlene plans to enter a nursing career as a way of helping other people. Awareness Faced with a world in which Poverty, pollution, war, and discrimination Were far more than words in a sociology | book, We sought for answers, Fearing many before us had asked the same questions And been given no answers. Government taught words ‘Freedom, democracy, justice”’ Boyfriends and brothers died in Viet Nam. Friends got busted. State-wide elections saw students taking Their first active role in political change; Fighting the problems of pollution on our own Battlefield, the student Ecology Committee Sought to combat area problems; Classes and assemblies discussed drugs, As did the mass media; The state of the world Opened our eyes In painful awareness, While questions burned in the minds Of each A PEACEFUL SUNSET is marred by pollution. Con- cerned students formed an ecology committee to fight the problem in the area. 12—Individuality SENIOR JERRY FOX reflects on his draft card. For many high school was shadowed with the prospect of being drafted. SIGNS AROUND TOWN expressed the anti-war opinions of many youth. Mishawaka was not immune to protest and strong convictions, whether spoken or written. AT AN ASSEMBLY to inform students of the ups and downs of heavy drug users, Mr. Charles McPheeters told of his personal experiences, which renewed his faith in God and Christianity. Individuality—13 Living School day over, Time was ours Ooms al-la- mana lmial-lare[s Or be alone, 'st-lammaUl gallate melaln xoll als (ON Vial ek-lacxoyat-l imi aivZe)iVZ=1an - al aaa Working, rapping, Dating, searching; (OTVi tKo =m) me) afore) We got into our selves, Filling each moment With individuality. Student Life—15 KATHY SHINGLEDECKER, Paul Ransberger, and Marianne Schlundt spend an evening at the new Coffee House in the cellar of the “Y,” after its opening in early September. SPIRITED SENIOR CHRIS CARNEY spends her leisure time cheering the MHS Caveman to avictory over Penn, Mishawaka rival. Nancy Miles joins her in the senior cheer section. LARRY LANCASTER LABORS industriously to improve the mechanical aspect of his custom Chevrolet coupe. 16—Student Life Leisure time lea ds to hobbies, dating With the long-awaited final bell comes freedom— to work, rap, start a party, go on a date, or just sit and contemplate. Rebuilding, adjusting, and lubricating cars and cycles offered both practical experience and enjoy- ment to guys who owned their own wheels. For others with electronic inclinations, rebuilding stereos and tape decks provided challenged and payed off in listening pleasure. Performing in local rock groups was another pastime in which talents were developed and experience in performance gained. Girls spent free hours shopping for the latest fash- ions or sewing them, pursuing hobbies, talking on the phone, or dating their favorite guy. For some painting, cooking, writing, or singing was a creative pastime. Dating consisted of anything from a basketball game to a rock concert. While many couples did the traditional movie and french fries routine, others exhibited originality in Yoga and sensitivity classes, trips to Chicago for shopping in Old Town, or skiing in area resorts and parks. UPPER LEFT, LARRY SAN- DERS and Sandy Lema enjoy a quiet moment at the ‘‘Lock- In” at the Y.M.C.A. ABOVE, FROSH JO DAVIS examines a Scandinavian doll from her collection. RIGHT, DAN SWADENER and Beth Blue share a rap together at a Christmas party. Student Life—17 18-—Student Life Employees find after-school jobs ask extra effort As the unemployment rate in the U.S. rose, MHS students found that acquiring jobs and keeping them was a difficult task. The students searched for jobs in their individual field of interest and if no job was found, they began taking any jobs available. Such jobs as pumping gas, selling shoes, and waiting on tables occupied the time of many MHS’ers. Others found jobs selling merchandise, putting away stock, or working at a cash register. Hopeful photographers worked after school in various studios, trying to learn new techniques in taking pictures. Future homemakers practiced their skills while taking care of small children. Young secretaries worked in offices in their spare time. Movie enthusiasts worked in their spare time in the community’s theaters. The money earned was spent on various activities such as dates, clothes, re- cords, and supplies for school. Many began saving for their college education or started payments on a new car, stereo system, or apartment. SENIOR ANN BERGIN assists a customer at her job at Tribe-O-Rea Drugs. Ann earned enough to pay her way to Europe for a year’s study. VINCE FLORIDIA SHOWS a customer the latest in loafer styles at Thom McAn’s. Vince has worked since his freshman year at the shopping center JUNIOR JANET JOHNSON sells popcorn at the Town and Country Theatre. Jan’s high spirits were an added attraction. | DAN RICE SETS UP a Christmas display at Robertson’s with “Sparky the Clown.” Dan used his talent on displays through- out the store, and gained experience toward his art career. Student Life—19 SENIOR TOM BENFORD plunges after a Riley Wildcat as senior, Don Shock, rushes in to assist. THE SENIOR FLOAT leads the annual Homecoming pa- rade during the afternoon pep session. 20-—Student Life Roma as Queen, floats, spirit mark ’70 Homecoming An enthusiastic student body swarmed into the stadium for the afternoon homecoming pep session. The highlight of the afternoon was the announcing of the prize-winning floats. Art Club captured the award for beauty, while the Thespians were awarded the prize for originality. The Freshman and the Sopho- more class floats tied for the theme prize. At the evening football game, half-time activities included the parade of the winning floats, and the Senior float. As the crowd became quiet and the a Capella choir finished its last notes, Student Council President Frank Portolese crowned Miss Roma Crock- er Homecoming Queen. The Misses Peggy Rydzinski and Pam Jackson were the Senior attendants. Amy Tomaczewski and Marta Greenwood represented the Junior class, and Cindy Sherril and Connie Young were chosen by the Sophomore and Freshman classes respectively. ; Although the Cavemen were defeated by the Riley Wildcats, the spirit of the student body was not dampened. Many of the spectators attended the Homecoming Dance in the gym where Monkeybutter provided the entertainment. ROMA CROCKER reveals her excitement and happiness after being crowned homecoming queen during half-time. SOPHOMORES JENNIFER LOVETTE, Cindy Sherril, and Sue Garda work diligently to finish their class float. CONNIE YOUNG and Cindy Sherril, the underclass queens, wave excitedly to their friends in the stadium. 22—Student Life Assemblies, pep rallies give facts on drugs, spirit Providing entertainment and a program of educa- tional benefit, school assemblies served to give stu- dents a break from classes while still rendering useful information. As the drug scene explodes into a preva- lent problem at MHS, many of the all-school assem- blies were aimed at curbing the use of drugs in our area. Listening to Ken McPheeters, an ex-drug addict, overwhelmed students with a feeling of despair. His depressing story of shooting speed, dropping acid, and popping pills started some of the students at MHS thinking, ‘Is the drug scene really worth it?” “Dust”, a group of talented young musicians, provided students with the sound of vibrating rock music and also shared their experiences with drugs. Their drug lives had ended with a prison sentence. Other assemblies consisted of Student Council cam- paign, Christmas Vespers, National Honor Society induction, and the band and orchestra recitals. Other breaks in the daily routine at MHS are pro- vided by pep-sessions. Enthusiastic students packed the gym for volunteer pep-sessions, as the cheer- leaders aroused the spirit of the student body with ardent cheers of victory. DANCERS JiLL SKEETERS, Bruce Mishler, and Lee Chel- miniak prepare for their number with the orchestra. PAUL BARKER, John VanDenAbeele, Mark Thornton, and Jeff Coyner lead the Pep Band in the MHS Fight Song. braeatenspi ea nei Ko RR Nm a saa NG SRN I mms en ate i RSH ees ep BRR 9 28th ne ee ee ee q ee Student Life—23 ived it. ich Ritken the gym. ;hel mw, in “‘a bad scene oc E ° ke — oH Cc fe) a oO TC c= E gets ab -school assembly ior, at an all juni , a , STUDENTS LISTEN ATTENTIVELY to the words and song of Rich Ritken, as he tells them drugs are CINDY CARNEY lead singer of ‘‘Dust”’ PRES ME. veg tier : ppears: e MRS. CONDOMINE, arg , after his first wife rea ’ rehearsal, Madame Arcati, Peggy Blair, aapts , Jim Nichols, and his wife, Carolyn tin AT AN EARLY Bradman CHRIS CARNEY band, John Marsh Dr. 24-—Student Life Seance conjures deceased wives in ‘Blithe Spirit’ This year’s all-schoo! play opened in the midst of unknown mysticism and high spirits. BLITHE SPIRIT was presented early in February. The first few weeks of rehearsals were characterized by frequent ‘‘between the lines’’ interpreting, cokes from Sandy’s, and late journeys to Bonnie Doon’s to see the “‘lady in the box’. During the last few weeks, the atmosphere changed to one of serious memorization of lines and intense characterization. BLITHE SPIRIT is a farcical look at what happens when the deceased wife of Charles Condomine, John Marsh, returns to haunt him. It unfolds as Madame Arcati, Peggy Blair, conducts a seance to make con- tact with the ‘‘other side,’ in spite of the skeptical attitudes of Charles’ wife Ruth, Chris Carney, Dr. Bradman, Jim Nichols, and Mrs. Bradman, Carolyn Currey. The remainder of the play concerns the trials and tribulations of Charles as he attempts to convince Ruth that Elvira, Becky Semenak, has indeed re- turned. The plot takes on new complexity when Ruth is killed in a car booby-trapped by Elvira. Fi- nally, both of Charles’ wives return to haunt him, and how the spirits fly . . . to say nothing of vases, paintings, and furniture! MADAM ARCATI, Peggy Blair, expresses pride and pleasure at having summoned the late Elvira Condomine. IN AN ATTEMPT to excorcise the ghosts of both Charles Condomine’s wives, Madame Arcati goes into a trance. ay v3 lp. Ce SENIOR STAN MAY tells a Santa at the shopping center what he wants to find waiting for him under the tree on Christmas morning. ee eee a Pi Re? : SKATERS SOPHOMORE MARIANNE SCHLUNDT and her brother, junior Bill Schlundt, enjoy the ice at the new Merrifield Skating Rink. SENIORS ALICIA SHINGLE- DECKER and her escort Gary Ammerman enjoy a cup of punch at the Mistletoe Ball, a Christmas formal dance. 26—Student Life Mistletoe, Vespers highlight activities of winter months Winter was accepted at Mishawaka High School, as elsewhere, with different reactions from everybody. From some there was only apathy. Others reacted with emotions ranging from complete hate to a love expressed on the ski slopes or on the Mishawaka sledding hills. Winter brought the annual Misteletoe Ball with its beautiful formals, distinguished tuxedoes, and expen- sive dinners. Winter also brought the yearly Vespers program after a week of stretched vocal cords and arms tired from being held in one position in a tableau. Christmas brought joy to many after a trip to the neighborhood Santa Claus, and to others after an evening spent in worship, celebrating Christmas in their own way. Winter, however, was not received with joy by all. Those who were faced with a two-mile hike every morning and afternoon to and from school despised the slippery sidewalks and knee-high snow drifts. Winter brought stalled cars, clumsy boots, and frost- bitten noses seemingly only to those who hate snow. Winter brought all these things, and was received with joy by some, with sorrow by others. For some it was a time of awakening, for others a time of hiber- nating, waiting for spring and their awakening. SENIOR DON EISWALD shows his enjoyment for the winter season by skiing on the slopes of Swiss Valley in Michigan. ACAPELLA CHOIR: first row: K. Cunningham, J. Eller, S. Torian, D. Van Rie, S. McManus, D. Markham, S. Riederer, S. Neises, S. Streich, K. McLane, D. Merey, S. Wilcox, P. Whitt, M. Bauters, J. Skeeters, S. Austin, G. Gherardi, T. Masters. Second row: P. Richards, J. Trimboli, L. Jones, D. Emery, D. Warner, S. Favorite, Cathy Odle, M. Addison, C. Odle, T. Stroh, C. McKinnis, S. Favorite, S. Fore, S. Davis, C. Wroblewski, M. Greenwood, M. Eling, Mr. Long. Third row: B. Lidolph, L. Vanderbeke, C. Leniski, M. Camargo, Z. Kowalski, M. Pooley, C. Fox, S. Lima, A. Shoemaker, L. Karst, N. Knisley, B. Bicknell, J. Wright, K. Hoskins, D. Carter, G. Zehring, Fourth row: M. Needham, J. Coyner, G. Groth, M. Siri,B. Hammond, A. Tkach, P. Walker, M. McGee, P. Hoff- man, T. Templeton, D. Ward, J. Marsh, M. Tagliaferri, R. Cosby, B. Brenneman, C. Dare, J. Parker, R. McDowell, J. M. McPhail. Student Life—27 uF (helm) stworter ad ao fint otuet re Lee Chelminiak, i Chris Dare star in ‘Music Man’ Harold Hill entertained the MHS audiences in March in the all-school musical THE MUSIC MAN. Chris Dare captured the lead and Lee Chelminiak played Marian. The story of a corrupt salesman who falls in love with a virtuous librarian, MUSIC MAN was and is a play that the classes will remember. Mrs. Paroo (Jill Nevel) sees her son Winthrop (Lou Mihajlovich Jr.) come out of his shell as he sings ‘Gary, Indiana’’. Harold’s sidekick Marcellus (Frank Portolese) warns him that Mayor Shinn (Scott Fore) has discovered his fraud. In his haste to escape, Hill gets caught talking to Tommy and Zaneeta (Vince Floridia and Amy Lotz), but all is not lost. The River City Band ends the play with the Minuet in G, afterwards going into a resounding chorus of ‘’Seventy-Six Trombones.” LEE CHELMINIAK LISTENS as Lou Mihajlovich, her little brother, expresses pleasure at the prospect of joining the boys’ band. FOREIGN STUDENTS Matty Gonzalez and Ana Maria De La Vega addressed the students during Spirit Week. 28—Student Life CHRIS DARE IN HIS ROLE as Professor Harold Hill advocates the “Think System” to young citizens of River City, lowa. B-TEAM CHEERLEADERS include Jeanna Swartz, Diane Firmani, Jackie Watts, Kathy Halterman and Sara Torian. RICK MILLER, Senior Class President, gives a carnation to Scott Decker, soph. caveman, as Bill Powers looks on. Slave auction, dress down day | make Spirit Week | Spirit Week, February 15-19, began with a slave auction on Monday. Fall and Winter athletes and | varsity, B-team, and Freshman cheerleaders were sold to the highest bidder. Auctioned by senior Rick Mil- ler, the slaves performed all kinds of deeds for their masters, such as carry books and buy lunches. Thurs- day was “‘turn-around day” and masters got equal treatment. During the week student boosters sold maroon “Robin Hood” hats and GAA sold new Cavemen pins to promote school spirit. Friday was Senior recognition day. Most students wore maroon and white, while the seniors declaimed it as ‘‘Dress Down Day”’. Mark Skene and Bridgette Laughlin, Caveman and Cavewoman, reigned over a pep rally to boost a winning team in a 69-63 victory over Goshen. ET SMP A TS A ET SS NR PES OSS OS SS Student Life—29 Winter months see aer Dr. Koger abolish MHS dress code Abolishing the dress code was perhaps the most dramatic change that was brought about at Mishawaka High School this past year. In the wake of a student demonstration on December first in which over one hundred girls wore slacks to school, a committee was organized to study the problem and make a recom- mendation. The committee, chaired by Reverend Phillip B. Smith, was composed of students, faculty, and P.T.A. representatives. The thirty held two meetings, and voted unanimously to recommend that any dress code going beyond health and safety considerations be abolished. Student members of the committee were Seniors Frank Portolese, Jerry Cox, and Beth Blue: Juniors Dennis Ward and Barney Packard; Sopho- mores Jon Gratzol and Debby Weiss; and Freshmen Toni Bilancio and Teresa Stringer. On January 20, all dress regulations were dropped in a policy statement by Superintendent Kenneth Koger. He stated that ‘When dress or grooming demon- strates that it is disruptive of the educational process ... It will not be permitted in school.’’ FRESHMEN JANET TAM and Mandy Hook appear both pleased and comfortable with the changed dress code. LOWER RIGHT, Principal Robert Smith addresses demon- strators protesting the dress code; one is Janet Tam. LEGS WERE A RARE SIGHT after the abolition of the dress code; Seniors Lisa Collins, Linda DeLoof, and Bonnie Miller demonstrate the look “before.” ; i { Uy Hb bbe ; “l J j Ce 2 ES t poss a Prom ‘Dream’ becomes reality Faced with the annual dilemna of transforming the gymnasium into an appropriate setting for the Junior- Senior Prom, the Class of ‘71 completed ‘‘A Midsum- mer Night’s Dream’’a few hours before doors opened. Making a quick change from paint spattered blue | jeans to formals and tuxes, exhausted juniors and seniors they were hosting prepared for the most expen- sive date of the year. After dinner, a challenge for many who were not accustomed to five course meals and four digit checks, i couples entered the gym through a flower covered | bridge which led to a fountain, complete with gold- fish, and a large castle. Murals adorned all the walls, portraying a fairyland, mystical countryside with en- chanted castles, and a mushroom and butterfly scene. A deep purple sky with white stars was the backdrop for the band, Brand X, a local group, whose music ranged from hard rock to more traditional slow numbers. Parties, rap sessions, late dinner, and pictures for the family followed the prom into the early hours when most couples left for Tower Hill or cottages. SENIOR LINDA VANDERBEKE and escort Gary Tranter gaze into the Wishing Pond at the 1970 Junior-Senior Prom. ENTERING THE 1970 prom are Brenda Eiswald, Vince | Floridia, Kent Housouer and his date, Joan Goethals and Scott Pullin, crossing the flowered bridge. eee wr Student Life—31 Foreign exchange program furnishes travel, experience Kari Hovinmaa, Mishawaka’s foreign exchange stu- dent, found life in America exciting, yet very similar to the lifestyle in his home country of Finland. Kari, who had long hoped to visit America, was sponsored by Youth for Understanding. He arrived in August and lived with the family of Lynn Williams. Since he had already acquired fluency in English, there was no language barrier. Mrs. Garth Schiffer has been instrumental in the continuation of the foreign exchange programs in Mishawaka. Through her efforts, two South American students attended MHS during the second semester. Sincerely interested, and key figures in city-wide or- ganization of the program, the Schiffers often invite foreign students to stay in their home. MRS. GARTH SCHIFFER, in- strumental in many foreign stu- dent programs, checks on ar- rangements for students. PAT FLAHERTY, above, right, gets in shape for travel. She will travel on an AFS assign- ment during the summer. KARI HOVINMAA OF Fin- land chats with Debbie Waden- er and Debbie Lamb at a for- eign student get-together here. i —_ A ” — remem 32—Student Life Many different religious denominations were repre- sented by the student body of MHS. Different forms of worship were observed in the individual churches of our community, ranging from the simplicity of the Morman service to the elaborate ceremony of the | Roman Catholic church. Students searched for a religion they could relate to. The young people par- ticipated in a variety of programs including choirs, teaching younger children in both summer ‘vacation’ school and Sunday school. Young members became fully involved to help themselves, their church, and their community. Be- | sides providing enjoyment by entertainment, many groups performed actions, such as putting together poor baskets and collecting for UNICEF. In addition to all the various special programs and projects designed for the benefit of high school stu- dents, the students helped to benefit their churches through their active involvement in church services. Churches patronized by MHS’ers, and by all peopie offered spiritual and mental rewards, appreciated and measured only by the conscience and by the individual. JOE DE MEULENAERE and Chris Wroblewski help Laurie Chamberlin practice to present a guitar mass for St. Monica’s church. Weekly folk masses offered students expression. JILL NEVEL lights the Sabbath candle, an observance done every Friday night in the Orthodox Jewish home. Student Life—33 I SS Oe ae See Oe EE Pee eS ae eee TO ee eee) wee Informed daily by Television, papers, book Andteachers, = Things we heard formed — Our questions as well | Asouropinions. Fitting our futures To the curriculum : Wasn't always easy errialiate knowledge. hae Only to realize our own Ignorance of so much. Qu estioning, studying, ae Playing the games, VVETahatate pm com eY-aiTcVA= in what op We knew, Rae Aware that the one Who starts changes is An informed individual. MRS. HARRIET NYE explains part of her new library reference orientation to Pam Barrett during the two week unit, which was an experiment in senior English classes. THE PACER’S LIGHT BEAM prodded many students to improving their reading rates and general comprehension. A second semester of reading was offered. strive toward 36—Academics English sections dabble in film; readers use pacer Students experimented with special programs in the new English E sections. Headed by Mrs. Cheryl Stegich, the class was offered to juniors and sopho- mores in place of regular English classes. One of the aids to education used in the class was a tele-trainer provided by the Indiana Bell Company. A section in television producing involved a study of the technical aspects and the various viewing dis- criminations. Video-taped TV shows and ten-minute movies were also written and directed by the English students. The students gained practical knowledge of this type of communication by making their own movies. Sophomores had an opportunity to expand their reading speeds in Developmental Reading. In Miss Marie Chadwick’s room, second-year students read books by the light of the roving pacer machine, which increases overall rate of reading. VEIN =| elf-expression used in communicating Recognizing the expanding need for self-expression, the English Department focused on writing skills. Senior English classes, through the use of library references, prepared for college. A library resource course was offered on an experimental basis for two weeks during the first semester. Librarian Mrs. Harriet Nye instructed the 182 students, familiarizing them with reference materials necessary for research pro- jects. ‘‘The goal of the course,” stated Mrs. Nye, “‘is to give the students the ability to research for them- selves without the aid of a librarian.” Seniors also reviewed filmstrips, later shown to underclassmen, on the process of writing a research paper. Second semester the seniors spent a six-weeks period studying Greek literature. Paperbacks played an important role in the Junior English classes. Class selections included ALAS BAB- YLON, A TALE OF TWO CITIES, and THE PIC- TURE OF DORIAN GRAY. Hoping to inspire his 3W classes, Mr. James Lloyd gave his students carmel candy, instructing them to write about their experiences. Other sophomore classes emphasized narration and oral expression. Freshmen classes were also introduced to the many facets of the high school library. Although their course was not as extensive as the seniors; they too learned new things. STUDENT LIBRARIAN Pam Barrett checks out a book for a junior doing her research paper for her first semester English course. Shelving, cataloging, and filing were other duties. SOPHOMORES EXPERIMENTING with carmel candy in 3W class are Marc Schmidt, Jeanna Swartz, John Gratzol and Karen Lewellan. Mr. Lloyd was the teacher. AFTER BEING INTRODUCED to the card catalogue during freshman library orientation, Janet Wiley stops to check it out. Frosh were also taught how to use the Reader’s Guide. Academics—37 38—Academics ROUND-TABLE DISCUSSIONS such as this one with Chris Ronan, Blake Angleton, Peggy Blair, Gordan Smith, and Cathy Cunningham were one of the projects attempted by Speech || students, taught by Mr. Chamberlin. LAST YEAR’S JOURNALISM students Cindy Shafer and Lisa Ermeti are now active in the publications department. DRAMA COACH MR. JOHN GIBSON explains the scrapbook required in his Drama classes to students Mike Siri and Suzanne Tansey, active Thespians, bottom center. Fine Arts aid communication, performing skills Expanding one’s knowledge of literary and dra- matic techniques was the goal of Journalism and Drama classes at MHS. Prospective journalists worked on learning the techniques of writing and editing, % 4 while dramatists practiced at perfecting their acting — and theatrical skills. Both Journalism and Drama classes stressed indi- viduality during this school year. Journalism classes emphasized: personal projects to broaden their knowl- edge of communication skills. Each student applied journalistic techniques to some form of radio, tele- vision, Newspaper, Or magazine media. Drama students performed parts from various plays to present to MHS PTA meetings. Miss Barbara Mayer, Journalism teacher, helped to | tS) encouraged a large number of Journalism students to work on the MISKODEED and ALLTOLD staffs to � , apply practical knowledge of their skills. Mr. John % o, Gibson, dramatics coach, aided the drama students in ey ‘ er) participating in the MHS student plays. as Both classes are electives and are extensions of the « 4 4, English Department. ee fidence gained through speakin The jitters soon vanished as Mr. Bruce Chamber- lin’s speech and debate classes became more confident in public speaking. Panel discussions, soap-box talks, and persuasive speaking were among the presentations given in speech classes. Controversial issues such as the draft and SST were popular subjects for the final talks. The Speakers’ Bureau in its second year dealt with some of these subjects in their programs to area clubs. The debate classes analyzed the Indiana State resolution involving air pollution control. Co-captains Lisa Ermeti and Sue Streich headed the five varsity debaters. Jill Nevel, Dick Currey, and Kurt Nelson formed the backbone of the team. Early season debates primed the team for the January sectional. Students in the Debate class entered several novice and sub-varsity contests. CHRIS RONAN, Blake Angleton, Peggy Blair, John Sweeney, and Kathy Cunningham group together to discuss a topic in their Speech |! class, a popular elective. MR.BRUCE CHAMBERLIN, who teaches speech and debate, pauses for questions from his class on the general use ofa microphone in public speaking and debating. Science students probe new concepts —_— q as atomic age awakens Mishawakans The emphasis in the science department this year is on new developments in each particular area: Physics, Chemistry, Biology, and Earth Science. In physics under Mr. Braunsdorf, the Atomic Age was explored. In the laboratory, budding scientists studied electricity and light. Students became ac- quainted with the ever-changing science of physics. Chemistry brought out a study of the Atomic Age too but not as in-depth as in Physics. The students applied their knowledge of the elements and the metric system in experiments. Thursdays and Fridays were set aside for that purpose. The other three days were used for lectures and problem solving. Biology, which means the study of life, did just that. Members of that class learned the difference between certain insects, memorized the names of birds, collected leaves, and dissected frogs, grass- hoppers, and other organisms. Earth science studied the physical layout of the PROBLEMS PERPLEX Sophomore Mark Tagliaferri as he earth. Students learned how to measure fhe carne sits in one of his more challenging classes trying to concentrate. circumference, and field trips to the “gravel pits” STAN MAY, Marsha Pooley, and Mr. James Braunsdorf dis- acquainted the students with fossils, tending more cuss the rather humerous situation of the 99% male class. toward the study of the past earth than the future. Q) WWMEMCERS OF MR. CARMICHAEL'S earth science class measure the relative circumference of the earth. SS} CONNIE YOUNG mediates on the beauty of the wilderness Y while out scavaging for leaves on a biology class assignment. 40—Academics JUNIOR RICHARD CURREY pauses to fill a gas bottle with water while preparing to make oxygen in Chemistry class. WHILE TITRATING A BASE, Tim Lovette requests some pointers on the amount of acid that is needed in the experiment. Experiments took place twice a week. Academics—41 42—Academics LANGUAGE STUDENTS Mike McLoughlin, Ron May, Barb Baiz, Ted Snider, and Bob Bonebrake practice declension on the board, trying to recall what they’ve learned. BECKY GERARD CLOSELY follows the antics of ‘’Pepito”’ in her first year Spanish class, utilizing the lab. Lab experience aid in learning three languages First year Latin students discovered the basics of verb conjugation and noun declensions, while Miss Mary Hess ’s second year students read Livy’s HIS- TORY OF ROME by applying first year skills. Third and fourth year classes combined to learn the Greek alphabet and study Vergil’s AENEID. Miss June Johnston’s first and second year Spanish students were aided in the learning process with films of Spanish-speaking families. Third and fourth year students, already having gained knowledge of the spoken language, studied the cultural aspects of Latin countries. Guided by Mrs. Doris Morey, first and second year French students memorized lines and gave short speeches. The fourth year class, engaging in all-French conversation, also studied French culture and customs. First and second year German students under Miss Marcia Liggett, spent most of their time learning grammar, reading stories, and practicing pronunciation in the language lab. The third year class put special emphasis on history and culture, giving oral reports in the native German language. Many students accom- plished a great deal in the foreign language department this year. Involvement becomes key word in MHS Social Studies Department SENIOR SUE McMANUS and Mr. Ward Baker share the ex- perience of his trip down the Monongahela River. Members of the Social Studies Department have, during the past year, seen subtle changes in their classes. The word is “involvement”, on the part of both the students and the teachers. Instructors, realizing the need for student participation and interest, have geared their courses to inductive reasoning through research. Government classes experienced participa- tory democracy in mock city council meetings. Stu- dents of International Relations discussed current events and U.S. foreign policy. Sociology classes reasoned and investigated o b j ectiveé scientific approaches to the social phenomena. Students have also seen changes in the Social Studies faculty. Mr. Taylor and Miss Stebbins joined the staff of freshman Civics teachers. Mr. Ward Baker, head of the department, retired after thirty-one years of teaching in this school system. As he put it, he “graduated with the Class of 1971.” NOVEMBER ELECTIONS BROUGHT Sue Kowalski to Mr. Robertson's bulletin board to study candidates and issues. Academics—43 — op Teacher gives mathematicians Data Processing New textbooks highlighted math classes at MHS this year. Students became more aware of the daily applications of their classroom instruction. Data Processing was offered by Mr. Louis Schroer. Students learned how to compile statistics and feed information to computers. Applied Math classes studied concrete ideas as opposed to the abstract functions of the other math classes. Freshmen had a choice of three math classes to enter: General Math, Pre-Algebra, or Algebra. Each was geared to a different level to meet individual needs of students. Quadratic equations were explained to geometry students. Third year math students expanded the equations in a section on trigonometry. Juniors rediscovered Pythagoras’ theorem, and worked on limits and arithmetic progressions. The senior math classes began the year with polar coordinates. MARTY PARIDEAN AND Mr. Reitveld seem to be enjoying a complex diagram which intrigues advanced math students. 44—Academics ADDING A NEW DIMENSION to the Math program at MHS, Mr. Louis Schroer prepares students for further work in the new Data Processing class offered to math scholars for the first time this year. Future secretaries prepare well for future work | Preparing their students for future business careers, business teachers discussed such things as correct letter-folding techniques, proper typing positions, and how to mail a five-pound package. Most freshmen start their business training by taking General Business. As the name implies, it is a study of all aspects of business such as writing busi- | ness letters, or buying the right kind of insurance. As a sophomore, the business student learns typing, one of the most important skills to a business- oriented student. Here he actually types all types of correspondence in all different letter styles. | The junior business student goes into a skill that is coupled with the typing learned earlier, that is, shorthand. Speed is stressed as the students learn a new shorter “‘language”’ to use in a future job. As a senior the student can combine these two skills to form Transcription. Shorthand is taken, then transcribed just as if the letter were to be sent out to a real company. Office Practice also helps the future secretary to train for her job by simulating actual jobs that must be performed in the business office. GAZING OVER LAURIE ELLIOT’S shoulder, the viewer captures a letter taken in shorthand. Laurie is a senior business student, who plans a secretarial career. SENIORS V1C KI DOYLE AND Patty Harris keep busy in Office Practice running the mimeograph machine. ———— SENIOR DEL RAE JOHNSON uses skills learned in four years of training by the Business Department in work at School City’s central office. Academics—45 Home Ec classes prepare MHS’ers for future lives Traditionally a freshman course, Home Economics prepared its students to be aware of the problems of everyday life. From the simple task of sewing ona button to the more complex one of completing a formal dress, clothing students followed the meticu- lous steps of patterns. First year Clothing students constructed pajamas and housecoats while formals and suits were made by the second year students. Several girls ambitiously as- sembled their winter coats. Pantsuits were another popular selection of the more advanced seamstresses. Foods classes started out with hot chocolate and built up to triple layer German-sweet chocolate cakes. A special Foods III class served meals to outside businessmen. 46—Academics DEBBIE LESLIE WORKS industriously, basting a hem in a garment she made in her clothing class taught by Miss Mary Nicholson. Sewing offered savings and practicality. POSING COQUETTISHLY, Senior Janet Nagy models one of her original creations after class in the clothing room. -seonpiorn rc O OA SA canal BOYS IN Mr. Kenneth Armel’s Print Shop set type for the ALLTOLD during their class. Mishawaka boys learn basic skills in shop classes Most students on an industrial arts course start out with drafting. In the first semester, the basic laws are learned and the students learn how to do line sketches and three-view drawings. In vocational or architectural drafting, blueprints are the major line of study. Print shop is another course offered there. First the students learn how to set up print and run the presses; then in vocational printing, they print the school newspaper and the printed material needed for the entire school system. In machine shop students learn how to use such machines as a lathe, drill presses, shavers, and other machines to be used in future industrial occupations. Electric shop teaches the boys the basic electronics. For projects they may bring in appliances from home and repair them. Each six weeks the students must do a project that is given them by the school. The wood shop learns to work in the different types of wood and to make various items in wood. At the end of the year the big projects are displayed in the main hall along with work from other areas of shop. MIKE WOOD'S individuality is brought out in Machine Shop as he works on a lathe project. Mike is a junior MHS’er. Academics—47 Gym shows skills; Health class raps on problems The rancid smell of locker rooms and the fre- quently blowing whistles were all a part of gym class. Gymnastics, volleyball, tennis, basketball, ping-pong, and bowling were participated in by a ll girls. Skill and endurance was stressed for the boys as they were taught wrestling, football, and basketball. A girls’ track team and fitness program were ideas Mrs. Gould wanted to see put into effect. In the spring, the walls in the gym were moved aside for co-ed volleyball games between the gym classes. Both boys and girls made up the teams, com- peting against their classmates. Both sides of the drug problem were openly dis- cussed in Health classes. The material, which stated the pros and cons of drug usage, was supplied by the National Association of Pharmacists. A national contest for effective posters on the drug crisis was also sponsored by the National Associ- ation of Pharmacists, and many health students entered. The annual seminar on drugs was held in Indianapolis; five Mishawaka students attended. A short course in anatomy was ventured into by most health classes. EAGER ENTHUSIASM and a throng of hands reach high to gain control of a rebound, marking the return of the basket- ball season in fall gym classes with Mr. Chelminiak. SWINGING STRONGLY, Pat Holcomb returns the birdie to an opponent in a game of badminton f or t he class contest, which she won. 48—Academics ot ¢ Drivers education uses good habits, safety know-how Driver’s Education classes played a major role in teaching high school students how to drive defensive- ly. Meeting twice a week each student had one day in class and one in practical driving. Gates Chevrolet and Hibschman Pontiac, two auto- mobile dealers, furnished new cars for this particular course. Over 180 young drivers participated each semester. Parallel parking, reversing, and general driving techniques were some of the areas stressed by the instructors. Road tests were administered at the end of the course. Qualified drivers received a waiver on the driving test at the Drivers License Bureau. VICK! FAULKNER and another student examine the tire in their Driver’s Education class to check the position. SENIOR CECIL CROOK place kicks the football to his re- ceiver Joe Leniski while other observers learn the techniques. — GIVING HiS SEMESTER speech on the digestive system, Phil Verhamme needs to make a quick glance at his health notebook before he continues. Academics—49 THE DESIGN on the cover of the 1971 Miskodeed was done by Senior Dan Rice, and here he is working on another. JOYCE SHARP works on a poster in Art Class in order to practice the techniques of let- tering with India ink and pen. SENIORS KAY YOUNG and Susan Tansey study the types of child apparel in their Health Education first semester. LAURA KORN waits patiently for the next question ona test in her Co-op class as Jean Kronewitter answers. Academics—50 Art, Coop create self-expression in challenging field Color created a furor in this year’s Art classes. Students taking art for the first time became aware of all the possible color combinations and the value of using them. Art projects ranged from clay figurines to oil paint- ings. Senior Dan Rice’s first semester art project is shown on the cover of this year’s MISKODEED. Other Art students tried their skill at water colors, still lifes, sculpture, and crafts. Instructor Miss Rosa Weikel enlisted the aid of her Art students in forming the tableaus for Vespers in Decembe r. Art History students learned the back- grounds of each of the famous portraits depicted. In an effort to help students bridge the gap be- tween school and work, MHS has been participating in a program designed to provide vocational training for students in the industrial, office, sales, and health Occupations. A variety of jobs were offered in this program headed by Mr. Lloyd Wayne. They ranged from Auto- motive Mechanics to Dental Assistants. Students enrolled in Co-op were given jobs accord- ing to their abilities and desires. LEA ANN STOUT’S water color paintbox draws her at- tention as she prepares to cre- ate an outdoor scene in Art. Academics—51 ORCHESTRA: Violin (this page): Blue, Sharon Favorite, Erwin, VonBergin, Lechlitner, Deethardt, Freed, Marsh, Bryan. PERCUSSION: Housouer, Boettcher, Shel- by. Directors: Miss Mary Watt, Mrs. Deborah Culp. Cello: Susan Favorite, West. Flute: Elson, Waidner. Trumpet: VanDenAbeele, Barker. ‘ es seed. st ers veAE Ss 8 oe LEE RT eae ay steer . Cee RS eR REHEARSING SOPRANO parts from the MESSIAH are Connie Odle, Nancy Knisley, Pat Richards, and Joyce Wright. CONCERT MISTRESS Beth Blue is entranced with music from the First movement of Beethoven's Fifth Symphony, a concert piece this year. 52—Academics | Violin (this page): P. Flaherty, J. Germano, M. Schlundt, K. Janowiak, S. Bartsch, J. Inghels, V. Britton, C. Miller, C. Buck, Wilson, R. Atkinson, G. Atkinson. Viola: K. Nelson, R. Yakym, Nichols, Clarinet: M. Grayson, Thornton. French Horn: S. Riederer. Piano: L. Chamberlin, S. Ermeti, D. Firmani, M. Greenwood. String Bass: | | D. Fray. Music groups show creativity in songs, new orchestrations Despite a few unexpected cases of laryngitis and quick trips to the music store to replace broken violin strings, the orchestra and choirs had little difficulty with this year’s concert season. Miss Mary Watt and Mrs. Deborah Culp, directors of the 45-member orchestra, had several of their stu- dents play in their All-State Orchestra. In addition to the Winter and Spring Concerts, the orchestra played for the May Festival and the spring musical. Officers of the orchestra were President Kent Housouer, Vice-President Martin Erwin, Secretary Sharon Favorite, and Treasurer Pat Flaherty. Cabinet members were Nancy Marsh, Marianne Schlundt, Deb- by VonBergen, and Sue Reiderer. Mr. John Long directed the 85-member A capella Choir in the various concerts they gave. The 40-mem- ber Chamber Singers met early Friday mornings to practice. In period costume, the Madrigal Society sang for Education Week. Choir officers were President John Marsh, Vice-President Marsha Pooley, Secretary Sue Reiderer, and Treasurer Paul Hoffman. WAITING FOR a few last minute instructions from Mr. Long, Andy Tkach removes his Madrigal costume from the hanger. Academics—53 54—Academics POM-POM CINDY SHERRILL, twirls a pennant while the Pep Band plays ‘‘Windy” at one of the home basketball games. THE ROLLING THUNDER of the tympani are silenced by a quick flip of Kent Housouer’s wrist during a rehearsal. we my Mw oS. 4 Sete Maoh A Ge ye, % hy ba. 5% ty We in te a eG BAND: FLUTES (this page): S. Tuma, K. Hull, B. Geist, B. Bolin, C. McCool, J. Sharp, J. Gerard. Clarinets: M. Grayson, V. Thornton, K. McQuade, K. Miller, M. Siri, C. Muszynski, L. Ransberger, T. Sloan, J. Fifer, J. Tindall, K. McMurtrie, N. Yoder, D. Kollars, K. Steele, P. Holcomb, C. Cahnce, C. Gill. Alto Clarinet: A. Morin. French Horn: D. Carner, J. Connon, C. Shroeder. Cornets (this page): MM. Yocum, B. Roush, T. Hess, M. Thornton, B. Woodruff, B. LaDow, K. Wood. Drums: D. Armel, M. Skene, R. Eberhardt, K. Swadener, P. Fox, K. Pajor, R. May. Bass: M. Dicken, P. Ransberger, S. Sharp. Mr. Carroll Cecil’s marching cavemen found them- selves involved in many types of activities this year. Beginning with the Football Jamboree, the band, pom-poms, and twirlers Judy Connon and Cindy Gill started their season of football halftime shows. At the last homegame, the Marching Band performed an in- tricate routine shaping cannons, Abraham Lincoln's home, and a shield. As a finale, Seniors Paul Barker and John VanDen Abeele played Taps. President Tom Grayson, Vice-president Kent Hous- over, Treasurer Paul Ransberger, and Secretary Debbie Waidner headed the band candy sales operation. January’s Winter Concert featured the Concert Band and the Dance Band. Mr. Cecil and Mrs. Deborah Culp directed the band in several numbers including “Alla Barrocco” and highlights from Richard Rogers. Nineteen seniors received recognition. This year’s Pep Band performed at all the home basketball games. In February, Notre Dame requested the band to play for o ne of their hockey games. The Spring Concert included the All-City Band in addition to the Concert and Dance Bands. The May Festival also featured the Concert Band. The Marching Band made their final performance in the Memorial Day parade. The 1971 Commence- ment was the Seniors’ last performance. AFTER THE BASKETBALL TEAM romped to a victory, ju- bilant fans sang the school song accompanied by the Pep Band. tn FLUTES: L. Lanning, M. Perkins, C. Dare, J. Lanning, V. Doyle, D. M. DeMeyer, C. Power. Trombone: D. Cook, B. Funkhouser, D. Har- Fray, D. Waidner. Horn: S. Ozsa. Tenor Sax: K. Fulkerson, D. Funk- vey, C. Dare, D. Bottroff, J. Jordan. Bells; E. McCool. Cornet; J. Coy- houser, S. Geyer, G. DeMeester. Bass Clarinet: K. Coryn, L. Ermeti. ner, L. Sanders, C. Guyton, M. Battenburg, J. VandenAbeele, P. Barker. Oboe: N. Parker, M. Nichols. Baritone Sax: S. Dare, T. Grayson. Alto Baritone; O. Lackey, M. Hans. Tympani; K. Housover. Directors; Mrs. Sax: J. Spencer, B. Gerard, M. Sharkey, Deborah Culp, Mr. Carroll Cecil. an Academics—55 J at a RE RR BETS Student Council seeks reforms; AFS students gain new perspective The thirtieth Student Council spent most of their time this year earning money to subsidize worthy pro- jects that were never quite accomplished. One such project was a school that would be built under a cooperative plan with Peace Corps or VISTA. MHS would raise $1000 for the materials and pick a place anywhere in the world for the school to be built. Thus the Student Council would enable people to receive learning that might otherwise be denied them. Due to conflicts inside the Council itself, this project was tabled for further discussion. One of the successful fund-raising projects was a Powderpuff football game held on November 8. The Senior and Freshmen girls defeated the Sophomore and Junior girls by a score of 8-0. At half-time, Junior Gary Blimling was crowned Powderpuff Queen and fans were entertained by a timpan kazoo band. The Student Council officers worked with the Council, but too often the cooperation needed for an effective Student Council was lacking. President Portolese opened the meetings and guided them with Vice-President Fox assisting, and leading committees that discussed student problmes. Secretary Kowalski recorded the minutes while Treasurer Gushwa kept a record of funds in the Council treasury. Student Council again managed the American Field JERRY FOX, ZANN KOWALSKI, Gayle Gushwa, and Frank Portolese give a big ta-da for the old Student Council. SENIORS LEW KOBOLD AND Bob Doty display a cheerful spirit while selling AFS Christmas cards in the hall. 58—Organizations Service foreign exchange program. To fund this pro- gram, Council members sold Christmas cards made by AFS students. In the spring, Vice-president Jerry Fox headed a fund drive with a goal of $800. Outside the school, the counterpart to AFS was Youth for Understanding. Similiar to AFS, the YFU student travels abroad during the summer, but pays for his own way. Exchange student, Terri Schiffer summered in Brazil, while YFU student Debbie Lamb trav- eled to Switzerland. Kari Hovinma, YFU student from Helsinki, Finland, came to MHS for the 1970-71 school year. He stayed with Lynn Williams and his family, but later moved to the Schnaible residence. Kari tried to adjust to the customs and practices of Americans, but didn’t really seem to feel at home here at MHS. The junior candidates for the next year’s program were screened by an AFS committee and announced in November. Pat Flaherty was chosen as AFS repre- sentative, and Diane Firmani and Butch Breedlove will go through Youth For Understanding. Diane has chosen to spend her summer in Germany, while Butch will travel to Switzerland for adventure there. Pat Flaherty has not yet been assigned to a country. These two programs combine to allow U.S. students to take an active in the lifestyle of another nation. POWDERPUFF QUEEN Gary Blimling looks stunned at his coronation as escort Phil Sum- mers and a player look on. YFU EXCHANGE STUDENT Debbie Lamb poses during a long hike in the Aletsch Forest in sunny Switzerland. Organizations—59 60—Organizations HI-Y MEMBERS FROLIC IN the halls as they straighten out the light strings for the Christmas trees in and outside school. Club concentrates upon awareness An awareness in outside conflicts brought about the Human Relations Club. The first series of meet- ings revolved around the theme, ‘‘Are you bugged?” In one meeting, a panel of students and teachers interpreted their ideas on the student-teacher conflict. Officers Danny Anderson, Lisa Ermeti, Linda Leslie, and Joe Trimboli took an active part in the discussion for the student side, while four teachers represented the opposing side. After these opening activities, the club concentrated on understanding the position of opposing groups. Sponsor Mr. Richard Bottorff emphasized that this year’s club was only a start in achieving better human relations. ‘‘We have to start somewhere, and this club can be the answer.”’ This club may enable the students and faculty to take a clearer look at the real problems. s stress involvement One of the largest membership clubs, Y-teens this year boasted of 96 members. A first for Y-teens was a dinner for the MHS janitors which was so successful that members hoped to make it an annual activity. Profits from a candy sale were used to adopt a child from an underprivileged country. Their service project called SHARE aimed at collecting enough food goods for the needy families in the area so that they might have something for Christmas. Officers were Kris Bosler, President, Cindy Shafer, Vice-President, Candi Hess, Secretary, and Barb Baiz, Treasurer. Hi-Y also took the initiative this year. Every year MHS has a Christmas light display. It is community- acclaimed for its beauty, but in recent years has been plagued by vandalism. The alumni were in charge of the project, but dropped it due to the thefts. Hi-Y took over the project this year and no thefts resulted. They also set up the Christmas tree in the lobby. Officers of Hi-Y were President Paul Hoffman, Veep Roger Hibschman, Secretary Paul Goegebeur, and Treasurer Rick Schaphorst. HI-Y PRESIDENT Paul Hoffman delivers Christmas cards to a sponsor room, one of several service projects Hi-Y sponsored. sss PRESIDENT OF Y-Teens Chris Bosler, Treasurer Barb Baiz, and Cabinet members Sue Garda and Patty Harris relax outside. HUMAN RELATIONS CLUB officers, Joe Trimboli, Linda Leslie, Lisa Ermeti, and Danny Anderson look ‘‘bugged. ’ Organizations—61 KAREN McCLOUD receives a call slip from Chery! Herron as she prepares to run an errand in her job as Hall Guide. aes ‘tir: Bh BSG ee ee ee Service clubs gain satisfaction assisting MHSers Mishawaka High School would miss the help it re- ceives from two of its service clubs. One of these is Ushers Club. Its twelve-member group are volunteers who give their time and efforts so that many school functions can run more smoothly. Students are famil- iar with the sight of hands reaching out to take a ticket or hand out a program. In past years, Mr. Floyd Zeiger was the faculty advisor for this organization; this year Mr. John Shrader has taken over the responsibility. The other group that renders its services daily is Hall Guides. It is composed of 98 students who de- liever counselor call-slips, check on loiterers, or guide visitors through the halls of MHS. With all the intra- school correspondence, these students are a welcome addition to school. Miss Helen Stoddart again this year was the advisor. To help supervise the hall guides are the checkers who take attendance of the guides. In both these clubs there are no honors or awards except satisfaction from service. MARTY O’CONNOR AND BOB HUNSBERGER are ushers on the spot for classmates Stanley Riechoski, Mickey Hesch and Dave Davenport, as they enter the school. 62—Organizations Board of Control approves yearly club budgets Approving budgets and controlling club’s expense accounts for the two major duties of the Board of Control. Mr. Ward Baker acted as president of the Board this year along with the other officers, vice- president Vince Floridia and secretary Bridget Lough- lin. Each of the six student members of the board were elected by their class members in the fall. Senior Brad Robertson was elected to represent the class of 1971. Junior members included Phil Verhamme and Andy Baker, while Frank Trimboli was the only soph- omore board member. In addition to Mr. Baker, Miss Martha Miller, Miss Thelma Martin, and Miss Lynetta Wilson are the faculty advisors. Mr. Robert Smith is also an ex-officio member of the board. Vice-principal, Thomas Rice takes on the major share of responsibility, assuming care of all budget problems. This year’s council met on the second Wednesday of each month. One of the more pressing problems concerned the passage of the Student Council budget. ‘ eh A Tite e eased? ae pave ge ved P ‘ x i]s + rave yava fa 4 Be, UPPER LEFT, faculty adviser Miss Stoddart talks to hall guides Dennis Oklak, Lance Kizer, Mike McGann, Carol Guyton, Maureen Higgins, and Helen Maggart, in her room. BELOW, BOARD of Control adviser Mr. Baker discusses a proposed budget with Miss Judy Stebbins as Bridgette Laughlin listens at a meeting. LATIN CLUB VICE PRES. Sue Striech adjusts Pres. Susie McManus toga before the Saturnalia feast. BELOW, GERMAN CLUB of- ficers Debbie F ray, Gary Groth, Chris Wrobleski and Peggy Blair clown. FRENCH CLUB officers Betty Perri, Kathy Micinski, and Fran Pringle relax. Organizations—64 Be. ie - Cadet teachers help in schools; clubs continue During November the French club held a pizza sale in which members made and delivered the pizzas that were sold ahead of time to various customers. Profits were used to sponsor a bus trip and to buy film strips for the language lab. Members also sang carols during the Christmas season and dressed in costume for. the | Annual Mardi Gras. Spanish Club members broke a candy-filled pinata at their Christmas party. In the spring members launched annual candy sale. This year it was ‘‘turtles.”’ Latin Club members dressed in togas for their Saturnalia which was held in December. The activities at the party center around the life and customs of Ancient Rome. T-P’ing Mrs. Liggett’s house was one of the inany activities German Club members enjoyed. Money obtained through their projects was used to keep up the AFS pictures in the library. F.T.A. opened this year with an induction of new members. Members sold popcorn as a money-making project. Beiger School was the classroom experience for the cadet teachers. Pupils as well as teachers en- joyed the experience. Officers include: Debbie Van Rie, President; Cathy Cunningham, Vice-President; Betty Perri, Secretary; and Chery! Meixel, Treasurer. The 130 combined members of these four clubs discovered that working together can accomplish | many things. SPANISH CLUB OFFICERS Diane Neises, Dennis Oklak, | Sue Fox, and President Jenny Trimboli discuss the day’s reading assignment. CADET TEACHER Alicia Shingledecker teaches measure- ments to second graders at Beiger School, where she spent an hour each day. : � Organizations—65 a, ee: FOURTH YEAR ART CLUB member Chuck Strantz works on a special project in Art X. Points were given to members. ART CLUB OFFICERS Cheryl Meixel, Jeanne Scheibelhut, Carolyn Currey, and advisor, Miss Weikel plan the year’s special events. Organizations—66 Art, business clubs continue traditions of annual projects Business Club experienced tne usual activities of the year. To make money for the treasury, two bake sales were held—one in November and another in March. In the spring, the annual awards banquet was held. Included on the agenda was a guest speaker and the awarding of the Ball Band trophy to the best se- nior in the business department. The winners from the business department contests in General Business, spelling, and beginning and advanced typing, short- hand, and bookkeeping were announced. The club also handled the concessions at the basketball games. Advisors were Miss Mary Dunn, Mrs. Janet Shields, Miss Rita Kunkle, and Mr. Charles Esperseth. Art Club undertook the annual project of making stuffed animals for the Northern Indiana Children’s Hospital in South Bend. Members gave their spare hours to club projects, including a boutique at the Thieve’s Market and posters for National Education Week. Various guest speakers accented the club meetings. THE ART CLUB float with the theme, ‘‘Squeeze ‘em out”, won the prize for beauty for the Homecoming Parade. Pig fereee Ba Bice pie das fiero tio BUSINESS CLUB SECRETARY Nancy Knisley finds it necessary to talk to Miss Dunn about plans for the banquet. BUSINESS CLUB OFFICERS Nancy Knisley, President Zann Kowalski, Jackie Claeys, and Jill Skeeters talk about their bake sale, held during the year. Organizations—6 QUILL AND SCROLL offi- cers Frank Portolese, Alicia Shingledecker, Lisa Ermeti, and Sue Kowalski pose for a MISKO picture. THESPIAN MEMBERS Jill Skeeters and Vince Floridia prac- tice for one of the skits the Thespians presented to the PTA. SENIORS DENNIS FIELDS AND JOHN MARSH join inan audition for membership in Music Honor Society. 68—Organizations Achievement brings reward to those in honor societies Activities of each of the four honor societies, consisting of more than 150 students, kept both the officers and the members busy looking for new and better ways to educate the public about themselves. Thespians, supervised by Mr. John Gibson, made a trip to Camp Milhouse to entertain underprivileged children. Officers were President Vince Floridia, Vice-President Becky Semenak, Secretary Debbie Randolph, Treasurer Ralph Strader, and Scribe Sue Tansey. A folk-rock concert featuring ‘“The Dust’’ was sponsored by Mr. John Long’s Music Honor Society. The profits were used to pay for a trip to Chicago. Plans were made to form a Music Boosters’ Club. National Honor Society made several changes in this year’s induction. Instead of an outside speaker, four members gave speeches. The traditio nal organ music was eliminated. Officers were elected at the beginning of each semester. duction in (November while new inductee Sue ers, ee roll book. BERS OF National Honor Society, not in- ted in the spring, pose for a portrait. —— ew Organizations—69 VARSITY CHEERLEADERS, Gail Fagan, Mary Kay Fagan, Eileen DeWulf, Debbie Jacobsen, and Sue Riederer go into formation on Tupper Field, before a home game. GAA VOLLEYBALL TEAM member Debbie Rando!ph spikes the ball into the net, while Joan Goethals takes the de- fensive side, practicing for the state tournament. WHITE CAPS RED COATS member Wendy Wise gets ex- perience by working in the nurse’s office during the day. 70—Organizations GAA, cheerleaders boost MHSers spirit in varied athletics — The cheerleading squad, chosen early in the spring by Mrs. Gould, practiced throughout the summer to create new cheers and perfect old standards. Led by senior Mary Kay Fagan, the varsity squad of six girls were on hand for all the major sports events of the school year, only to be replaced during the Powder Puff Football game in November by a few daring teachers, Miss Bailey, Mrs. Pozgay, Mrs. Stegich, Mr. Golba, Mr. Lloyd and Mr. Gibson. The varsity cheerleaders—Kathy Gill, Sue Riederer, Mary Kay Fagan, Eileen DeWolfe, Debbie Jacobson and Gail Fagan, earned new cheerleading sweaters for both the football and basketball games by washing cars for a day. The B-team and Freshman Cheerleaders were also present to back the school to all sports events. They lent spirit to the Freshman and B-team contests. Also this year’s GAA president, senior Becky Lidolph, led the female athletes to another State Vol- leyball Championship. To this they added a fourth- place title in badminton competition. The girls, prac- ticing many hours for the meet, met during fourth period on alternate days to perfect their talents and techniques in many sports. VARSITY CHEERLEADERS Gail Fagan and Debbie Jacob- A ot : : : Organizations—71 sen join in a cheer during halftime at homecoming.. SMOKE FROM | M rolls out of three stacks, dropping ash and capturing the concern of the Ecology Committee. HAPPILY INSPECTING A bottle are science club officers M. Dicken, J. Jordan, G. Ammerman, G. DeMeester. a SENIOR JOHN VANDENABEELE works on a logarithm while Vice-President Debbie Van Rie scans the Math book. 72—Organizations Ecology Committee created to tackle ‘Mishawaka-Mess’ Density and chemical reaction were filmed by the Science Club this year under the direction of Mr. Charles Karst, head of the Science Department and sponsor of the Science Club. Officers of the club were led by Gary DeMeester, president. Jim Jordan assisted with technical help and the use of a Bolex camera, which produced a single concept film which is designed for student use. To combat the problem of pollution, a group of concerned students organized an ecology committee. Headed by Curt Unruh, the group prepared an all-day rap session for Earth Day. Speakers talked on the pollution problem and pertinent films were shown. Committee members also set up petitions in which statistics on factories in the area were presented. Two slogans came out of the after-school meetings which were held in Room 138. The ‘Mishawaka Mess’’ symbol, which consisted of two M's and an ecology (theta) sign, was designed and used throughout the school. The SIPP slogan was also used. The title stands for Students Interested in the Pollution Problem, and all members of the Ecology Committee associated themselves with this group. Science and its practical uses were viewed from two different aspects by these two groups; both felt they were contributing to the betterment of the world by their involvement and by their interest. CHAIRMAN OF THE ECOLOGY COMMITTEE Curt Unruh finds that area industries are not aware of their pollution. Organizations—73 W™ PHOTOGRAPHER BOB JONES ENS ave put ALL- TOLD editor Terri Schiffer in a defeWStwe Moocei is trick photo Bob made. TER CHIFFER, first ester editonof AL seams to be fri a Iltold sees c FIRST SEMESTER ALLTOLD staff reflects upon their work. Bottom row: Ann Pozwilka, Susan Favorite, Cindy Shafer, and Editor Terri Schiffer. Top Row: Dave Schrader, anges in editors, staff The ALLTOLD staff snooped news, strained facts from fiction, and let imaginative minds loose to create a weekly tabloid that preserved memories of MHS happenings. Spurred by last year’s All-American rating, the ‘70-'71 ALLTOLD staff hoped to produce a news- paper that was of journalistic quality, yet a paper that would owe allegiance to every member of the MHS community. In the search for health communication between all factions, the ALLTOLD opened the Letters to Editor column to those who wished to voice opinions. In voicing its own opinions, the ALLTOLD editorial board sponsored issues on topics such as the dress code, pollution, music and drugs, and the relationship between the administration and the student body. Senior Terri Schiffer edited the ALLTOLD first semester. Terri, who also edited the paper last year, turned her position over to assistant editor Scott Fore at semester break. Sue Favorite and Cindy Shafer were co-editors of the news. Co-editors Frank Portolese and Ann Pozwilka and co-editors Jerry Fox and Dave Schrader were in charge of feature and sports, respectively. Bob Plonski was business man- ager. Miss Barbara Mayer served as faculty adviser. - oiennsiayge anal eea atta er GI SOOT gy ean I, ALLTOLD PHOTOGRAPHERS MATT MORRIS and Jim Jordan are busy using the enlarger in the darkroom to furnish the publications pictures and negatives. re re ca RR ne ae eB ge ns, Associate Editor Scott Fore, Bob Plonski, Rick Doles, Frank Portolese, Bob Jones, and Tom Grayson. The newspaper staff produced issues dealing with topics relevant to students. Organizations—75 — wm becomes closer Hours of rapping, working, laughing, and producing made this year’s MISKODEED staff a creative yet crazy group of kids. Cropping pictures, drawing lay- outs, writing copy, and taking pictures were but a few of the involvements staff members experienced. Late night runs to Luigi’s for pizza, slumber parties, send- ing an empty film pack to be developed, then rushing to retake the pictures, and painting Sadie Hawkins decorations seconds before the doors opened were some of the more hectic moments—not to mention meeting deadlines. More serious moments came when the staff was faced with making a book which was honest, and relevant to the times. Drugs, pollution, student rights and searching, and the war should not be ignored, so the staff had the task of gathering a cross-section of world and local events, and trying not to editorialize. Most MISKODEED staffers had strong political and social views, so this was seldom easy. Discussions and staff meetings largely determined the editorial policies this year. Even when the book was completed, staff members continued to meet, rap, and share in their convictions. Friendships made through all the pains and pleasures of putting out a yearbook will continue to grow, for they grew up and out this year. 76—Organizations BETH BLUE, Editor-in-Chief, stops burbling to enjoy humor as she turns out divider copy for the '71 MISKODEED. jLE FT: S. McManus, V. Floridia, B. Blue, D. Lamb, C. Kimmel, D. Young, Z. Kowalski, and L. Ermeti, truck. |THE STAFF proudly presents their ‘’Mom’’, Miss Mayer, who | appears to be uttering a ‘Why me?” to Debbie Lamb. | M. DICKEN, J. FOX, G. Ammerman, S. bows and exclaim “Thank YOU for shopping at Streich, A. Shingledecker, J. Marsh, F. Pringle, MISKODEEDI!” The staff often flamed and gaped D. Johnson, K. Micinski, and B. Perri take their during the sales drive for book subscriptions, ABOVE, MISKODEED HEAD Editors Beth Blue and Debbie Lamb flame with Juniors Patty Flaherty and Cathy Wagner. Organizations—77 Sports Cursing, sweating, Laughing, crying, Mavenhvale(Okelicm cele |cadalcrs Formed a team, (@feyanyel-veialemwanenmendalcies and with themselves. Cf avielitarem ele- onarer= Gave reward as a win or anger at a loss; aXcvalcrondcre Pdaiemelcaeciaanviarhalela Happiness and frustration ohm oxoyany elzidhareyal Striving together in individuality. Sports—79 « Schnaible passes gridders through rough season After opening the season with an excellent show- ing in the Jamboree, and a decisive victory over the Penn Kingsmen, 19-6, the Cavemen fell to six formi- dable opponents. The loss to Adams was the first mar in the Caveman record as Mishawaka fell by a score of 25-6. The Cavemen were then shut out in two consecu- tive contests by Washington and Riley by scores of 35-0, and 27-0 respectively. The next opponent was third-ranked, arch rival Mishawaka Marian. The Cave- man defense toughened and Senior quarterback Tom Schnaible passed to Ron Good for a touchdown ina tightly fought contest which was won by Marian 21-6. Despite the presence of a strong following at LaPorte, Mishawaka was the victim to an awesome offense attack of the Slicers. The Cavemen were shut out in this game, 36-0. Reaching paydirt three times against a tough Goshen eleven the Cavemen nearly upset the Redskins. Don Eiswald, Tom Schnaible, and Joe Trimboli all scored for the Cavemen in a 24-20 loss to Goshen. JUNIOR BUTCH BREEDLOVE, out-maneuvering a formida- ble group of Marian opponents, heads for open spaces. FOLLOWING THE BLOCKING of Don Shock, George Rice sprints around end on a long gain in the Chesterton game. won by the Cavemen. 80—Sports DON EISWALD DROPS to his knees in tackling a Marian foe while Randy Hively and Kim Guidi arrive to lend assistance. STARTING OFF ON a long gain, Ron Tracas sprints toward the goal in an effort to reach a first down for the Cavemen. Sports—81 JIM WISEMAN gets into it with a Riley receiver while Bill Power closes in on the action. Riley won the game. } v 4 ’ J a a Li : N uy, 7. tT ahead al di acs mem ibd a aa —— i _ ai, i aan re FIRST ROW: Mgr. J. Parker, R. Miller, R. Betzer, M. Rogers, D. Shock, C. K. Guidi, M. Lechnitner, B. Breedlove, B. Angleton, C. Streich, G. Rupard, Crook, J. Howard, J. Tromboli, Mgr. B. Walters. SECOND ROW: Mgr. J. A. Baker. FOURTH ROW: J. Woodruff, C. Klein, G. Rice, B. Ipe, S. Fowler, Cunningham, D. Eiswald, J. Wiseman, B. Power, T. Benford, T. Schnaible, M. J.Givens, R. Robertson, D. Ward, S. Micinski, J. Mell, J. Marzotto, D. Stringer, Miller, R. Good, L. Lancaster, G. Robertson, J. Crook, R. Tracas. THIRD D. Jones. ROW: B. Verhamme, R. Hively, T. Stamm, E. Hartley, R. Miller, J. Comer, 82—Sports Coach experiments with unorthodox offenses, defenses FOOTBALL WON 2 LOST 7 Penn Adams Washington Riley Marian LaPorte Goshen Chesterton Elkhart SCHNAIBLE STOPS A Knight runner for a short gain in the contest against Marian while an official watches the play. SENIOR HALFBACK DON Eiswald turns at the right mo- ment to share a long bomb from the hand of Schnaible. Sports—83 ROW ONE: R. Love, P. Anderson, R. Sobecki, B. Jones, M. Anderson, R. Gradeless, M. Markham, R. Gilmartin, A. O'Connell, D. Cook, A. Gilbert, L. Mihajlovich. ROW TWO: B. Wright, L. Geisel, G. Potts, T. Shelby, R. Van Arsdale, R. Schaphorst, J. Huemmer, S. Keen, M. Gaby, J. Bellavich, D. DeMetz, D. Flowers, F. Severa, R. DeSmith, ROW THREE: A. Baiz, T. Alwine, K. Jodway, M. Breske, J. Cook, J. Leniski, J. Beal, B. Coyner, L. Kuczmanski, S. Etherton, J. Bowman, M. Gephart. ROW FOUR: K. Janowiak, J. Schrader, D. Overman, J. Hixenbaugh, W. Troiola, R. Dresser, E. De Broka, D. Cook, R. Louallen, L. Potts, M. Coleman, T. Hinton, W. Burns. IN THE MIDST of gridiron chaos, Rick Robertson and Tom Schnaible lay in wait for an onrushing Elkhart Blue Blazer. 84-—Sports Cavekids stun every opponent Mishawaka’s freshman gridiron team was one of the most successful freshman teams that the Cavemen have had for several years. The young Cavemen had one of the most respected teams in the area, winning all eight of their contests. The freshmen opened their season with a convincing victory over the Eagles of Adams. Following a tough battle against South Bend Washington, which the Cavemen won 7-0, Mishawaka rolled over cross town rival Marian, 21-8. As the season progressed a tougher Caveman de- fense brought several victories to Mishawaka by wide margins. Against Michigan City the frosh blanked the Red Devils 39-0, and against Grissom the Cavemen played a near perfect game winning 48-0. In the course of the season Coaches John Danaher and Don Cromer were able to work several freshmen into the lineup. This playing experience will be an advantage for these freshmen next season. FRESHMAN FOOTBALL WON 8 LOST O Adams 33 6 Washington 7 0 Mishawaka Marian 21 8 Jackson 28 8 Riley 14 6 Michigan City 39 0 Grissom 48 0 Clay 22 0 SENIOR QUARTERBACK TOM Schnaible arches a pass over the outstretched hands of two Elkhart defenders. BOTTOM ROW: Mgr. J. Cunningham, Mgr. S. Smoker. SECOND ROW: J. VanBruane, J. Gratzol, J. Marzotto, D. Jones, M. Addison, P. Maribella, D. Parks, T. McCullough, J. Barnette, M. Koldyke, B. Hillers. THIRD ROW: K. O'Shea, M. VanOoteghem, G. Powell, P. Anderson, M. Boyland, M. Ladow, J. Silvers, D. Morrisette, M. Weeks. FOURTH ROW: B. Ipe, B. Bonebrake, G. Randolf, T. Barkes, D. Kindig, D. Lechnitner. HEAD COACH LOU Mijhalovich points out a weakness in the Chesterton offense. Mishawaka won the Chesterton game. Sports—85 Harriers forceful; lack varsity power In a rebuilding season, Coach Wiseman put his harriers through countless heavy workouts at George Wilson Park. Roger Stuff was the only senior on a team dominated by juniors and sophomores. Led by sophomore Dave Williams the Cavemen runners up ended four opponents. LaVille was outdistanced by Mishawaka early in the season, and after losing to two powerhouses, LaSalle and Penn, the harriers outran Washington for their second win. After the Washing- ton meet, the Cavemen suffered six consecutive de- feats, all but one by wide margins. Goshen escaped defeat by a slim seven point spread. Coach Wiseman’s runners returned from the Northwood and Riley meets with decisive victories. 1n the last meet before the sectional Cavemen were nipped by a tough Jackson squad. In the sectional the Cavemen per- formed well, finishing tenth. CROSS COUNTRY WON 4 LOST 10 New Prairie LaVille Penn LaSalle Washington Michigan City Marian Adams LaPorte Goshen Elkhart Northwood Riley Jackson Sectional LaPorte Invit. FIRST ROW: C. Gronning, J. Kabzinski, J. Moore, D. Wilson, B. Johnson. SECOND ROW: M. McGann, R. Keele, D. Williams, Mgr. T. Reiter, C. Holt. THIRD ROW: G. Aker, D. Botos, D. Copp, R. Snuff, B. Neilson, B. Gleissner, Coach Carl Wiseman. 86—Sports MHS 31 18 50 47 25 45 39 50 46 Bias ge, Fides is OPP 24 44 15 15 34 16 16 15 15 24 15 50 43 27 ney re ioe: ee THREE MEMBERS OF the cross coun- try team begin their daily workout. They are Chris Gronning, John Kabzinski, and Dave Williams. FRESHMAN CHRIS GAUTIER prepares his return of a shot from a LaPorte player in the sectional tournament. BOTTOM ROW: Brian Harker, Martin Erwin, John Germono. TOP ROW: Coach Shaw, Tom Templeton, Rich Battenburg, Chris Gautier. netters win our matches TENNIS WON9 LOST3 OPP = aE a) LaVille Penn Riley Clay LaPorte Howe Jackson Washington Michigan City Adams Goshen Elkart Sectional QNONODOHSP HP HOON ON On oes Sa wWwnwa |] OOo N = Losing his top four racketmen through graduation Coach Jerry Shaw hardly expected his team to be a contender for the sectional title that they won the year before. Sophomore John Germano led his team composed of two juniors, three sophomores, and one freshman through a season of nine victories in twelve matches. The Cavemen won their first four matches before falling to a powerful LaPorte team. Sports—87 RICK WATSON sets up a play in the upset against Elkhart. Carl Macon of the Blazers tries to defend; Gary Gautier waits. GARY GAUTIER sinks two in one of the regular season games as Dan Fowler, injured for part of the season, watches. record Opening the season with a heartbreaking loss to Clay, the Cavemen bounced back to win their next two contests. Wawasee was the victim of the Cave- man’s home opener, 87-78. Mishawaka led through- out the game, largely due to Gray Gautier’s 38 points. The Cavemen then dropped three decisions. A close loss to St. Joseph opened the door to an upset victory over touted Elkhart. Playing an excellent defensive game led by the return of Dan Fowler and Rick Everts, the Cavemen were never behind in their 67-53 win over N.I.C. rival Elkhart. Rick Watson and Gray Gautier provided the heroics in a decisive victory over arch-rival Marian. Following a close loss to Adams, Mishawaka broke the MHS gym record by scoring a 108-71 victory over Columbia City. The Cavemen amassed 68 points in the first half. Splitting the next two outings against Washington and Plymouth, Mishawaka traveled to Michigan City losing a tightly fought contest 86-78. Mishawaka reached the century mark for the second time against Logansport winning 100-68. JUNIOR RICK EVERTS arches a jump shot over a Marian opponent. Rick's defensive talents helped the Woodsmen. GARY GAUTIER SOARS over a Lafayette Central Catholic player to score two points. Bob Doty gets position. SONG; Gautiers, Watson lead team fo victories BOB DOTY AND Dan Fowler trap a Washington opponent during some second quarter action. The Cavemen easily downed the Panthers. CHEERLEADER MARY KAY Fagan stretches to cut her stran of the net after the Holiday Tourney victory. Mary Kay and others shared victory. FIRST ROW: Bill Carmack. SECOND ROW: Dave Kline, Rick Watson, Gray Gautier, Gray Gautier, R ick Everts, Glenn Haddock, Jim Hunter. THIRD ROW: Don Cromer, Vic Overman, John Marzotto, Jim Wiseman, Rick Pletcher, Bob Doty, Marv Wood, Jerry Shaw. FOURTH ROW: Mike Battenburg, Rick Robertson, Denny Ward, Daf)Fowler, Lew Kobold, Tom Sthnaible. A SENIOR GRAY GAUTIER outreaches a Lafayette Central Catholic opponent during Holiday Tourney action. Gary Gautier looks on. Sports—91 GARY GAUTIER AND Dan Fowler stretch high over their Lafayette Central Catholic opponents en route to a tip in. GUARD RICK WATSON executes a fine jump shot. Besides his superb shooting he led the team. HEAD COACH MARV WOOD and cheerleader Debbie Jacobson happily watch their team cut down the nets after the Holiday Tourney. 92—Sports In capturing the Holiday Tourney for the second year in a row, the Cavemen entertained the crowd cutting the nets. Varsity Basketball Varsity wins Holiday Tourney with two explosive offensive shows, as well as some Clay eee a nifty defensive play. Jackson 74 66 Lafayette Central Catholic was the victim of the Wawasee 87 78 Mishawaka quintet losing in the title game, 85-68. Penn 50 84 Arch-rival Mishawaka Marain won the consolation Riley 65 Us : : St. Joseph 68 71 contest defeating Southwestern Tippecanoe County expat 67 oe by a single point in the waning seconds, 83-82. AAarian 16 63 The Cavemen easily won the afternoon contest Southwestern Tippecanoe Co. 77 57 over Southwestern. At one point Mishawaka held a Lafayette Central Catholic 85 68 35-6 lead over the touted opponent. The Gautier (eSeTS Ue 81 : f ‘ Columbia City 108 71 twins dominated both contests and were aided by Wachinaton 98 67 some superb passing and clutch shooting of Rick pjymouth 74 97 Watson. Michigan City 78 86 After the championship game Athletic Director Logansport 100 68 Vic Overman presented the tourney trophy to Gray LaSalle 66 80 Gautier and Rick Watson. The evening’s events were be a 5 climaxed with the Cavemen and the cheerleaders Goshen 68 63 JUNIOR VARSITY EDDIE Killebrew relaxes in the whirl- pool to soothe the many aches and pains after practice. Sports—93 Ward, Marzotto shine in B-team season triumphs B-team coach Jerry Shaw experienced one of his most successful seasons with his predominantly junior team. The Cavemen were one of the highest scoring quintets in the area averaging nearly 60 points a game. Ed Killebrew led the junior varsity leading the team in rebounding and was one of the leading scor- ers. Juniors Rick Robertson, Denny Ward, and Mike Battenburg alternated between varsity play and B- team play. Ward and sophomore John Marzotto were the leading scorers on the team with Killebrew, Battenburg, and Robertson close behind. The freshman team experienced some rough going at the start of the season, but rallied for a respectable 12-4 season. Dave Overman was the leading scorer for John Taylor, the new freshman coach. Other top performers for the Cavekids were Bob Wright, Tim Kizer, and Jim Schrader. The highlight of the season for the freshman squad was the post-season tourney. Advancing to the semi-finals the frosh team fell to St. Joseph in overtime. 94—Sports FRESHMEN BASKETBALL TEAM—FIRST ROW-R. Love, M. Gaby, M. Coleman, M. Breske, D. DeMetz, S. Etherton, F. Severa, SECOND ROW-—Coach J. Taylor, S. De Meulenaere, R. Gradeless, S. Keen, S. Jennings, G. Randolph, THIRD ROW-—4J. Cook, B. Fry, T. Kizer, T. Hinton, B. Wright, D. Overman. FOURTH ROW —J. Schrader, L. Mahajlovich, W. Triola, D. Glover, T. Montgomery, N. Risch, G. Schroder. 4 ve MOZAVEME OE ‘ Pe | | B TEAM BASKETBALL TEAM—FIRST ROW-—Dave Klein, D. lrions, J. Hunter. SECOND ROW— Coach J. Shaw, C. Williams, E. Killebrew, G. Rice, G. Aker. THIRD ROW_—D. Weeks, K. Cates, M. Kobold, S. Fowler, F. Bradley, M. Wood. FOURTH ROW-_D. Schrader, J. Marzotto, R. Robertson, D. Ward, M. Battenberg. Swim team builds in strong season Finishing the season with three consecutive vic- tories, the tankers compiled a record of eight wins and eight loses. The Cavemen opened the season with an impressive win over Clay, 62-33. After dropping two straight Mishawaka rebounded to cop the next pair. Bob Jones was a standout in the diving compe- tition, and Jeff Smith performed well in the free- style events. Coach Walter Ross depended a great deal on his underclassmen and had several freshmen competing on the varsity. In the invitational at Penn Mishawaka finished fourth, and in the conference meet Mishawaka was fifth. Varsity Swimming MHS OPP Clay 62 33 Goshen 39 56 LaPorte 30 65 Howe 58 30 Concord 56 39 Jackson 39 56 Elkhart 43 52 Culver 38 57 LaSalle 48 47 New Prairie 57 34 Penn 41 54 St. Joseph 43 52 Adams 44 51 Michigan City 65 30 Washington 62 33 Riley 54 44 VARSITY SWIMMING: FIRST ROW: K. Quam, D. Meyer, D. Debruyne, J. Hueimer, B. Schiundi, D. DeVliegher, D. Hoffman, J. Schmidt, G. Laffin, THIRD ROW: 8B. Jones, J. Butterfield, M. K.Connon, G. Geer, M. Thornton, SECOND ROW: Hientzberger, J. Lochomondy, D. Campbell, J. | B. Brennaman, D. Schaphorst, K. Quam, J. Smith, Leniski, W. Ross. i JUNIOR BILL SCHLUNDT dives in for the 50-yard freestyle event. Bill won his event several times during the year. ATTEMPTING TO PERFECT his starting technique, Rick McGee concentrates on the vital elements of a correct dive. 96—Sports FIRST ROW: B. Power, J. Lochmondy, M. Rodgers, P. Garrage, R. Tracas, R. Betzer, D. Dentino, J. Laskowski, M. Miller, L. Lancaster, T. Cannarecci. SECOND ROW: Mr. Vic Overman, S. Micinski, J. Comer, S. Fowler, R. Robertson, J. Trimboli, T. Schnaible, R. Miller, D. Ashbaugh, B. Breedlove, J. Friedman. THIRD ROW: B. Gleissner, C. Starke, B. Johnston, T. Riter, J. Germano, T. Templeton, J. Moore, B. Walters, J. Cunningham, C. Gronning, A. Anders. Varsity Wrestling Won7 Lost3 MHS OPP Clay 31 19 LaPorte 33 15 Elkhart 19 24 Adams 19 20 LaSalle 23 15 Jackson 30 14 Washington 24 17 Riley 13 26 Penn 21 20 Michigan City � 41 11 Sophomore Tommy Barkes led Coach Smith's grapplers through a winning season. Going undefeat- ed through the regular season and easily copping the sectional Barkes surpassed his expectations. Ray Al- drich, the second-half of the Cavemen fearsome duo failed to win the sectional title due to a painful in- jury in a preliminary bout. The B-team squad met with more success than the varsity squad, winning almost all of their meets. The Freshman squad finished the season with a 6-1 mark. B-TEAM WRESTLERS: FIRST ROW: J. Sterzik, R. Keel, VARSITY WRESTLERS: FIRST ROW: T. Barkes, D. Dentino, ; i ( Y x va T. Morissette, K. Collins, K. Hartley, B. Kindley, D. Kindig, J. M. Schmidt, A. Anders. SECOND ROW: Coach Jim Miller, fi 3 7 | Dietrich. SECOND ROW: L. Parks, R. Dresser, M. Kinsey, P. J. Van Bruaene, M. Robinson, R. Plot, D. Barnette, R. Melin, b J J Anderson, L. Potts, M. Oklak, J. Viscek, D. Morissette. THIRD L. Parks. THIRD ROW: Coach Lou Mihajlovich, R. Aldrich, 3 we ee | | ROW: J. Francis, B. Burns, T. VanArsdale, T. McCullough, D. S. Micinski, D. Stringer, M. Miller, R. Stuff, B. Woodruff, Coach La Steinke, F. Trimboli, S. Nixon, M. Addison. FOURTH ROW: Al Smith. | Coach Al Smith, G. Potts, D. Costa, B. Miller, P. Anderson, E. DeBroka, T. Shelby, Coach J. Miller. | | { | | Sports—97 team rebuilds for next season Opening the season with an overwhelming 22-0 victory over Brandywine Mishawaka’s diamondmen experienced three winning streaks and one losing streak. Led by Tom Schnaible, Dan Fowler, Tom Canarecci, and Mark Miller the Cavemen compiled a mark of 15 wins and 12 losses. In the Elkhart sectional Mishawaka advanced to the final game before falling to a tough Marian nine. The Cavemen scored an easy 5-1 victory over the Penn Kingsmen in the first game of the sectional. In the championship Marian tallied the deciding run in a 4-3 contest when a Mishawaka player threw to a wrong base. The Cavemen shut out four opponents including two in one day when they defeated Penn 2-0, 8-0 ina doubleheader. Through the course of the season the Cavemen were blanked by Marian, Washington, and LaPorte, including one no-hitter when Marian’s Paul Bock held the Cavemen hitless. Schnaible, Joe Trimboli, Larry Barkes, and Fowler were the leading hitters with Trimboli and Barkes each hitting over .300. The mainstays of the pitching staff were Fowler, Schnaible and Jack Comer. The B-team had its problems during the season and managed only seven victories against ten defeats. BASEBALL WON 15 LOST 12 MHS-OPP MHS-OPP Brandywine 22-0 New Prairie 9-2 Marian 0-6 Central 7-3 Washington 0-4 LaPorte 0-2 Central 7-1 Goshen 2-0 Jimtown 1-9 Goshen 1-6 LaPorte 1-4 Adams 6-7 Adams 5-8 Elkhart 43 Michigan City 3-5 Michigan City 2-1 Penn 2-0 Plymouth 5-2 Penn 8-0 Riley 1-2 Culver 11-5 Jackson 3-2 Riley 8-6 SECTIONAL Elkhart 2-6 Penn (semifinal) 5-1 Washington 3-1 Marian (final) 3-4 FIRST ROW: Brian LaDow, John Zalas, Richard Currey, Kim Thorton, Bob Gleissner, Mark Green. SECOND ROW: Coach John Chelminiak, Dan Sabaity, Chuck Starke, Ron Powell, Spencer Walton, Bob Doty, Jim Moore, John Groth, Matt Morris. 98-—Sports Diamondmen finish strong; golf Experiencing a very disappointing season, the 1970 golfers managed to win only two of twenty matches. Both victories came at the expense of South Bend Central. Due to the loss of their three top golf- ers through graduation, the linksmen suffered a trying season. Golf Coach Mr. John Chelminiak rebuilt his team behind his number one man Ron Powell. Powell was followed by Jim Laskowski, Spencer Walton, Bob Doty, Chuck Starke, and Paul Moore who comprised the varsity team. Inconsistancy plagued the varsity throughout the season. Another factor in the golfers’ losing season was the tough schedule they faced. Powerhouses such as LaPorte, Riley, Adams, and Michigan City easily de- feated the Cavemen throughout the year. In five B-team matches Mishawaka’s linksmen sal- vaged two victories. Again the two victories were against the same opponent, Penn. The B-team was comprised of seven golfers with similar talents. Matt Morris, Dick Curry, Gary Groth, Bob Gleissner, Mark Green, Kim Thornton, and Brian LaDow alternated during the B-team contests. GOLF WON 2 LOST 18 MHS-OPP MHS-OPP Clay 356-331 Central 340-407 Marian 360-353 Riley 335-312 LaSalle 360-359 Penn 335-311 Adams 359-327 Michigan City 358-316 LaPorte 359-312 Elkhart 358-317 Riley 330-320 Central 347-398 Goshen 339-331 Washington 347-330 Michigan City 378-351 St. Joseph's 321-302 Elkhart 378-351 Adams 322-305 Washington 340-325 LaPorte 322-309 THREE MEMBERS OF the varsity baseball team, Don Eiswald, Mark Miller, Tom Benford take a ‘fruit break”. DAN FOWLER LISTENS as Coach Danaher explains the weakness of the batter. Fowler was on the pitching staff. ing staff. FIRST ROW: Managers Bill Carmak, Vernon Snyder. SECOND ROW: Tom Nix, Tom Canarecci, Joe Trimboli, Rick Miller, Don Eiswald, Larry Barkes, Steve Dentino, Tom Buraczewski, Doug Tramer. THIRD ROW: Coach Danaher, Mark Miller, Jack Comer, Tom Benford, Dan Fowler, Rick Martens, Frank Firmani, Tom Schnaible, Roger Schroder, Gary Morris, Coach Besinger. FOLLOWING AN AWRY shot, Junior Chuck Starke suc- cessfully completes a difficult shot at the Eberhart Golf. Sports—99 Track men post successful season with Fry, Howard A winning season for the 1970 track team reached its climax when Craig Fry, a ‘70 graduate, competed in the state finals in the pole vault event. Fry set the MHS vaulting record by clearing the thirteen foot mark. Losing the annual pre-season meet to Penn by two points, the Cavemen went on to win the next five meets in a row. The season outcome ended with six wins, four losses, and one tie. The Cavemen placed sixth out of sixteen teams at the Goshen Relays. Admirable performances were turned in by the relay runners who, along with points from the high jump pit, compiled a better Relay score than any other under the direction of Coach Wiseman. The leading talent of the ‘70 squad came from the field events. Jeff Howard led the pole vaulting as a blue-ribbon athlete while Gary Ammerman, one of the best high jumpers in the area, dominated his event. Shot putter Bill Power, who broke the fifty- foot barrier as a junior, added his outstanding ability to the team. In the running contests the Cindermen boasted the speed and endurance of Jim Wiseman, Pete Garrage, Butch Breedlove, Dave Harringer and Dave Williams. COACH WISEMAN STARTS off and indoor practice race among trackmen junior Butch Breedlove, senior Dave Wilson, and Dave Williams. VARSITY TRACK: first row: K. Nelson, C. Salyer, D. Harringer, D. Wiseman. Third Row: Coach Carl Wiseman, Coach Jerry Shaw, J. J. Harper, J. Kapzinski, T. Parker, C. Fry. Second Row: D. Williams, Steffins, C. Hunter, T. Rodgers, L. Lancaster, D. Wilson, G. Ammerman, J. Wiseman, T. Sommers, P. Garrage, S. Craig, J. Howard, H. Breedlove, P.Siple, B. Power, Coach Jim Miller, Coach Marvin Wood. 100—Sports B TRACK TEAM: First Row: G. Haddock, B. Bonebrake, D. Lechtlitner, J. Haney, J. Cunningham, J. Strock, M. McGann, J. Moore, D. Copp, B. Harker. Second Row: 8B. McDowell, B. Jones, C. Holt, E. Steinke, J. Strousser, M. Robinson, C. Kline, R. Stuff, T. Templeton, C. Gronning, D. Botos, B. Hillers, A. Tkatch. Third Row: T. Chase, E. Hartley, R. Miller, P. Meribela, K. Katz, D. Ward, J. Gratzol, E. Killebrew, G. Aker, R. Johnson, A. Carter, A. Gunner. BILL POWER STRUGGLES to involve every possible muscle in throwing the shot. Power was very successful at his job. GARY AMMERMAN begins his ascent over the bar. A senior, Gary is one of the backbones of the MHS track program. Sports—101 TR I. shi 6 O_O SL Ses) Ee TE a (AUNTIE, REIT) AIR 5 ARC bai) oe Beal iam MEMBERS OF THE SCHOOL Board Robert E. Schalliol, Richard H. Schiffer, Delmar W. Anderson, Ronald A. Kronewitter, and LaVerne V. Speiser, check plans with Superintendent Dr. Kenneth J. Koger. MISS AUDRA REA, Head Counselor, looks over a change in the curriculum. Throughout the year, she worked with Mr. Thomas Rice in arranging classes and student schedules. 104—Administration January, school dress code dropped The 1970-71 school administration boasts several new faces this year. Dr. Kenneth J. Koger assumed the role of superintendent of the Mishawaka School Corporation. In December he set up a dress code committee composed of students, teachers, and parents. After the committee’s recommendation that the code be dropped, a decision was made by Dr. Koger and the school board that no further restric- tions be made on school dress other than standards set by public health and safety. The School Board, made up of Robert E. Schajliol, Richard H. Schiffer, LaVerne V. Spicer, Ronald A. Kronewitter, and Delmar W. Anderson, also approved two new courses to add to the curriculum, a second semester of computer math, and auto mechanics. Mr. Robert D. Smith returned to MHS this year to become principal. From 1969 to 1970, Mr. Smith served as principal at Beiger School. Mr. Smith was previously Dean of Boys at MHS. Mr. Thomas Rice assisted Mr. Smith in his first year of duties. Mr. Max Eby and Miss Lynetta Wilson offered their experience in dealing with disciplinary matters. PRINCIPAL ROBERT D. SMITH checks statistics on Indiana Laws of Education, preparing for his next faculty meeting. DEANS LYNETTA WILSON and Max Eby discuss the recent change in dress code and how it affects student behavior. Pa i Sa MS Fa Ps SECRETARY MABEL BRUBAKER and Assistant Principal Tom Rice look over a budget for the Board of Control. Administration—105 MR. BRUCE CHAMBERLIN, Speech and Debate teacher, teaches his daughter Marie the art of sliding at Battell Park. MR. WARD BAKER, head of the Social Studies Department, discusses pros and cons of various forms of government. MR. JAMES BRAUNSDORF, Le, cs, Physics, relaxes under a tree Ce. with one of his favorite maga- ¢ zines on science fiction. MISS ROSA WEIKEL, Art, begins work on a wood carv- ing, opposite page. Miss Weikel is the director of Vespers. 106—Faculty =] ey oO @ 2) © 3 @ re) © o “= Q aia, @ = RUE Q = a living MISS ANNE E. BAILY, English, feels that ‘We educators must examine our profession and discard the flaws that disillusion the minds of the young people.’ MR. WARD BAKER, Social Studies, journeys to Civil War battlefields and collects historical relics. MRS. FLORENCE BENKO, Gyn, receives a tradi- tional dunking from her swim students every year. MR. RICHARD BESINGER, Drafting, enjoys jogging and attending professional and student athletics. MR. MERLE BLUE, Social Studies, believes ‘’We need more mutual understanding and cooperation and less alienation between the two generations.” MR. RICHARD BOTTORFF, Sociology, is the faculty advisor for the new Human Relations Club at MHS. MR. VICTOR BOYER, Bookstore, spends leisure time reading and listening to his record collection. MR. WILLIAM CARMICHAEL, Earth Science, thinks that courses are taught better in modern education. This is his third year at MHS. Faculty—107 MR. CARROLL CECIL, Band, received the Jaycee Outstand- ing Young Educator Award in 1968. This is his first year at Mishawaka. MISS MA R1E CHADWICK, English, also teaches the two Developmental Reading classes for college-bound students in second year. MR. JOHN CHELMINIAK, Biology, also teaches boys’ gym daily. He is an official for football and basketball games, and coaches golf. _ MR. RAYMOND COSNER, Math, is a Baptist minister in a church in South Bend. He teaches Algebra. MR. DONALD CROMER, Dri- vers Education, is proud of the fact that he has never received a traffic ticket or had an accident. MRS. WILLA CUNNINGHAM, English, taught half days this year. She enjoys going on camp- ing trips with members of her family. MR. JOHN DANAHER, Social Studies, also teaches Drivers Ed and coaches the baseball team. He helps supervise in the cafe. MISS MARY DUNN, Account- ing and Business Law, feels people sh ould learn to be responsible. MR. CHARLES ESPERSETH, Business and Typing, held a Christmas party for all faculty members who found time to attend. MRS. BE TTY FAVORITE, English, took over responsi- bility for the National Honor Society this year. She likes to bake. MRS. MYRNA KAY EARN- HART, Business, enjoys sec- retarial work and also plays the organ for the church she attends. She likes music. MR. VICTOR OVERMAN, Athletic Director, oversees sea- son schedules a _n d assists coaches in carrying out their duties. 108—Faculty ABOVE MR. MERLE BLUE, Social Studies, works on his weekly column for the church newsletter as his wife, Clarice, corrects students’ work. MRS. MARCIA LIGGETT, German and English, dictates an after-school test to a student in her English classes. . ey : ¢ % . ; : Faculty members continue hobbies from college days MR. MILTON ROSS, Gym and Industrial A rts, spends some free time during the summer working on his sun- tan and his garage. MR. FLOYD ZEIGER, Social Studies, an outdoors fan, takes care of some of the forms teachers use to keep school running well. MISS MARY ANN WATT, Orchestra, practices her violin; she conducts orchestra con- certs in the Mishawaka schools, and was a violin major. Faculty—109 Staff plans to travel, publishes articles — MISS P E NN Y FLATT, English, drives a yellow sports car and is in her first year of teaching at MHS MR. GARRY FREELAND, Drafting, serves as faculty sponsor for the Red Cross and its TB seal campaign. MRS. JOAN FLURY, Home Economics, is frosh Y-Teen sponsor and _ serves on the Social Affairs Committee. MRS. CAROLYN GARBER, Home Economics, has had sev- eral articles published on protein and its effects. MR. CHUCK GOLLATZ, Industrial Arts, enjoys biking, and has made extensive trips with his bicycle. MRS: V E RA GOLLEATZ, Nurse, enjoys water skiing and knitting; plans to travel to Greece and Rome soon. MR. VICTOR WUKOVITS, SR., Counselor, gives help to a freshmen on choosing subjects necessary for his program. MRS. CHER YL STEGICH, English, finds time to enjoy conversations between her full schedule of English classes. 110—Faculty MRS. LOUISE GOULD, Gym, suc- cessfully coached the G.A.A. volley- ball team to victory; she also coaches the cheerleading squad. MRS. ANN GULYANICS, English, is very irritated by people who gripe about the U.S.; she says it’s the greatest nation. ROBERT HAHN, Math, Audio-Vis- ual, Dept. Head, uses free time for golfing, fishing, and an occasional visit to the bowling lane. MARY E. HESS, Latin, does volun- teer work during vacations with the St. Joseph County meals-on-wheels. MICHAEL M. JELLICOE, Govern- ment and Driver's Ed., works with a Hi-Y group and enjoys going camp- ing with his family on vacations. JUNE JOHNSTON, Spanish, spent her summer traveling through Gettys- burg and Williamsburg, and enjoys her records and piano. Ce ; mana! : 12588 weg eeai 4. JOHN R. LONG, Music Department head, directs 7th hour A _ Capella in preparation for the annual Christmas Vespers. RAE Mee ee a SOPHOMORE COUNSELOR MRS. JEANNETTE DAVIS takes advantage of vacation to retouch her kitchen cabinets. Faculty—111 MR. VICTOR WUKOVITS JR. Math, introduces his junior sponsor room students to some of the library’s bound magazine resources. vi MR. GERALD GERARD, Vocational Machine Shop, spent his vacation at home, building a garage in his back yard. 112—Faculty OA OE OU LS:: a, MISS SUZANNE KAMM, English, is currently engaged in compiling and illustrating books of quotations. She enjoys reading. MRS. RITA LYZEN, Business and Typing, also taught those on a steno course the Office Practices. MR. JAMES LLOYD, English, taught the 3W writing class. He attended Notre Dame classes the fall semester and IUSB the spring semester classes. MR. JOHN MARKER, Biology, is in his first year of teaching in the Mishawaka school system. MR. LOU MIHAJLOVICH, Health, coached the football for last year, along with coaching the wrest- ling team in a winning season. MR. JAMES MILLER, General Business and Sales- manship, taught summer school this year. He was the assistant coach for football and wrestling. MISS MARTHA C. MILLER, head of the business department, toured the Scandanavian countries in summer, and plans further travel. MRS. DORIS MOREY, French, sponsored the French Club in their activities; she lists as her primary interest and favorite hobby her granda- children, and her family. MISS MARY NICHOLSON, Head of the Home Economics department this year, taught Clothing this year. MR. WALTER JOHNSON. Social Studies, relaxes on week- ends with his family in his canoe on the St. Joseph River. MISS THELMA MARTIN, head of the English department, looks over her collection of wood carvings of different eras. Faculty—113 Circuits, new arrivals keep faculty busy MRS. HARRIET NYE, Librarian, recommends that everyone should alternate years of study with years of work; is working on a new book. MR. WILLIAM E. PHILLIPS, Math, spends his summer resting for the following year; he also enjoys playing bridge and golf. MR. DON PORTOLESE, Drafting, serves as spon- sor for the Hi-Y; he spends his summers on camping trips in the western United States. MRS. KATHY POZGAY, English, is concerned about the environment; she is faculty sponsor for newly formed M.H.S. Ecology Committee. MR. WARREN REITVELD, Math, enjoys his fam- ily, especially playing football with his sons during weekends. MR. WALTER ROSS, Gym, must rise very early in the morning to coach his 6 A.M. swim team practice at the local Y.M.C.A. MR. CLYDE T. SEVERS, Driver's Ed., taught summer school classes at |USB; he is the B-team football and basketball coach. MR. LOUIS C. SCHROER, Math and Data Pro- cessing, spent time during the summer working at Associates in the program department. MR. EDWARD FLEMING, Vocational Electric Shop, works on rewiring the circuits of a radio; he is in charge of stage crew and technical effects for Mishawaka theatrical productions. MR. JOHN GIBSON, Drama, with wife Nora and daughter Jean Marie, poses for a family portrait with the family pet Santcho. Mr. ‘‘G ’ produced two plays, ‘Blithe Spirit’’ and ‘‘Music Man.” 114—Faculty ILLUMINED BY AN original candle, Miss Barbara Mayer, publications, sings a ballad she composed about the sea, which is the subject of her painting. MR. DAVID ROBERTSON, Social Studies, displays artistic abilities. Sponsor of Student Council, he sees teaching as an education, not a job. Faculty—115 MISS MILDRED HARDEN, Math, enjoys spending free weekends cruising down the St. Joseph River on her pon- toon boat. MR. MAX EBY, Dean, relaxes with some students before the Homecoming game. Mr. Eby is in charge of all MHS boys. MISS PEGGY SCHAUM, Social Studies, has tra- veled to the western coast of the U.S. and to New England. MISS JANET SHIELDS, Business, teaches General Business and first year typing to future secretaries. MR. WALTER SHRADER, PVE, enjoys work at home, and feels students must help each other to grow and mature in order to be better citizens. MR. ALVIN SMITH, Social Studies, serves as wrestling coach and as assistant football coach. MISS JUDY STEBBINS, Social Studies, enjoys long walks in the woods, reading, and bike riding. MR. EARL STINE, Biology, puts his science to use at home in his special hobby—raising bees. MISS HELEN STODDART, English, collects for- eign stamps from letters of friends she met traveling. MR. JOHN TAYLOR, Social Studies, is teaching here in his first year. He mainly teaches Civics. MRS. HELEN TEETERS, Librarian, has fulfilled her life-long desire by working as a librarian. She has worked in this school system for twenty years. 116—Faculty | Teachers relax with their families at home, in local recreational areas aes MR. AUGUST BAETSLE, Math, takes time out from logarithms and theorems to frolic on the swing set with his three daughters. MR. KENNETH ARMEL, Print shop, spends time on week- ends and vacations paddling his canoe down the river. Faculty—117 Students’ welfare comes first for staff MISS BARBARA WALT ERS, English, spent her first year of teaching here. She also taught first- year French. MR. LLOYD WAYNE, Co-op, is the financial ad- visor for the Student Council and treasurer for the MEA. MR. CARL WISEMAN, Drafting, as coach of the track team, led the squad to a successful season last year. MR. MARVIN WOOD, Physical Education, is the basketball coach; he thinks it is nice to be important, but is more important to be nice. He's nice, too. MRS. NANCY BYRD, Home Management, relaxes with a magazine in a lawn chair in her yard. MRS. DEBORAH CULP, Assistant Orchestra Direc- tor, enjoys a meal in the cafeteria before class. gs ese sn tne on ees ‘ MR. AL DALKOWSKI, senior counselor, works with one of the graduates in choosing a college that will fit her needs. MR. CHARLES KARST, Chemistry, and head of the Science Department, gives directions to a student in the hallway. 118—Faculty MR. JOHN GOLBA paints one of the minia- tures from his collection. Each one entails much work, patience, and skill. MR. JERRY SHAW and Mr. Raymond Cosner watch as ‘‘Dust’’ performs at an all mh Aes oon school assembly. The program was held in only one half of the gym because of the — : , ee malfunction of the divider. MR. WILLIAM NIEMANN slams a return to Mr. Louis Schroer as they play a friendly game of tennis. The Merrifield tennis courts are a ‘‘hangout’’ for many teachers as well as students during the summer months. 1 | i] | Faculty—119 Staff workers keep school work running smoothly The service personnel at M.H.S. perform a variety of duties each day. The secretaries in the main office, Mrs. Mabel Bruebaker and Helen Margan are occupied with typing and mimeographing. Mrs. Betty Gerard, registrar, does the bookkeeping. The counselor’s office is assisted by Mrs. Garnet Kolezar. Mrs. Barbara Gaylor attends to the tasks of the athletic and dean’s offices. Mr. Raymond Bullard is in charge of a staff of thirteen custodians and three matrons. During the school year their primary job is maintaining the school grounds and building, and keeping things moving smoothly. The cafeteria staff under the capable guidance of Mrs. Mary Durr, prepared nutritious meals for stu- dents and teachers daily. The ladies also served meals for school functions and banquets. CHEERFULLY SMILING, the office secretaries Mrs. Mabel Brubaker, Mrs. Helen Morgan, Mrs. Garnet Kolezar, Mrs. Betty Gerard, and Mrs. Barbara Gaylor greet the MISKO- DEED photographer. The ladies kept busy during the day with bookkeeping and typing. CAFETERIA LADIES D. Ameyerhoefer, B. Brittian, M. Durr, T. Starkwether, |. Whetstone, G. Blume, A. Vanderheyden, C. Berreth, A. Sprague, H. Mannis, E. Claxton, and B. Hanks pause from their daily routine of preparing meals for the students. DULL GRAY DAYS are re- flected in Warren Chamberlin’s stance at left while... getting out on a sunny golf day seems to refresh him. MHS CUSTODIAL STAFF pauses on the steps. They are: Henry VandePutte, Oscar Van- dePutte, A non Riley, Basil Tudor, Kenneth Phillips, Edna Graves, B e tty Vandevoorde, Ray Bullard, J o hn Walters, Harold Rhinehart, and Warren Chamberlain. Jill, Hapesyues Champ J we Y EAR, DEbA E ThE NEXT LTs Made my vob A |; Tle beTER you and our k Vowin9 Ne Bed. 9 Individuals—121 A C 3 | A y {Vv A x a | y a ( - -{ ) A rs C Ip r ° ms he OV � i ' 7 eae Y -_ ; ad } ee ) A )A “= i fy — y Vv x SENIOR MARCIA POOLEY, seeking new ways of finding inner peace, practices the Lotus position in Yoga and meditates quietly. Y) | SENIOR BRAD ROBERTSON, Board of Control member, takes a seat on the stairs between classes to enjoy a laugh. i SENIOR TERRI SCHIFFER shows her ingenuity in art. In her spare time she converts old table legs into unique candleholders. 122—Individuals Commencement 1971 brought to an end the high school career of 416 seniors. Many achievements followed the class of 1971. Six students were honored by the National Merit Scholarship Association. Paul Walker became a finalist in early February, while Debbie Lamb and Bob Thomas were semi-finalists. Mark Dicken, Eric Rodts, and Sue McManus received Letters of Commendation. Sue McManus also received honorable mention from the National Council of English Teachers’ Scholarship. The Foreign Exchange Program sponsored three students. Terri Schiffer summered in Brazil on AFS, Debbie Lamb lived in Switzerland on YFU, and Kari Hovinmaa came to Mishawaka from Helsinki, Finland on the YFU program. Commencement ceremonies were planned by the class officers: President Rick Miller, Vice-President Lew Kobold, Secretary Marcia Pooley, and Treasurer Terri Schiffer. Valedictorian Paul Walker and Saluta- torian John Marsh were given honored positions. Seniors saw a change in the dress code and new ideas born out of their increasing awareness to the world, SENIOR EDITOR of the MISKO Fran Pringle shows plans to Senior Class President Rick Miller and Vice President Lew Kobold. SENIOR BOARD OF CONTROL members Bridget Loughlin and Vince Floridia talk following a meeting after school. Ray Aldrich Betty Alexander Cindy Alwine Gary Ammerman Danny Anderson Janice Anderson John Armstrong Linda Arnold Dean Ashbaugh Mark Badders Edward Baiz Ted Ballard SENIOR BETH BARRETT flashe s a big smile at the photographer in her ad- vanced clothing class as she models the plaid suit she made. 124—Personalities STUDENT COUNCIL OFFICERS, President Frank Portolese and Vice Presi- dent Jerry Fox listen as Mr. Smith addresses an after school open assembly concerning the dress code issue. He spoke following a demonstration in Dec- ember, and informed the students that a Dress Code Committee would be formed. re 4) ie xe. o = | oy o =: ‘ o © ©. tA Rate @) (@) © = © © = ©. @ a nr @) = tea Phil Barbera Paul Barker Debbie Barnes Brenda Barnette Dale Barnette Beth Barrett Pamela Barrett Celeste Bauters Darcia Beery Thomas Benford Ann Bergin Dan Bilancio Paula Biller Peggy Blair Beth Blue John Boggs Connie Bordner Kris Bosler David Bottorff David Bowman Gene Braddock Personalities—125 Paulette Brennan Cindy Brink Gary Briscoe Jerry Brothers Sandy Brown Mary Bryan Kathy Burkowski Pat Burns Vicki Butcher Larry Camparone Larry Campbell Tom Canarecci Gary Carlson Chris Carney Dennis Carter Linda Carter Mark Cerri Becky Chapman Nancy Chilcote Jackie Claeys Gary Clark Pat Clayborn Mike Clayton Sharon Cline Lisa Collins Harold Colvin Bonnie Conrad Steve Cooper Tim Coryn Dave Craig FACULTY EDITOR OF THE 1970 MISKODEED, Debbie Young, keeps her sense of humor as deadline day nears. 126—Individuals ‘Myriad personalities form single class Roma Crocker Cecil Crook Jim Crook Jim Crutchfield Kathy Cunningham Mark Darbin Chris Dare Linda Davis Pat Davis Mary Jane DeBroka Jim DeGeeter Cindy DeLaurelle Linda DeLoof Gary DeMeester Caro! Demeulenaere Joe DeMeulenaere Dan Dentino WATCH YOUR STEP Oletha Derrickson Nancy DeVolder ee ee eee OO ee ae ee Philip DeVolder Eileen DeWulf Individuals—127 Cafeteria dinners become grad memor Mark Dicken Pam Dillon Robert Doty Vickie Doyle Don Dzvonar Richard Eberhardt Don Eiswald Terry Eling Jill Eller Flint Elliot Laurie Elliot Connie Emery Kathy Epperson Lisa Ermeti Mary Kay Fagan Beverly Fields Dennis Fields Eileen Fisher Darry| Fleck Vince Floridia Dan Fowler Janet Fox Jerry Fox Kris Frazier Cindy Freed Chris Fry Jim Fry Patty Galloway Sherry Gardner Pete Garrage 128—Individuals eo PRPUBUCy x? | va % Lae Oe i ee So eT Pid BETTY PERRI, an editor of the MISKODEED, pauses for a moment while planning a page for the ‘71 yearbook. SENIORS FAYTHE STEELE and Nancy Devolder join friends at the lunch table in the cafeteria, while laughing at a joke. 2 Tr S ‘ a Gary Gautier Gray Gautier Vicki George Tom Gevaert Gerry Gherardi Kathy Gill Charles Giszewski Jim Goebal Joan Goethals Ron Good Laura Gorn Tom Grayson Roger Griggs Robert Groves Candy Gulata Allen Gunter Gayle Gushwa Carol Guyton Pat Hammer Joe Hardman Individuals—129 Sadie David Harringer Patty Harris Rosemary Hayden Rita Hayes Mike Heintzberger Judy Hembrect Dorthy Herron Connie Hesch Maureen Higgins Belinda Highland Paul Hoffman Jim Holbert 130—I ndividuals awkins, Christmas boost spirit SENIOR STAN MAY makes his annual Christmas visit to have a talk with Santa Claus to tell him his wishes for his Christmas stocking. | | | { SS aN i a —— = — = = - —-— Lynette Holdeman Ron Hollingsworth Dee Hood Karen Hoskins Craig Houghton Linda Housand Kent Housover Kari Hovinmaa Jeff Howard Mariann Howland Wayne Hufkens Pat Hugo Howard Hull Marlene Huston Teresa Huston Bob Huyvaert Debbie Ipe Lynn Irvine Pam Jackson Janet Jaffee : | Chris Johnson PHOTO : : : 4 === Del Rae Johnson NOT | Rita Johnson Se Shirley Jojo Ken Jones Rick Jones Jim Jordon Greg Kalil Kathy Kelley Luanne Kime JIM CROOK AND LINDA DeLoof, winners of prize for the best dressed couple at the Sadie Hawkins Dance, pose for the local photographer of Dogpatch. Individuals—131 Carol Kimmel Lance Kizer James Kleiser David Kline Jim Klingaman Betty Klopenstine Carol Klopenstein Nancy Knisley Lewis Kobold Richard Kochendofer Cathy Kodba Laura Korn Ed Kovatch Sue Kowalski Ed Kronewitter Jean Kronwitter John Kwasny Debbie Lamb Bob Lamirand Larry Lancaster Margret Lardon Mark Lardon Jim Laskowski Rick Leazenby Herb Lechlitner Charmaine Leniski Debbie Leslie Linda Leslie Janel Lewellen Mark Lewinski 132 Individuals Becky Lidolph Randa Lindenberg John Lochmondy Bridget Loughlin Tim Lovette Mick Lukens Clint Lynch Steve Madou Cynthia Maenhout Oranda Maes Helen Maggert Sharon Maggert Deidree Markin John Marsh David Marks Diana Marshall George Masterman Theresa Masters Stan May Cindy Mayerhoffer Barb Melter MISKO UNDERCLASS EDITOR Eileen Fisher demonstrates her ability to perform two tasks at once—sorting pictures and selling an ad. After her section was done, she helped out by joining the business staff. —— Individuals—133 Martha Meyerhoefer Mary Michele Kathy Micinski Nancy Miles Thomas Bonnie Miller Brad Miller Mark Miller Michele Miller Rick Miller Virginia Miller Tom Minglin Bruce Mishler Gloria Moore Karen Moore John Mortimore Sue Muhme Connie Muszynski Wanda Myers Chuck McKinnis Karen McLeod Sue McManus 134—Individuals CHRIS CARNEY AND Nancy Miles reflect the Mishawaka spirit at an early football game. — —— SS —— TH NR FS RST ae = = = — - — - Careers, college loom in Senior plans Janet Nagy Pete Nagy Ken Needham Bill Nehmer Sue Nieses Ken Nellans Kurt Nelson Ron Nelson Anne Newcomer Sharon Newman Mary Nichols Rebecca Nielsen Tom Nix Jim Norris Conny Odle Kathy Odle Joanne Olsen Julia Olszewski Marty Paridaen Becky Parker Larry Parks Patty Peiffer Betty Perri Stan Piechoski Kevin Pletcher Rick Pletcher Bob Plonski Basil Pohnov Marcia Pooley Frank Portolese Individuals—135 Seniors anticipate summer employment Cherrie Powell Ron Powell Bill Power Fran Pringle Jeannine Ramos Debbie Randolph Paul Ransberger Steve Redman Margaret Reed Candi Reiter Randy Rentz Pat Richards Sue Reiderer Dan Riffle Marilyn Rigley Selma Ringelski Brad Robertson Gladys Robertson Greg Robertson Max Rodgers Eric Rodts Mary Rosier Sabaj Peggy Rydzinski Dan Sabade Ron Salyer Larry Sanders Chris Schidler Terri Schiffer Sharry Schlemmer Tom Schnaible 136—Individuals ———— CHUCK STRANTZ SETS UP lettering for a press. Art was Chuck's favorite pasttime. Becky Schmidt Diane Schroeder Linda Schroeder Becky Semenak Sandy Shane Karen Shannon Alicia Shingledecker Don Shock Mike Shoemaker Becky Shriver Sally Sierens Jill Skeeters Mark Skene Debbie Smith Nancy Smith Bill Smith Steve Solliday Rena Springman i Don Squibb Sue Streich Gail Stamper Individuals—137 Seniors go to Ken Starr Faythe Steele Roseanne Stein Greg Steinke Becky Stokes Ken Stone Ralph Strader Chuck Strantz David Straughn Glenn Strock Roger Stuff Phil Summers Kurt Swadner Debbie Swiental Linda Szcypiorski Sue Tansey Derinda Thomas Robert Thomas Sharon Thomas Carol Toombs Joe Trimboli Jim Tuma Curt Unruh Betsy Vallance Joyce Van Arsdale Dennis Vance Diane Vance John Van Den Abeele Linda Van Der Beke Debbie Van Rie 138—Individuals Tower Hill for tranquility id SENIOR MEMBERS of the varsity basketball team celebrate t h e i r Holiday Tourney victory. Don Vickery Marlene Vinnedge Janis Wagner Paul Walker Vicky Wallace Terri Warner Robert Watkins Roger Watkins Charlotte White Debbie White Pegi Whitt Marie Wilemon Lynn Williams David Wilson Jim Wiseman Patty Witwer George Wood Joyce Wright Chris Wroblewski Rudy Yakym Debbie Young Diana Young John Young Judy Young Kay Young Cindi Zieki Denise Aitken, Mark Aker, Carl Alwine, Alvin Anders, Ray Anders, Brenda Anderson, Pat Andrews, Blake Angleton Sue Arata, Jon Armey, Barbara Armstrong, Andrea Asher, Roy Atkison, Sue Austin, Andy Baker, Lyle Baker Miriam Baiz, Roger Barclay, Barb Barnes, Bruce Barnette, James Barnhart, Nancy Barr, Mike Battenburg, Khristy Bauer Cathy Beehler, William Below, Carey Bert, Kathy Bevan, LuAnn Bice, Bob Bicknell, David Bieganski, Gary Bliming Greg Bliming, Sue Blake, Jim Blankenhorn, Denny Boettcher, Vicki Bome, Denise Bottorff, Fred Bradley, Howard Breedlove Wanda Briscoe, Jerry Britton, Janet Broomall, James Brown, Janice Burns, Candice Buscoe, Gary Callen, Doug Campbell, Carol Canarecci 140—I ndividuals JUNIORS SUSAN FAVORITE, Carey Bert, and Cindy Schafer gather in the Alltold room after school to laugh at impersonations of Patty Flaherty. Susan and Cindy worked on the ALLTOLD, while Carey and Pat devoted their time to the literary magazine, BROWSE, and the MISKODEED. With over half of their high school education be- hind them, the Class of 1972 spent their junior year enjoying some of their privileges as upperclassmen. 1970-1971 was a year of change for MHS. Juniors joined in this change by buying their class rings in November—seven months before the traditional summer date. Leadership of the class was assumed by President Richard Currey, Vice-President Russ Melin, Secretary Marta Greenwood, Treasurer Rick Robertson, and Board of Control members William Verhamme and Andy Baker. Their main duties were to raise money for the prom, and organize it. Taking advantage of their more flexible schedules, juniors studied a variety of subjects. Many college- bound students took courses as demanding as chem- istry and algebra. Some had the opportunity to par- ticipate in electives such as art, drama, music, journal- ism, and advanced language. Shorthand and typing were tackled by many aspiring stenographers. Extracurricular activities became important to many new upperclassmen. In the two dramatic pro- ductions, in the various musical programs, on the publications staffs, in clubs of all sorts, juniors were to be found. Many also held down a job in addition to their schoolwork. Preparing for their role as seniors, members of the class of 1972 assumed some leadership and learned how, when next year arrives, to take the rest. Summer institutes will provide the means for some. JUNIOR CLASS OFFICERS Rick Robertson, Marta Green- wood, Dick Curry, and Russ Melin laugh at a joke. foe ae TE MUSIC HONOR MEMBER Debbie VonBergen performs in the Old Member’s Concert. Debbie has played violin eight years. ART CLUB MEMBER Sue Geyer appears happy to read the ALLTOLD'’S coverage of the club’s winning float. Individuals—141 gid ead x a Bill Carmack, Cindy Carney, Joe Casper, Laurie Chamberlin, Jeff Chance, Troy Chase, Lori Clark, Deb- bie Claeys, Barry Clavien Jim Claxton, Carol Claypool, Walter Clevenger, Denise Cole, Jack Cole, Penny Cole, Curt Collins, Kevin Colpert, Jack Comer Debbie Cook, Steve Cooper, Terry Corey, Jeff Coyner, Patti Cunningham, Richard Currey, David Davenport, Greg Davis, Steve Davis Susan Davis, Chris Deal, Bruce De Laurelle, Ethan DeMaegd, Cindy De Meester, Sue DeMoss, Carol Derbin, Debbie DeWulf, Pam Doerr Chari Dome, Dave Doolin, Lisa Drew, Ted Drury, Pam Dyiewski, Tom Eberhardt, Linda Eberlein, Dan Edwards, Dorlan Einfalt Mariann Eling, Debbie Ellsworth, Julie Elson, Judy Emerick, Jeannie Emery, Laura Epperson, Martin Erwin, Rick Everts, Mary Ewald 142—I| ndividuals JUNIORS PAT FLAHERTY, Carey Bert, and Lea Ann Stout browse through the clothing racks in a shop that caters to mod dress. onsibility Gail Fagan, Chuck Farling, Pia Farris, Sharon Favorite, Susan Favorite, Tom Ferrettie, Laura Epperson, Joanne Fifer, Diane Firmani Pat Flaherty, Scott Fore, Peggy Foster, Steve Fowler, Sue Fox, Jim Franks, Debbie Fray, Jim Fridrich, Ann Friedman Jim Friedman, Karen Fry, Karen Gaines, Donna Galbreath, Greg Gall, Sallie Gardner, Mike Garman, Jeff George, Cathy Gerard Dennis Gerard, Domingo Gesch- wender, Kathy Gilbert, Denise Gilchrist, Jeff Givens, Mary Glassburn, Bob Gleissner, Karen Goebel, Kirk Golden Lori Gradeless, Mary Grayson, Debbie Green, Mark Green, Marta Greenwood, Gary Groth, Kim Guidi, Glen Haddock, Carl Hafer Dave Hagedorn, Kathy Halterman, Bill Hanman, James Hamman, Mark Hans, Jim Handman, Ben Harper, Cheryll Harrel, Ed Harley Dave Harvey, Chris Hass, Lori Hawkins, Steve Hawn, Chris Hayden, Debbie Hazen, Bob Hazlewood, Greg Heckaman, Don Heyse Roger Hibsehman, Randy Hively, Jane Hixenbaugh, Rich Hobanks, Adele Holdeman, Pat Hulecki, Mary Holewzynski, Jan Holloway, JoAnn Holmes Mike Honaker, John Hook, Marilyn Hook, Steve Hook, Debra Houck, Harold Houck, Linda Howsan, Ron Hunt, Greg Hupp i Janet Inghels, Debra Ingram, Debbie Jacobson, Robert James, Janet Johnson, L inda Jones, Bob Jones, Dan Jordan Individuals 143 Class of ’72 assumes leadership roles Lori Karst, Mark Kensinger, Marcia Kerr, Bill Keyser, Harold Kilor, Wanda Kilgas, Chery! Kinzie, Greg Kirk, Chris Klein Dave Klein, Rick Klinedinst, Lynn Koger, Vicky Kohler, Bob Koontz, Charles Kovach, Bruce Kujawa, Louie Kurnyak, Owen Lackey Fred Laird, Jean Lanning, Marcia Laws, Sue Lea’ke, Mike Lechlitner, Sandy Lema, Sharon Lindorf, John Little, Bill Livengood Debbie Love, Terry Lovette, Mike Lyvers, Tom Lyvers, Malena Mandich, Nancy Mariotti, Stella Mark, Richard Marshall, Linda Martens Michael Martin, Vickie Martin, Bonnie Matz, Pam Matz, Debbie May, Linda McCay, Cris McFarland, Michael McGann, Gary McGee Rick McGee, Becky McKelvey, Karen McLane, Brian McLaughlin, Kathy McMurtrie, Lorraine McQuade, Beatrice Mechling, Cindy Meidel, Chery! Meixel Jeanne Meixel, Russ Melin, Jack Mell, Charles Melton, Ed Melton, Diane Merey, Annette Meribela, Mario Meribela, Barbara Merritt Don Messer, Steve Micinski, Dave Mikulyak, Kathy Miller, Luci Miller, Michelle Miller, Rusty Miller, Wayne Miller, Keith Mills Diana Montel, D. J. Mordenti, Alaine Morin, Melinda Morse, Ernie Mullins, Steven Murray, Martha Needham, Diana Nieses, John Nelson Tom Nelson, Donna Newland, Carol Nichols, Jean Nichols, Pam Nichols, Pam Nicodemus, Bonnie Nicolini, Gail Nicolini, Steve Nowicki 144—I| ndividuals JUNIOR SCOTT FORE TAKES time to clown with senior Frank Portolese in a few minutes of upperclassman enjoyment, pride, and masculinity. Dennis Okiak, Joanne Osmanski, Sue Osza, Paul Pace, Yvonne Pace, Barny Packard, Bev Parish, John Parker, Cathy Patterson Larry Pearson, Jamie Persun, Curt Pietrzak, Linda Pitts, Dawn Place, Nancy Platner, Jill Plummer, Diane Praklet, Philip Pratt Robin Polt, Nancy Potts, Craig Power, Ann Pozwilka, Ron Scarberry, Kathy Schaffer, Jeanne Scheibelhut, James Schirf, William Schlundt Cindy Shafer, LuAnn Shaffer, Donna Sheets, Sam Shelby, Randy Sherril, Cindy Shingledecker, Kathy Shingledecker, Anita Shoemaker, Joe Siri Mike Siri, Jim Slagle, Donna Slates, Tom Slone, Don Smith, Gordon Smith, Jeff Smith, KarenSmith, Vernon Snyder Donald Sommer, Carol Sostrack, James Spencer, Tabitha Spite, Todd Stamm, Cynthia Stanley. Chuck Starke, Gary Starosta, Garry Stebbins Individuals—145 Scott Fore assumes role of top editor; Larry Stebbins, Gordon Steffens, Joan Stein, James Stewart Kathy Stokes, Lea Ann Stout, Michael Strantz, Chuck Streich Drennon Stringer, Jerry Strock, Terry Stroh, Don Stuff Mark Swadener, John Sweeney, Glenda Teeter, Mike Tevault Max Thacker, Tom Thielking, Ann THomas, Sharon Thomas June Tindall, Amy Tomaszewski, James Townsend, Jenny Trinboli Kurt Valko, Jean VanCamp, Sue VandeWalle, Debbie VanGoey Brent VanValin, Carlos Vasguez, Phil Verhamme, William Verhamme Pat Vollmer, Debby VonBergan, Cathy Wagner, Terry Wagner HEAD PHOTOGRAPHER BOB JONES readies the enlarger. This year was Bob's first in the journalism department. department. SCOTT FORE AND SUSAN FAVORITE share a laugh over a mistake in the ALLTOLD proofs; Scott became editor. semester. 146—Individuals Debbie Waidner, Dennis Ward, Hope Ward, Diana Warner, Carolyn Warren, Sandra Watford JackieWatts, John Webber, MikeWeber, Dan Weeks, Pauline Wennerstrom, John Woodruff Mike Wood, Marty Wolf, Dennis Wiser, Pamela Wise, Robert Wilson, Dan Wilson Deborah Williams, Claude Williams, Lydia Williams, Linda Willekens, Tom Wiley, Tina Wilemon Wanda White, Nancy White, Don White, Cathy Wenta, Vicki Yakym, Bill Yancy Terry Yoder, Rose Young, Garry Zakrocki,GeneZehring, Julie Zemialkowski, Joni Zirille Individuals—147 Gary Aker, Grey Aldrich, Robin Allison, Jean Anders, Pete Anderson, Terry Andrews Don Armel, Jim Asbury, Randy Asper, Pamela Badders, Kathleen Baer, Barb Baiz Barb Baldoni, Ron Banker, Pat Barera, Debra Barrier, Doug Barth, Mathew Bauters John Bean, Jess Beard, Bob Beason, Debbie Bennett, Ed Beehler, Scott Bert Loretta Bess, Chris Biddle, Joanne Blair, Pam Biller, Michael Blake, Lisa Blasko Larry Bloomer, Doug Bloss, Chris Blume, Becky Boler, Betty Bolin, Virginia Bonar Ann Bonebrake, Bob Bonebrake, Mary Bonnell, Marianne Bosler, Dana Botos, Chery! Bottorff 148—I ndividuals Sophs learn by experience B-Team cheerleaders Jeanna Swartz and Sarah Torian led the Sophomore Class into a productive year. It was a time for exploring new horizons and branching out into different extra-curricular activities at MHS. Mr. John Golba served as sophomore counsellor, and Cindy Sherril was chosen by her classmates to represent them in the Homecoming Court. Sports fans appreciated the efforts of versatile John Marzotto, who played third string quarterback last fall on the varsity and who rotated between the varsity basketball and B-Section teams. Soph members of the dance troupe which per- formed at several children’s hospitals were Jim Nichols, Mary Bonnell, , Carol Makielski, and Lee Chelminiak. The team also included Lynn Gerard, Sarah Torian and Karen Gushwa. The Class of ‘73 proved that leadership and initiative do not belong only to upperclassmen. By doing much to better MHS they grew in maturity and judgment. Diane Bottorff, Lynne Bower, Gary Bowers, Larry Bowers, Mike Boyland Greg Brandt, Bryan Bernneman, Vicki Briggs, Verne Britton, Norma Brockie Barb Brockoff, Keith Brockway, Dave Broomall, Joe Brown, Carol Buck Bill Burkus, Jim Butterfield, Tim Buwa, Clark Bargo, Tom Braves John Barnette, Philomena Calderone, Maria Camargo, Janet Canfield, Pam Carter SOPHOMORE DEBBIE WEISS checks a mailbox in the MIS- KODEED room, to help finish one of the deadlines. JODY DAVIS AND CHRIS GRONNING lead a group of smiling students in a sophomore English class. HARRIERS John Grudzinski, Dave Williams, James Moore, and Chris Gronning rush to practice. Individuals—149 Jill Neve Ken Cates, Lee Chelminiak, Terry Chizum, Beverly Christman Roscoe Church, Linda Claeys, Curt Clardy, Linda Clark Shelia Clayborn, Renee Claypool, Anita Clayton, Ron Cleveland Terry Cline, Cindy Coats, Jenny Coddens, Debbie Colley Terry Collins, Debbie Cooper, Joe Cooper, Dave Copp Rosa Corey, Kathy Coryn, Richard Cosby, Don Costa, Vera Craven, Jon Creakbaum, Jim Cunningham, Pam Cunningham, Cynthia Dare Dale Darnell, Steve Davis, Jody Davis, Roane Debrock, Scott Decker, Christine DeGeyter, Mark DeLaurelle, Teresa DeLaurelle, Mariene DeMeyer Susan Dene, SuAnn Deranek, Ralph DeVolder, Debbie DeWitt, Mike Dickeson,John Dietrich, Judy Doherty, Debbie Dresser, Jim Dycus Holly Dye, Sherry Dykes, Robert Eakins, Paula Eaton, Darrell Eggers, James Einfalt, Terry Eisenhart, Terry Ellsworth, Kathy Elliot Claire Emery, Darlene Emery, Karen Engel, Susan Ermeti, Ron Esarey, Mike Evans, Vicki Evans, Nigel Everett, Gary Ewald 150—Individuals |! writes in South Bend Trib STEVE WILCOX AND JIM ASBURY find entertainment in something amusing during free time between classes. Terry Farr, Vickie Faulkner, Linda Fell, Pamela Fike, Jill Fisher, Kathy Fischer, Paul Fjerstad, Theresa Ford, Debbie Forst Rick Forsythe, Connie Fox, David Fox, Frank Francis, Darwin Frick, Dave Fridrich, Sue Fry, Charlotte Fuller, Pam Fuller Bob Funkhouser, Sue Garda, Kathy Garrison, Gary Gaskill, Gary Gear, Danny Geldner, Connie George, Jill Gerard, Lynne Gerard John Germano, Michael Getha, Sue Geyer, Carl Gilbert, Dwayne Gill, Bonnie Glover, Kathy Gnivecki, Judy Goodwin, Robert Gorny Janet Gramenz, Jim Gramenz, Gerald Graser, Jon Gratzol, Rick Green, Cathy Greene, Richard Gregory, Chris Gronning, Bridgette Grudzinski Terry Gulatta, Craig Gurtner, Karen Gushwa, Pamela Hall, Peggy Hamilton, Jann Hammock, Sam Hanback, Dale Handley Joe Haning, Brian Harker, Ruth Harper, Terry Harris, Becky Harrison, Tina Harrison, Joyce Hartsough, Jim Havens, Kent Haverstock JOHN VAN BRUAENE, Roxanne Nisley, Dick Van Ooteghem, Monte Koldyke, Barb Brockhoff, Tim McCullough and Richard Koontz lift John Silvers in victory making the prize-win- ning Sophomore float. AP Ray Individuals—151 Prom attendance boosted by sophs Teresa Hawkins, Monica Hayden, Melvin Henson, Charlotte Herron, James Herron, Beth Hildebrand, Bob Hillers, Debbie Hixenbaugh Shawna Hockman, Candi Hess, David Hoffman, Becky Holland, Ron Holland, Debbie Holmes, Kerr Holt, Cheryl Housand, Ray Housand Rhoda Humphry, Jim Hunter, Sue Hurley, Ron Husband, Jim Huston, Kathy Hutton, Mary Ice, Katie |mus, Bill Ipe David Irions, Julie luston, Daniel James, Donna James, Stan Jannings, Stan Jennings, Peggy Johnson, Randy Johnson, Bob Jones Michael Jones, Darlene Jones, Denis Jones, Peggy Jones, John Kabzinski, Mary Kabzinski, Gail Kahlenbeck, Mantea Kapatan, Don Keen Donna Kelly, Brian Keltz, Larry Kemp, Paul Kenzinger, Doug Kerrn, Ed Kilebrew, Dave Kindig, Diane Kitson, Gloria Knudson, Jim Kobb Mark Kobold, Linda Koldyke, Monte Koldyke, Gail Kollar, Debbie Kollars, Richard Koontz Richard C. Koontz, Carmela Kovatch, Mark Kronewitter, Ron Kronewitter, Connie Kurnyak, Joe Lackey Brian Ladow, Christine Lampert, Lois Lang, Linda Lanning, Lacy LaPorte, Sondra Laxson Martha Leach, Dave Lechlitner, Debbie Leda, Randy Leniski, Marianne Lese, Terry Leuthold 152—Individuals Homecoming float brings new spirit Mark Lewandowski, Karen Lewellen, Beverlee Lodolph, Ken Lingo, Jennifer Lovette, Beverly Luke, Vickey Lute, Ray Lyvers, Sue Mabie Mike WMicConahay, Chery! McCool, Tim McCullough, Doug McDougal, Bob McDowell, Patty McGann, Alan McGillem, Jim McGookin, Mike McLaughlin Brenda MacLean, Tom McLemore, Mike McPhail, Kevin Madou, Carol Makielski, Cindy Malone, Bob Mann, Paula Mann, Rick Martin Debbie Mason, Becky Masterman, John Marzotto, Linda Matson, Larry Matz, Ron May, Mike Mazurkiewicz, Denise Mell, Ron Melter Dinah Melton, Paul Meribela, Linda Meyers, Charlene Miller, Dean Miller, Steve Minne, Colleen Mitchell, Tony Montgomery, Diane Moore Dick Moore, James Moore, Dan Morissette, Cindy Morris, Matt Morris, John Morth, Revis Morton, Sheila Myers, Valerie Myers Tom Nagy, John Natali, Jeff Naugher Rene Neece, Neff Linda Neely, Cheryl Tim Neiter, John Nellans, Jill Nevel SOPHOMORES LABOR in- dustriously, trying to paste to- gether strips of newspaper with paper mache jor their float. Individuals—153 Jim Nichols, Bob Nielson, Roxanne Nisley, Cindy Nixon, Sonia -Nolen, Chuck Norris, James Nothstine, Cathy O'Dell, Keven O'Shea, Cecilia Olszewski Gerald Overholt, Karma Overpeck, Joe Palatinus, Karla Parker, David Parks, Debbie Peiffer, Michele Pericins, Pam Pfender, Kathy Pinkstaff Nancy Pletcher, Jayne Portolese, Gary Powell, Jeannie Paulowski, Wendy Penn, Sam Perri, John Poorman, Deb Putnam Kirk Quam, Rayette Quick, William Radabaugh, Wes Ramer,Greg Randolph, Robert Rast, Denise Reed, Brenda Reidenback, Nancy Renfroe Delores Richards, Carol Riffle, David Rimbey, John Roberts, Diane Rodts, Bill Roesener, Cindy Roettgen, Deena Rose, Becky Rosenburgh Jeff Roush, Gail Samuels, Nancy Sarkisian, Chris Saros, Merri Sayer, Jeanna Scarberry, Carolyn Schelstraete, Lynn Schiffer Josephine Schimizzi, Marianne Schlundt, Mark Schmitt, David Schrader, Sue Sellers, Rishael Scharkey, Joyce Sharp, Roy Sharp, Cindy Sherrill Cindy Shirk, Connie Shilling, Bob Sloan, Steve Shoys, Dorothy Sigler, John Silvers, Sandea Silvers, Sharon Silvers, Don Simbeck Ss OPH O-M.O R ESes UIE DeESReA IN) ERK Soule Windomaker, and RoAnn DeBlock pool their talents on the prize winning float. THE SOPHOMORE FLOAT was a prize-winner, and here Sue Deranek, Sue Windomaker, and RoAnn DeBlock pool their talents on the float. 154—Individuals ee MNES Ca Sophs take advantage of writing help Pat Siple, Elaine Slone, Becky Smith, Jeff Smith, Jess Smith, Steven Smoker, Ted Snider, Al Spagnola, Tami Speiser John Spencer, Doug Steinke, John Strauser, Vicki Strock, Jeanna Swartz, Mark Tagliaferri, Cathi Taylor, Mark Taylor, Tom Templeton Mary Tevault, Michael Thibodean, Judy Thomas, Barry Thomson, Tom Thorton, Andy Tkatch, George Tomp- kins Sarah Torian, Barry Toth, Frank Trimboli, Frank Troops, John Van- Bruanne, Jeanette VanLeacke, Richard Van Ooteghem, Fred Van- Zant, Bob Veal Pam Veal, Debbie Verstrate, John Vicsik, David Vinnedge, Debbie Wag- ner, Pam Wallace, Bill Walters, Randy Wanbaugh, Stephen Watford Dean Watson, Jim Webo, Steve Weber, Mike Weeks, Tereas Weesner, Debbie Weiss, Wanda Welch, Wendy Welch, Karen West Jackie White, Jeff White, Meshell White, Jan Whitt, Steve Wilcox, Cyn- dee Williams, Dave E. Williams, Dave Williams, Larry Williams Susan Williams, Barb Wilma, Jim Wilma, Dave Wilson, Wendy Wise, Janis Wiser, Susan Windowmaker, Maria Wolf, Ken Wood Richard Wood, Sandra Woods, Steve Woody, Barry Woolet, Joe Yeager, Nancy Yoder, Lori Young, Richard Young, Vicki Young John Zalas, Ed Zehner, Connie Zeller, Frank Zirille, Paul Thiel Individuals—155 Jim Adkinson, Roxy Aingood, Gary Aldrich, Bill Alford, Gary Alwine Ted Alwine, Michael Anderson, Pat Anderson, Timothy Anderson, Ron Andrews Lonnie Armstrong, Carolyn Ashbaugh, Jerri Asher, Gary Atkinson, Randy Austin Alex Baiz, Doug Baker, Ron Baker, Fred Balbo, Mary Baldoni Jonnie Balmer, Yvonne Banks, Scott Barner, Jack Barnes, Brad Barnette Donna Barnette, Mike Barnette, Carol Barrett, Gary Barrett, Debra Bartsch SOWA Ges me tani cage 156—Individuals FRESHMEN TYRONE MITCHELL, Diana Reynolds, and Junior Quiroz share a joke on the stairs between classes. MARTY O'CONNOR, NANCY WEEKS, Frank Bricker, Jim Putz, Kim Squibb, Ken Fulkerson, Ken Fozo, Bob Wagner and Cecelia Fisher flash friendly smiles for the MISKODEED. Freshmen adjust to full schedules, high school living One of the largest classes to ever enter the halls of Mishawaka High School, the freshmen soon learned that high school life is much different from anything they had experienced before. Freshman athletics was successful, with the Frosh football team registering an undefeated season; finish- ing a fine season with the Ninth Grade Championship. Others turned to music, drama and art, and soon freshman names began appearing in successful plays and projects throughout M.H.S. Under the direction of Mr. Victor Wukovits, the freshman counsellor, class schedules were explained and followed, and students learned what classes were necessary for admission to colleges and_ technical schools. Connie Young was the freshman representative on the Homecoming Court, and filling the role of fresh- man cheerleaders were Cindy Mathias, Jill Melin, Mary Lou Metzner, and Lu Ann Stoeckinger. Mrs. Louise Gould was in charge of these girls. TIM RICHMOND watches Mr. John Shrader at the rocket blast-off which his class organized and carried out. Denise Bassier, Denise Bayman, Joseph Beal, Vicki Balentine, Kathy Bell, John Bellovich, Gregg Below Debby Bemis, Sharon Benford, Cherri Bennett, Jim Bennett, Louanne Bennett, Charles Benson, Patrick Bergin Toni Bilancio, Rich Blankenhorn, Cathy Boehnlein, Rick Bogaert, Bill Bottorff, Bruce Bortone, Jerome Bowman Geneva Boyland, Mike Breske, Frank Bricker, Howard Bright, Gerry Brink, Terry Brink, Cheryl Britton Cecilia Bronk, Kathy Brown, Joan Brown, Randy Brown, Walter Brown, Ray Bryant, Sally Bulger Individuals—157 Frosh add new spirit to school family Charlotte Burns, Mickie Burns, Bill Burns, Roberta Butz, John Calentine, Brian Campoli, Doris Carmack, Denise Carter, Sallie Chamberlin Chery! Chance, Roxana Church, Diana Cline, Linda Clough, Maurice Cocquyt, Terry Cochran, Brad Cole, Diane Kay Cole, Mike Coleman Connie Collins, Kevin Collins, Nora Conley, Judy Connon, Kenneth Connon, John Contadeluci, Dan Cook, Danny Cook, Jere Cook Robert Cook, Paula Corbin, Gregory Costa, Brian Coyner, Penny Cunningham, Carolyn Currey, Lynn Czosnowski, Shannon Dare, Mike David Danny Davis, Jo Davis, Sharee Davis, Michale Deal, Sue Davis, Robert Dean, Ed DeBroka, Cary DeCauwer, Dale DeBrune Chery! Deethardt, Ken DeKeizee, Ray DeMaegd, Don Demetz, Steve DeMeulenare, Ronnie Dencel, Ronald DeSmith, Dave DeVliegher, Sue DeVriese Jeannete DeWeirdt, Sandy DeWulf, Sherri Dixon, Rickey Doles, Rich Dresser, Joan Drew, Dean Dutoi, Terry Dykes, Beth Eberhardy Loretta Edwards, Sharon Edwards, Mary Eling, Jeff Elliot, Billie Jo Farris, Wanda Farling, Cheryl Fielder, Vicki Fisher, Sandra Fitz Harold Fleming, Nancy Flood, April Flowers, David Flowers, Kathy Foster, Peggy Foster, Phillip Fox, Phyllis Fox, Ken Fozo John Francis, Patti Frisoni, Brian Fry, Gail Fryar, Ken Fulkerson, Dan Funkhouser, Mike Gaby, Mike Gannon, Stanley Gardner 158—Individuals SR eet ke cae om TYRONE MITCHELL takes time out from a good Junch to enjoy a laugh with friends. Penny Garman, Judi Garn, Terry Gaskill, Cris Gautier, Daniel Geer, Paul Geer, Larry Geisel, Beverly Geist, Jill George Mike Gephart, Craig Gerard, Rebekah Gerard, Julie Geschwender, Randy Gevaert, Sharon Ghant, Andrew Gilbert, Cindy Gill, David Gill Stan Gill, Steve Gill, Danny Gillespie, Ron Gilmartin, Bill Glassburn, Dennis Glover,PaulGoegebeur, Mark Goethals, Valerie Gorry Timothy Gosztola, Michael Gould, Ron Gradeless, Lewis Grant, Julie Gratzol, James Graves, Leslie Graves, Alan Graybosch, Attea Guidi Patsy Gunter, Tina Gunter, Joan Gurske, Kathy Haberle, Paul Hafer, Sue Hall, Karen Harder, Cheryle Harman, Kevin Hartley Deena Hartz, John Hawkins, Andy Hayes, Debbie Hazlewood, Marcia Heeter, Toni Henke, Mike Hensley, Wayne Henzel, Kathy Herron Individuals—159 English classes offer expression skills Mickey Hesch, Terry Hess, Tom Hickey, Becky Hildebrand, Tony Hill, Tim Hinton, Vivian Hively, Jim Hixenbaugh, Pat Holcomb Tim Halland, Rosemary Holmes, Darlene Holtsclau, Mandy Hook, John Horvath, Lori Hostetler, Ellen Houghton, Diane Howard, Debbie Howch Jim Huemmer, Ed Huff, Moe Hufkins, Kim Hull, Mary Humes, Bob Hunsberger, Rebecca Hunsberger, Ann Hitchens, Diane Ice Kirk Janowich, James Jennings, Kevin Jodway, Bob Johnson, Dave Johnson, Ellen Johnson, Mary Johnson, Mike Johnson Bill Jones, Doris Jones, Pam Jordan, Rex Keel, Scott Keen, Chery! Kellett, Kristi Kent, Jeri Kerchner, Brenda Ketring Kim Kindig, Bob Kindley, Dennis Kinzie, Tim Kizer, Cathy Koc, Jerry Kohler, Judith Kolkicwicz, Stephen Kollars, Cheryl Kronewitter Larry Kucsmanski, Debbie Kuharic, Paula Kleiser, Connie Kline Deborah Kyle, Amy Lacy, Gary Laffin, Linda Lambrechts Pam Laug, Greg Langel, Terry Lanning, Bill Lanning Brian Lannoo, Randy Leazenby, Joey Leniski, Jo Ann Lias 160—I ndividuals “JUNIOR” QUIROZ is caught daydreaming during grammar in Miss Barbara Mayer’s Freshman English | class first hour. Class pictures bring smiles, mild anxiety U_RA@IR SRL D eG see eitieess FROSH SUE ROBINSON, Nancy Flood and Debbie Reed get ready for the big moment on class picture day. Students posed during English class. Cpr te oe ae ee aes | Aidt ak nt we Bagi Pees tats PEE WHEE gs ¥ Linda Little, Rosemary Logan, Janet Loug, Ron Lovellen, Ricky Lour, Sue Lowe, Beverly Luccki, Richard Maller, Pam Marrs Claudia Marlin, Cathy Makielski, Laucey Malstaff, Gregory Marchant, Susan Martsoif, Donna Martin, David Martin, Jeanette Martin, Richard Mariotti Mike Markham, Nancy Marsh, Cindy Mathias, Beth Matthews, Karen Matthews, Brenda Mattson, Robert Matz, Debbie May, Laurel May Linda May, Elaine McCool, Diane McCracken, Lynn McDonald, Dan McLemore, Sandy Meidel, Jill Melin, Carolyn Melson, Donna Merriz MaryLou Metzner, Dale Meyers, Dawn Michallis, Margie Midday, Louis Mihajlovich, Cheryl Mikulyuk, Vicki Miles, Denis Milliage, Craig Miller Linda Miller, Michael Miller, Sheila Miller, Bill Miller, Sandie Mitchell, Tyrone Mitchell, Barbara Moe, Tom Montgomery, Debbie Moore Individuals—161 Freshman teams do well through seasons Sharon Moore, Cherie Morris, David Morris, Tom Movisetti, Don Myers, Paula Myers, Rita Nard, Debra Needham, Karen Neises Darlene Nelson, Dennis Nelson, Perry Nelson, Stevie Nelson, Linda Nielsen, Dave Niemier, Cathy Nichols, Pam Nichols Tom Nichals, Diane Nix, Steve Nixon, Michele Nolen, John Norris, Dave Northcut, John Null, George Obren, Kirk Obren Cindy O’Connell, Martin O'Connor, Dave Oler, Kathy Osborn, Randy Osborne, Terry Osborne, Mary Osmanski, Sherry Bewalt, Becky Otterstein Dave Overman, Kent Pajor, John Palatinus, James Palmer, Dennis Parker, Nancy Parker, Rick Patterson, Dave Paulsen, Dwight Peebles FRESHMAN CHEERLEADERS open a football pep session as the crowd enters for the first volunteer session of the year. 162—Individuals Frosh float ties Sophs for creativity Rick Penrod, Pat Perri, Joseph Pesut, Debbie Place, Arthur Pletcher, Jim Pola, Theresa Pola, Gary Potts, Larry Potts Barry Power, Pam Praklet, Bruce Pratt, Donald Price, Patty Price, Randy Pride, Susan Pringle, Barbara Purrell, Jim Putz Kenneth Quam, Joanne Quig, Eliberto Quinoz, Sandra Ramsey, Fanny Randolph, Terry Releran, Kim Rea, Sharon Reaker, Elaine Reasor Kathy Redman, Michele Reed, Terry Reeder, April Reid, Sandy Reiter, Bob Reynolds, Diana Reynolds, Jill Reynolds, Sue Rhoade John Rice, Sandy Rich, Randy Richards, Tim Richmond, Neil Rish, Leonard Robbins, Sue Robinson, Teri Robinson, Eldon Robinson Terry Rodich, Tom Roesener, Mike Rose, Daniel Rosenwasser, Brad Roush, Tony Rucano Mark Ruthowski, Valerie Sailor, Kathy Sandefur,DonSater, Richard Schaphorst, Jean Scheibelhut Kathie Scheibelhut, Mark Schmanski, Joe Schmitt, Ray Schoen, Mariella Schortgin, Jim Schrader Craig Schroeder, Carol Seggerman, Sue Senff, Marisa Suge, Frank Severa, Linda Schafer Patty Sharp, Gilbert Shaw, Timothy, David Shingledecker, Patricia Shingledecker, Sandy Sierens Individuals—163 Spirit builds at Merrifield Park rink Susan Silvers, Agnes Simbeck, Rick Siri, Chery] Smith, Connie Smith, Kirk Smith, Laura Smith, Robert Smith, Sharon Smith Ron Sobecki, Thersa Sommer, Steve Soule, Suzanne Spain, Curt Springman, Kim Squibb, Terry Squibb, Ken Stafford, Darlene Stalcup Nietta Stanisci, Steve Stanag, Jon Stanley, Sue Starr, Karen Steele, Sharon Stein, Kathy Stephenson, Jeff Sterzik, Richard Strahan Frank Strantz, Liz Strantz, Debbie Stratton, PaulStraughn, Theresa Stringer, Jackie Strock, LouAnne Stoeckinger, Marianne Stoeckinger, Janet Stopper Donna Stout, Sue Swartz, Julie Sweeney, Gary Tam, Janet Tam, Gary Tate, Randal Tavernier, Debbie Taylor Leigh Taylor, Anita Thomas, Mark Thorton, Jackie Tolley, Sandy Tomaszewski, Debra Tomber, Brian Toth, Wayne Triola, Sally Tuma Debby Tuttle, Marcia Tyler, Brian Vaerewyck, Valerie Vallance, Roger Van Arsdale, Mark Vander Hayden, Vicki Van De Voorde, Ralph Vandergriff, Sue Van Rie Sandy Varner, Bruce Veno, Julius Vergauwen, Vicky Verspelt, Diane Vicsek, Kirt Wagner, Carolyn Wallace, Robert Wagner, Jenny Ward Debbie Waumers, Kevin Weaver, Jenie Webber, Nancy Weeks, Marcia Welch, Deborah Wenker, Darlene Wenzel, Mike Whalen, Brenda White Nancy White, Pat White, Tom Whitaker, Jackie Wilburn, June Wilder, Rick Wileman, Janet Wiley, Jay Willans, Louis Willekens 164—I ndividuals FRESHMAN TRACY RADCLIFFE and her boyfriend Walter Brown share a laugh over pictures in the sponsor room. Chery! Wilma, Nancy Wilma, Greg Williams, Laurence Williams, Debbie Willoughly, Kathy Wilson, Steve Wilson, Danney Witt Bill Woodraff, Bob Wright, Edwin Woycikowski, Jim Yancy, Chris Zeakey, Carla Yoder, Mile Yocum, Connie Young, Kevin Young, Charles Zavor Individuals—165 Tiere he | ‘ee cs ws Pe, ag eee eee ee Soe en a Community _ Stores, restaurants, theatres, and banks Gave service, furnished products, And entertained... “ Money earned was spent Or saved; CTT akcmyo)[Vige-Yomelamel fey tals Guys rebuilt their cars, Friends met downtown To just look around, és Getting to know the store owners = And clerks, shopping for bargains, oO Or using a charge... . 3 ee Sy olerarelTaredeclare MlaNicrs dial p eos Students matured, Accepting another aspect Oh miarel ureter nae ‘Advertising—1 67. SCOTT FORE, ALLTOLD editor, is impressed with facili- ties found in the First National 168—Advertising ar ® . ete ep oe ee ee Pa ie i Ps @ —_ pad bow - Hil ua Skeet mek ee ReneS og peewee a First National Bank of Mishawaka gives MHS’ers full service banking High school students are finding it increasingly hard to hold on to their few dollars monthly income. But those who forsee more education, a new car, marriage, Or a summer vacation have already begun saving. The First National Bank of Mishawaka is helping students save for their future. Since its establishment over 70 years ago, the First National Bank has changed its ideas to fit the modern times. As a member of the Federal Depositors In- surance Corporation, they can guarantee a savings account up to $20,000. Being a full service bank, the First National Bank is open to serve the public each Monday, Tuesday, and Thursday 9:00 a.m. till 5:00 p.m.; Wednesday 9:00 a.m. till noon; Friday 9:00 till 5:30 and Saturday 9:00 till noon. In dealing with the bank one will find there are five convenient locations to meet your banking needs. The First National Bank’s main office is at 101 Lin- coln Way East and the drive-in bank, with 3 car win- dows and a walk-up window for ease and convenience, is located on the corner of Main and Third Streets. The First National Bank’s main office is at 101 East The other locations are the Northside Branch at 101 East Mishawaka Avenue, the McKinley Avenue Branch at 403 East McKinley, and the Osceola Branchat 850 Lincoln Way West. So, in order to get a grip on the future start now with a grip on your money by Opening a savings account at the First National Bank. The money you save with them is money you save for yourself. Visit Gilbert’s Up Shop, today’s place to shop for all those year-round fashions. What other department in the downtown Mishawaka area caters to the girl of the now generation in a setting of orange butterfly wallpaper, moving background music, and her own peers to help her select that “just for her’’ outfit? Whether it’s a sleek evening ensemble or a casual jumpsuit, one can be sure to find it among the Gilbert’s line of quality merchandise. Bathing suits and beach cover-ups, jeans and shirts are available for casual wear during the summer months. From shoes to coats, minis to maxis, Gilbert’s promises to give its customers the best possible in service and apparel, and at prices that fit that on-the-go budget of today’s fashion-con- scoius female. OUT KNEW I'D find you here!’’ laughs Beth Barrett as she bursts through the swining “‘bar doors’’ at the Up Shop. FUN TIME! as employees Cindy Shafer and Beth Barrett leave their duties to “‘ham it up” with Janet Fox. CINDY SHAFER gets into the spirit by modeling a maxi- length, mini-priced summer creation found at Gilbert's. Siar Sandy’s provides meals, service; dairy aids city MHS students enjoy spending lunch hours and time after school at Sandy’s, one of a chain of stores serving hungry teens in the Mishawaka area. Quick service and good food leave plenty of time for conversation and planning coming activities. Many students found Sandy’s the best place to meet and celebrate football and basketball victories. Those involved in dramatic productions and publications often stopped off at Sandy’s for a snack after their long hours were over. One of the places where the freshest milk and milk products are found in the area is Mishawaka Farmers Dairy. Serving Princess City residents with the finest in dairy products, always fresh and always nutritious, Mishawaka Farmers Dairy stresses quality and satisfaction, with home delivery serving all who wish it. Many alumni of MHS now work at the dairy, mak- ing sure present and future MHS’ers get the best of milk and milk products at the most reasonable price. SENIOR BRIDGET LOUGHLIN likes to spend her lunch hour at Sandy’s, enjoying a Big Scot, fries, and a shake. MR. CHUCK VAN PARIS tells Student Council President of the merits of milk from Mishawaka Farmers Dairy. 170—Advertising SENIOR JOHN MARSH AND MHS alumni Shirley Will examine the latest line of rings at Will’s Jewelry Store, 107 LWE. Wills specializes in fine silverware and diamond setting, and has been serving the people of Mishawaka since 1933. MRS. DOTTIE LATHAM assists Tom Schnaible and Sue Riederer, both all-star seniors, in choosing senior charms at Andros Photography Studio in downtown Mishawaka, where quality pictures and fast ser- vice make Andros Mishawaka’s leader in photographic work. MAN'S BEST FRIEND is the B K hot dog, according to Cathy Wagner. Good food and delicious root beer make a stop at B K a stop for good taste in food in Mishawaka. Advertising—171 STUDENTS FIND a wide selection of good reading matter at Mishawaka News Agency, in the heart of downtown. DAN BILANCIO examines a unique ring at the Novelty and Antique Store, located on Church St. SMART PEOPLE BANK their money at Mishawaka Federal Savings Loan located at 121 South Church Street in down- town Mishawaka, Indiana. MHS students will find Misha- waka Federal Loan a nice place to place confidence in their savings power and interest earnings. 172—Advertising 4 ree. ‘igs oem i banki h food “MHS’ers enjoy banking, shopping, foo | | What could possibly be more tantilizing than i LUIGI’S pepperoni pizza covered with sausage and rich mozerella cheese after a 19-0 defeat of Penn by the Mishawaka Cavemen’s football gridders? LUIGi'S offers more than “just good pizza.’ They feature a variety of hot sandwiches, all served with Luigi’s spicy sauce, and ready to go in a few minutes. In business for the pizza-lovers of Mishawaka and the area, LUIGI’S is the scene that many MHS’ers make after games, plays and just plain ‘fooling —e ; around.” Pizza can make your next bash even better. ° Tialian Italia: a When you aren't eating pizza, MISHAWAKA FED- a BEEF Sones . ERAL SAVINGS AND LOAN advises that you ; ae Sy _ “stash your cash” in their vaults. Interest rates are as high here as the law allows and you are always greeted with fast, courteous service. FEDERAL SAVINGS AND LOAN is located here in Mishawaka for the use of the students of Mishawaka High School as well as the citizens of the city. Mishawaka Federal Savings and Loan is the place for your college fund and other future funds. DAN SWADENER makes a pizza for approaching customer Jon Gratzol at Luigi’s Pizza on Mishawaka Avenue. Bray d a ‘ ; ts ®Seventh at West Street “Things are just a little bit nicer Lincoln Way East at Church Street Bank Tiist Advertising—173 Bibs Pek { 4 - a Ee eas ee i ij 2 $ UPPER LEFT, THREE friendly members of the Farmers In- surance Group; Tommy Housouer, Joe Davis, and Jim Goff. ABOVE, BRAZILIAN FOREIGN exchange student Claudio Braga samples a very American can of Coca-Cola. RIGHT, MHS STUDENT Dan Rice studies the values of fine furniture at Christianson’s in downtown Mishawaka. 174—Advertising 44 Se, MHS Teens like Town Shop quality The Town Shop located at 113 Lincolnway East in downtown Mishawaka has recently received a face- lifting with new larger display windows and a brick front. The interior of the shop has also been remodel- ed to include more dressing rooms and a larger shopping area. The Town Shop offers something for every fashion- conscious buyer. Pantsuits, the most popular item of the season, may be found in all shapes, sizes, and colors ranging from the casual, for everyday wear, to yy) a ._+_j— xy = the formal, for dress or evening wear. To accentuate ies My) oe ee A! 4 _ any outfit, scarves can be worn as belts, hairbows, or to tie around the neck. The Casual Corner, a new addition to the shop, features “‘in’ clothes by WHITE STAG. There are slacks, shorts and pantsuits in sizes from 5 to 16. Matching, or coordination tops and blouses in many colors are always available. There are swimsuits, for the teen-age figures or the classic one-piece designs for the more mature figures. The jewelry counter offers a variety of fine pieces of costume jewelry, including silvery necklaces, arm bracelets, and dangling earrings. Pajamas and robes in bright colors and various fabrics complete the wide selection of fine clothes at Town Shop. SENIORS Debbie Lamb and Debbie Young try on some of the pant suits at Town Shop in downtown Mishawaka. FOR THE SUMMER DAYS, Town Shop offers a variety of swimwear, including the orange and white bikini below. VALEDICTORIAN PAUL WALKER relaxes a moment with Chris Wroblewski. Paul leads the Class of ‘71 in scho- lastic honors. JOHN MARSH, SALUTATO- RIAN, demonstrates that hon- ‘or scholars are very capable of living the lighter side of life. 176—Senior Honors Walker, Marsh lead senior class Paul Walker has achieved the honor of being valedictorian of the Class of 1971. An Honor Society member and president during his senior year, Paul has excelled in the college preparatory program. Salutatorian John Marsh, second in his class, has been active in drama and journalism, and is also a member of the National Honor Society. Members of the Class of 1971 who merit recogni- tion on the Senior Honor Roll are listed here. They are: Mark Badders, Edward Baiz, Beth Blue, Paulette Brennan, Jerry Brothers, Vicki Butcher, Chris Carney, Dennis Carter, Jackie Claeys, Kathy Cunningham, Linda Davis, Patricia Davis, Gary DeMeester, Philip DeVolder, Mark Dicken, Lisa Ermeti, Eileen Fischer, Janet Fox, Jerry Fox, Cindy Freed, Rosemary Hay- den, George Hickey, Howard Hull, Bob Huyvaert, Del Rae Johnson, David Kline, Nancy Knisley, Lewis Kobold, and Zahn Kowalski. Also, Debbie Lamb, Bridget Loughlin, Cynthia Maenhout, John Marsh, Stan May, Kathy Micinski, Mark Miller, Susie McManus, Mary Nichols, Becky Nielsen, Betty Perri, Marsha Pooley, Fran Pringle, Marilyn Rigley, Eric Rodts, Christine Shidler (Ipe), Terri Schiffer, Becky Schmidt, Linda Schroeder, Becky Semenak, Alicia Shingledecker, Debby ' Gail Stamper (Gilvim), Sue Streich, John Van —- Abeele, Debbie Van Rie, Paul Walker, David Wilson, Chris Wroblewski, Debbie Young, and Cindi Zieke. A RAY ALDRICH .. . General; Football 1,2,3; M- Men 2,3,4; Wrestling 1,2,3,4 BETTY ALEXANDER ... General CINDY ALWINE .. . General; Hall Guides 2,3,4:; Latin Club 3;3; Y-Teens 4 GARY AMMERMAN ... College Prep; ALLTOLD 3,4; MISKODEED 3,4, Sports Editor 4; Science Club 2,3,4, Vice-President 4; Track 1,2,3,4; Quill Scroll 4 DANNY ANDERSON .. . General; Human Rela- tions Club, President 4; Art Club 2,3, Vice- President 3,4; Swimming 3 JANICE ANDERSON . .. General; Business Club 2,3,4; Y-Teens 1 JOHN ARMSTRONG .. . Pre-Engineering; Math Club 2,3,4 LINDA ARNOLD .... General; Business Club 1,2, 3,4, Vice-President 3; Home Ec Club 1 DEAN ASHBAUGH ... Pre-Engineering; Hi-Y 3,4; Math Club 3; Stage Crew 3,4; Tennis 1,2,3,4 B MARK BADDERS .. . College Prep; Hall Guides 2,3,4; Football 1; National Honor 3,4 ED BAIZ .. . Pre-Engineering; Hall Guides 2,3,4; Math Club 4; Sgt.-at-arms; National Honor 4 TED BALLARD ... Bookkeeping PHIL BARBERA... Business; Business Club 4 PAUL BARKER ... College Prep; Student Council 2,4; Hi-Y 2, Vice President 2; Latin Club 2,3; Band 1,2,3,4; Dance Band 3,4; Pep Band 3,4; Tennis 3 DEBBIE BARNES ... General; Home Ec Club BRENDA BARNETTE (EISWALD) . . . College Prep; Naples High; Naples Fla.; Art Club 3; French Club 1 DALE BARNETTE .. . General; Hall Guides 2; M-Men 4; Wrestling 1,2,3,4 BETH BARRETT College Prep; B oard of Control 3; Student Council 3 PAM BARRETT . .. College Prep; Office Assistant 3,4; Art Club 3; Human Relations 3; Latin Club 3; Red Cross 3; Y-Teens 1,2,3; Student Boosters 4 CELESTE BAUTERS .. . General; Business Club 3,4; Red Cross 4; Y-Teens 1 DARCIA BEERY ... General; Spanish Club 3 TOM BENFORD .. . General; Craftsmen Club 3; Spanish Club 1; Baseball 1,2,3,4; Football 1,2,3,4; M-Men 3,4; Wrestling 1 ANN BERGIN ... College Prep; Hall Guides 3,4; Latin Club 1; Y-Teens 1,2,3,4 RON BETZER ... Trade; Craftsmen Club 3; Hall Guides 3; Baseball 1,2,4; Football 1,4; M-Men 4 DANNY BILANCIO . .. General; Science Club 2,3 PAULA BILLER ...Stenography; GAA 3,4 Activities, honors reported in Directory PEGGY BLAIR ... College Prep; HALF A SIx- PENCE 3; BLITHE SPIRIT 4; German Club 3,4, Secretary 4; History Club 3; Hal! Guides 3,4 BETH BLUE .. . College Prep; ALLTOLD 3,4, Editorial Editor 3; MISKODEED 3,4, Editor-in- Chief 4; Y-Teens 1,2; Orchestra 1,2,3,4, Orchestra Council 3; National Honor 4; Quill and Scroll 3,4; Music Honor 2,3,4; BRIGADOON 2: CAROUSEL 2; MY FAIR LADY 3 JOHN BOGGS ... General: Hall Guides 2 CONNIE BORDNER .. . General; Business Club 2,3,4; Red Cross 3; Y-Teen 4; FTA 4; Future Medical Careers 4, Treasurer 4 KRIS BOSLER .. . General; Student Council 1,2,3; MISKODEED 3,4, Senior Editor 4; Business Club 4; Spanish Club 3; Y-Teens 1,2,3,4, President 4; Human Relations Club 3; Quill and Scroll 4 DAVID BOTTORFF .. . College Prep; German Club 1,2; Latin Club 3; Band 1,2,3,4 DAVE BOWMAN ... College Prep; Science Club 4; Spanish Club 2,3; Math Club 4; Baseball 3,4 GENE BRADDOCK . - . General; Angola High, 1,2; Band 1 PAULETTE BRENNAN .. . Stenography; Office Assistant 3; Business Club 3; Hall Guides 2,3; National Honor 4 CINDY BRINK... General GARY BRISCOE ... Trade DAN BROCKWAY ... Genera! JERRY BROTHERS . College Prep; Student Council 4; Science Club 4; National Honor MR. MERLE BLUE of the Social Studies Department illustrates bridging the generation gap, posing with his daughter Beth before the Sadie Hawkins Dance. Music, hall guides demonstrate service Society 4 SANDY BROWN .. . General; Nurse’s Assistant 2; Business Club 3,4; White Caps and White Coats 2,3 MARY BRYAN... College Prep; French Club 2,3; Hall Guides; Y-Teens 1,2,3,4; Orchestra 1,2,3,4 KATHY BURKOWSKI .. . Stenography; Business Club 2,3; Human Relations Club 4; Y-Teens 1 PAT BURNS ... Clerical VICKI BUTCHER... College Prep C LARRY CAMPARONE ... General; Football 1,3 TOM CANARECCI .. . General; Craftsmen Club 3,4; Hall Guides 2,3; Baseball 1,2,3,4; Basketball 1; M-Men 4 GARY CARLSON ... College Prep; Hall Guides 4; Golf 2 CHRIS CARNEY .. . College Prep; Student Coun- cil 1,2; Of fice Assistant 4; MISKODEED 3; BLITHE SPIRIT 4; Business Club 3; French Club 1; Hall Guides 2; Y-Teens 1,2,3; National Honor Society 3,4 DENNIS CARTE .. . College Prep; French Club 1; Hall Guides 1,2; Science Club 3,4; A Capella 2,3,4; Chamber Singers 3,4; Choraliers 3,4; Madrigals 4 LINDA CARTER... General; PVE; Penn High 1 MARK CERRI . General; Halli Guides 1,2; Baseball 1,2 BECKY CHAPMAN . 1,2,3; Art Club 4 NANCY CHILCOT ... Clerical; LaSalle High 1,2; Business Club 4 JACKIE CLAEYS ... College Prep; Library Assis- tant 3; Business Club 4; Treasurer 4; Hall Guides 3; Spanish Club 2,3, Treasurer 3; Y-Teens 1; Student Boosters 3; National Honor Society 4 GARY CLARK... Trade PAT CLAYBORN ... College Prep; Y-Teens e253 . General; Adams High JOHN MARSH, active in drama, journalism and music, participated in many organ programs. MIKE CLAYTON ... General; Riley High 1,2,3 SHARON CLINE .. . College Prep; Student Coun- cil 1,2,3; Office Assistant 3; Human Relations 3; Y-Teens 1,2; GAA 2,3,4; Point Chairman 4 LISA COLLINS ... Clerical; Business Club 4; Hall Guides 1; Human Relations 4; Y-Teens 1,2,3; Student Boosters 3; GAA 2,3,4 HAROLD COLVIN... General BONNIE CONRAD . . . Bookkeeping; Business Club 4 TIM CORYN ... General BILL COX ... General ROMA CROCKER .. . Clerical; Business Club 3,4; Hall Guides 1,2,3; GAA 2,3,4, Vice President 4 CECIL CROOK .. . General; Football 1,2,3,4; M-Men 3,4; DAVE CRAIG . . . General; Hall Guides 2; Track 1,2; Wrestling 1,2 KATHY CUNNINGHAM . . . College Prep; Hall Guides 3; Red Cross 2; Spanish Club 2,3; A Capella 4; Future Teachers 1,2,3,4, Scribe 1; Vice- president 3,4 MIKE DARBIN... Pre-Engineering; Hall Guides 2,3,4; Spanish Club 2 CHRIS DARE Trade; BRIGADOON 2; TEAHOUSE 2; FAIR LADY 3; MIRACLE WORK- ER 3; DRACULA 3; A Cappella Choir 2,3,4; Band 1,2,3,4; Chambers 3,4; Choraliers 2,3,4; Madrigals 4; Thespians 4 LINDA DAVIS... Stenographic; Warsaw Com- munity High School, Warsaw, Indiana, 1,2; Office Assistant 3,4; Business Club 3,4; Red Cross Club 3; National Honor Society 3,4; Secretary 4 PAT DAVIS .. . College Prep; Hall Guide 3,4; International Relations 3, Vice President SNe Teens 1; GAA 2,3; National Honor Society 4 MARY DEBROKA . . . General: Hall Guides 4; Home Ec Club 1,2, Readers Guild 1 JAMES DEGEETER ... General CINDY DELAURELLE .. . Home Ec; Art Club 4; Business Club 3; Home Ec Club 1,2; Y-Teens 1,3,4; FMCC 4; Vice president 4 LINDA DELOOF ... General; Student Council 4; Business Club 2,3; Secretary 3; Red Cross 1,2; Y-Teens 1,2,3; Student's Boosters 3; Treasurer 35 Choraliers 1,2,3; GAA 3,4 LINDA DEMAEGD ... Clerical; Business Club 3; Hall Guides 3; Y-Teens 1,2,3; Student Boosters 3 GARY DEMEESTER .. . College Prep; Science Club 3,4; President 4; Band 2,3,4; Math Club 4 CAROL DEMUELENAERE ... General JOE DEMUELENAERE . .. General; Basketball 1; Football 1,2; Golf 1,2,4 DAN DENTINO ... College Prep; Student Council 3; Hall Guides 4; Spanish Club 2,3; Basketball ds Football 1; M-Mens Club 2,3,4; Secretary and treasurer; Wrestling 1,2,3,4 OLETHA DERRICKSON .. . College Prep NANCY DEVOLDER .. . College Prep; CINDER- ELLA 3; Hall Guides 2,3,4; International Relations 4; Spanish Club 2; Y-Teens 1,2,3; Student Boosters SEPA 2 PHILLIP DEVOLDER... EILEEN DEWULF .. . College Prep; Board Of Control 2, Secretary 2; Student Council 1,2; ALL- TOLD 2; French Club 3 ; Y-Teens 1,2; Student Boosters 3; Cheerleader 2,3,4 MARK DICKEN . .. College Prep; MISKODEED 4, Business Manager 4; Business Club 1; Debate 4; Latin Club 1,2,3; Science Club 3,4, Sergeant-at- Arms 4; Band 1,2,3,4; Stage Band 4; National Honor Society 3,4; Junior Kiwanian 4 DOUG DITSCH ... General BOB DOTY .. . College Prep; Office Assistant 3,4; Hall Guides 2,3; Baseball 1,2; Basketball 1,2,3,4; Golf 3,4; M-Men 3,4 VICKIE DOYLE .. . Stenography; Business Club 2,3,4; FTA 1; Y-Teens 2,3; Band 1,2,3,4 MARSHALL DYE ... General DON DZVONAR... Trade E RICK EBERHART... General; Band 1,2,3,4 DON EISWALD ... College Prep; Student Council 1,3; Hall Guides 3,4; Spanish Club 1,2: Baseball 1,2,3; Football 1,2,3,4; M-Mens 2,3,4; Wrestling 1,2 TERRY ELING ... General; Human Relations 4: Red Cross 1,2,3,4; Science Club 2,3; Stage Crew 4 JILL ELLER . . . Stenography; Spanish Club 2: A Capella Choir 3,4; Cecilians 3,4; Chamber Singers 4 FLINT ELLIOTT General; Adams High School, 3 LAURIE ELLIOTT... General CONNIE EMERY .. . General; History Club $} Secretary 3; Red Cross 1; Band 1,2,3; Future Medical Careers 4, Secretary 4 KATHY EPPERSON . .. General; Business Club Zs Future Medical Careers 4 LISA ERMETI . . . College Prep; ALLTOLD 1,2,3, Page 1,4 Editor; MISKODEED 4, Academics Edi- tor 4; Debate 2,3,4, Co-Captain 4; FTA 1; Human Relations Club 4, Vice-President 4; Spanish Club 1,2; Band 1,2,3,4; National Honor Society 3,4; Quill Scroll, Secretary 4; CAROUSEL 3: BLITHE SPIRIT 4 MARY KAY FAGAN... Stenocraphy; Student Council 2; Nurse’s Assistant 3; Cheerleader 2,4 BEV FIELDS... General; Business Club 4 DENNY FIELDS ... Trade; A Capella Choir 4; Track 1,2,3; Music Honor Society 4 EILEEN FISCHER .. . College Prep; Marian High School 1; MISKODEED 4, Underclass Editor 4; Business Club 3; Hall Guides 3; Latin Club 2; Y-Te ens 2,3; Quill Scroll 4 DARRYL FLECK... General; Hall Guides 4 VINCE FLORIDIA ... College Prep; Board of Control 4, Vice President 4; MISKODEED 3,4, Index Editor 4; French Club 1,2,3,4, Vice Presi- dent 4; Thespians 3,4, President 4; CINDERELLA 3; MY FAIR LADY 3 a 6 2 ee a CF ee _ a DAN FOWLER ... College Prep; Student Boosters 3; Acapella Choir 2,3; Choraliers 2,3; Baseball 1,4; Basketball 1,2,3,4; Cross Country 1,2,3; M-Men 2,3,4 JANET FOX ... College Prep; Adams High School 1; Student Council 3,4; French Club 2,3; History Club 3; GAA 3,4, Secretary 4; National Honor Society 3,4 JERRY FOX .. . College Prep; Student Council 4, Vice-President 4; ALLTOLD 2,3,4; MISKODEED 3,4; Debate 4; French Club 1,2; Cross Country 1,2,3; M-Men 2,3,4; Track 1,2; Quill and Scroll 3,4 KRIS FRAZIER ... General; CAROUSEL 3; Art Club 2,3,4 CYNTHIA FREED . College Prep; Nurse’s Assistant 4; Hall Guides 3; Latin Club 3; White Caps 3; Y-Teens 3, Orchestra 1,2,3,4 CHRISTINE FRY ... General; Business Club 3,4 JAMES FRY ... General; Marian 1,2,3; Football 4 G PATTY GALLOWAY .. . General; French Club 3; FTA 1; Hall Guides 1,4; History Club 3; Vice- President 3. CHET GAMBLE .. . Pre-Engineering; Craftsmen Club 3, Vice-President 3; SHERRY GARDNER . .. General; Business Club 1,2,3,4. EVERETT GARRAGE .. . General; Craftsmen Club 4; Football 1,2,3,4; Track 3,4; M-Men 3,4; DIANA GARRETT ... General; Business Club 3; Y-Teens 1. GARY GAUTIER . . . College Prep; A Cappella Choir 2,3,4; Basketball 1,2,3,4; Football 1; THE LIFE OF a hall guide is usually busy, but here Greg Robertson stops by to say a good word to Terry Warner, as she waits for another call. M-Men’s 2,3,4. GRAY GAUTIER . . . General; A Cappella Choir 2,3,4; Basketball 1,2,3,4; Football 1; M-Men 2,3,4, VICKIE GEORGE .. . Home Economics; Flowing Wells High School, Tucson, Arizona 1; Book Guide 3,4, Secretary 3, Vice-President 4. GERRY GHERADI ... College Prep KATHY GILL ...General; French Club 3; Student Council 1,2,3,4; Y-Teens 1; Student Boosters 3; Cheerleader 1,2,3,4. JOHN GILMARTIN High School 1,2,3 CHARLES GISZEWSKI . . . General: Craftsmen Club 2,3; Hi-Y 4; History Club 3; Treasury 3. JAMES GOEBEL .. . General; Hall Guides 2 JOAN GOETHALS .. . College Prep; Student Council 3; Art Club 1,2; French Club 2; Red Cross 3,4; Y-Teen 1,2,3; GAA 2,3,4 RON GOOD ... General; Football 1,4; Wrestling 1 LAURA GORNEY ...Stenography; Business Club 2,3; Red Cross 2; Y-Teens 1; Co-op TOM GRAYSON .. . General; ALLTOLD 3,4; CINDERELLA 3; Latin Club 1,2; Band 1,2,3,4, President 4; Basketball 1,2; M-Men 2,3,4; Track 1,2; Quill and Scroll 3,4; Thespians 3,4 ROGER GRIGGS . . . General; Business Club 2 BOB GROVES .. . College Prep; ALLTOLD 3; Latin Club 2 AL GRUDZINSKI . . . General JOHN GRUDZINSKI... Trade CANDY GULATTA . General; Riley High School 1 ALAN GUNTER ... General; Track 3,4 GAYLE GUSHWA . . College Prep; Student Council 3,4, Treasurer 4; ALLTOLD 2; MISKO- . College Prep; Marian DEED 3; Art Club 1,2; French Club 2,3; Y-Teens 1,2; Band 1 CAROL GUYTON . Guides 4; Latin Club 2; Red Cross 2,3; Band 1,2,3,4 . . General; FTA 1,2; Hall H PAT HAMMER ... Trade JOE HARDMAN ... General; Baseball 3,4 DAVE HARRIANGER ... General; Student Coun- cil 1; Readers Guild 1; Cross-Country 1,2; Track 1) 2 e! PATTY HARRIS . . . Stenography; Student Coun- cil 2,3; Business Club 3,4; Human Relations 3,4; Y-Teens 1,3,4 TIM HARVEY ... Trade ROSEMARY. HAYDEN High; French Club 3,4 RITA HAYES .. . General; San Pierre High; GAA 2 . . . College Prep; Central MIKE HEINTZBERGER .. . General: Swimming 1,2,3,4 JUDY HEMBRECHT ... General; Washington High 1 DOT HERRON ... General CONNIE HESCH .. . General; Business Club 2 Baseball 1; Football 1; Wrestling 2 MAUREEN HIGGINS ... Home Ec; Business Club 2; Hall Guides 2,3,4; Red Cross 3; Y-Teens 1 BELINDA HIGHLAND ... General; Penn High 1 PAUL HOFFMAN .. . Trade; BRIGADOON 2: Hi-Y 2,3,4, President 4; A Capella 3,4, Treasurer 4: Chamber Singers 3,4; Choraliers 3,4 JAMES HOLBERT ... General; Adams High 2,3 LYNETTE HOLDEMAN . General; Nurse’s Assistant 3,4 RON HOLLINGSWORTH .... College Prep; Latin Club 3; A Capella 2; Chamber Singers 3; Senior Directory—179 Choraliers 3 DEE HOOD .. . General; Argo Community High 2,3; Readers Guild 3 BRENDA HOPPER ... General KAREN HOSKINS .. . College Prep; Student Council 4; MY FAIR LADY 3; French Club 3; Latin Club 1; Y-Teens 1; A Capella 3,4; Cecilians 3,4 LINDA HOUSAND ... General; FMCC 4 KENT HOUSOUER . . . College Prep; Student Council 1; French Club 2,3; Student Boosters 3; Band 1,2,3,4, President 4; Orchestra 3,4, President 4; Music Honor 3,4, President 4 KARI HOVINMAA . . . Senior Exchange Student; Tapiola, Finland 1,2,3; Student Council 4; Human Relations 4 JEFF HOWARD .. . Trade; Craftsmen Club 3,4; Football 1,2,4; M-Men’s 2,3,4; Track 1,2,3,4; Wrestling 1 MARIANN HOWLAND ... Clerical WAYNE HUFKENS ... General; Football 1 PAT HUGO . . . College Prep; Douglas McArthur High, Saginaw, Mich., 1; Latin Club 3; Y-Teens 2 HOWARD HULL . .. College Prep; Hall Guides 3,4; A Capella 2,3; Chamber Singers 2; Choraliers 2; National Honor Society 3,4 JUDY HUMES... General; Library Assistant 3,4 MARLENE HUSTON .. . General; Nurse’s Assis- tant 2,3; Swimming Assistant 2,3; Latin Club 2,3,4, Secretary 4; White Caps Red Coats 1,2,3,4, Vice President 3, President 4, Future Medical Careers Club 4 TERESA HUTSON .. . General; Hall Guides oF Band 2 BOB HUYVAERT .. . Pre-Engineering; Track 4; National Honor Society 3,4, DEBRA IPE ... Home Ec; Business Club 3,4; Y-Teens 3; GAA 2,3,4, Vice-President 4; Gym Assistant 4 LYNN IRVINE... General! J PAM JACKSON . . Clerical; Student Council 1,2,3; Hall Guides 1,2,3,4; Y-Teens 1,2,3; GAA 2,3,4, Treasurer 3 JANET JAFFEE ... Clerical; Office Assistant 3 CHRIS JOHNSON .. . Clerical; Business Club oe GAA 2,3,4; Office Assistant 2,3,4 DEL RAE JOHNSON .. . Stenography; ALLTOLD 3; MISKODEED 3,4; Band 2,3,4; Quill and Scroll 4 RITA JOHNSON . . . General; Hall Guides 4; Gym Assistant 3 SHIRLEY JOHNSON... General; Art Club 1 KEN JONES... General RICK JONES . . . Trade; BRIGADOON 2; Hi-Y 3: Stage Crew 2; Baseball 2; Tennis 1,2,3; Swimming 4 JIM JORDAN ... Pre-Engineering; ALLTOLD 3,4, Photographer; MISKODEED 3,4, Photographer; Science Club 3,4; Band 1,2,3,4; Quill and Scroll 3,4 K GREG KALIL .. . Pre-Engineering; Hall Guides 1 KATHY KELLEY ... Clerical LUANNE KIME ... General; Foods Assistant 4 CAROL KIMMEL ...College Prep; Art Club 2,3,4; Glee Club 1,2,3; A Capella 4; MISKODEED 3,4, Layout Editor 4; French Club 1,2; Student Council 1 LANCE KIZER ... College Prep; Art Club 4; Hall Guides 3,4; Track 2 JIM KLEISER ... General; Hall Guides 3,4 DAVID KLINE .. . Pre-Engineering; Hall Guides 2,3,4; Latin Club 3 JIM KLINGAMAN . . . College Prep; Wrestling 1,2 BETTY KLOPENSTINE ... Home Ec; MY FAIR LADIES OF RIVER CITY begin to accept Lee Ann Chelminiak, Marian, as they sing the reprise of Lee Ann wins over River City gossips LADY 2; STAR-SPANGLED GIRL 2; Readers Guild 1,2,3,4, Secretary-Treasurer 2, President 4; Red Cross 2; White Caps 1 CAROL KLOPFENSTEIN .. . General; BLITHE SPIRIT 4; Art Club 1,2,3,4; Red Cross 4; White Caps 4 NANCY KNISLEY . . . Accounting; Office Assis- tant 3,4, Business Club 2,4; Secretary 4; Y-Teens 15 A Capella Choir 4; Cecilians 4; National Honor Society 4 DENNIS KOBB ... General LEW KOBOLD . .. College Prep; Senior Class Vice President; Student Council 4, Sergeant at Arms 4; Art Club 2; Hall Guides 3,4; Baseball 2; Basketball 1,2,3,4; National Honor Society 3,4 RICHARD KOCHENDORFER... General; Audio-visual 2,3,4 CATHY KODBA ... General LAURA KORN ... General EDWARD KOVATCH ... General ZANN KOWALSKI . Stenography; Student Council 4, Secretary 4; ALLTOLD 3; MISKO- DEED 3,4, Organizations Editor 4; Business Club 4, President 4; Acapella 3,4; Cecilians 3,4; Chamber Singers 4; National Honor Society 4; Quill Scroll 4, President 4 LAURA KORN Y-Teens 1 ED KRONEWITTER ... General JEAN KRONEWITTER... Stenography; Hall Guides 3; Future Medical Careers Club 4 JOHN KWASNEY .. . General L DEBBIE LAMB .. . College Prep; MISKODEED 3,4, Associate Editor 4; Debate 2, OF AmIe2 +3: German Club 1,2, Vice-President 2; National Honor Society 3,4; Quill Scroll 4 BOB LAMIRAND ... General; Basepali 1 LARRY LANCASTER... General; Football 1,2, 3,4; M-Men’s 4; Track General; Hall Guides 3; “Pick a Little, Talk a Little” in “Music Man.” 1 STAN MAY ... MARGARET LARDON . . . College Prep; Spanish Club 2 MARK LARDON .. . General; Art Club 4; Human Relations Club 4 JIM LASKOWSKI . College Prep.; Student Council 1; German Club 1,2; Hi-Y 3,4; Golf 1,2, 3,4; M-Men’s Club 2,3,4 RICK LEAZENBY .. . General; Delta Junction High School, Delta Junction, Alaska 1 HERB LECHLITNER ... General; Craftsmen Club 3,4, President 3,4; Hi-Y 4; History Club 3; Track lez CHARMAINE LENISKI Choir 4; Band 2,3 DEBBIE LESLIE . . . General; Comstock, Kala- mazoo, Michigan 1; Y-Teens 4; A’cappella Choir 4; Cheerleader 1 LINDA LESLIE .. . Stenography; Business Club 1,4; Human Relations 4, Secretary 4 JANEL LEWELLEN .. . College Prep; French Club 3; Y-Teens 1 MARK LEWINSKI ... General; Student Council 4; Business Club 4; Hi-Y 4; History Club 3 BECKY LIDOLPH .. . College Prep; MY FAIR LADY 3; Spanish Club 2,3,4, Vice-President 3; A'cappella Choir 3,4; Madrigals 4; Chamber Singers 3,4; GAA 2,3,4, President 4 RANDA LINDENBERG . . Club 3 JOHN LOCHMONDY ... General; Hall Guides 3,4; Hi-Y 2; Science Club 3; Baseball 1; M-Men’s 3,4; Swimming 1,2,3,4 BRIDGET LOUGHLIN .. . College Prep; Board of Control 4, Secretary; French Club 1,2; Hall Guides 3,4; Y-Teens 1,2,4; GAA 2 TIM LOVETTE ... College Prep MICK LUKENS... General CLINT LYNCH... General; Hi-Y 1; Red Cross 4; Swimming 1,2,3 STEVE MADOU ... General; Marian High 1,2,3 RANDI MAES .. . Stenography HELEN MAGGERT ... General; Hall Guides 2,3,4; Library Assistant 4 SHARON MAGGERT ...P.V.E. DEIDREE MARKIN .. . General; Business Club 4; A Capella 4; Library Assistant 2,3 DAVID MARKS... General; Art Club 3,4 JOHN MARSH ... College Prep; ALLTOLD 2,3,4; MISKODEED 3; BRIGADOON 2; MY FAIR LADY 3; BLITHE SPIRIT 4; Book Guild 1; Trea- surer 1; French Club 2,3,4; A Capella 2,3,4, Presi- dent 4; Choraliers 2,3,4; National Honor Society 3,4; Quill and Scroll 3,4; Thespians 3,4; Music Honor Society 2,3,4 DIANA MARSHALL .. . General GEORGE MASTERMAN ... General THERESA MASTERS . . . College Prep; French Club 3,4; A Capella 4 College Prep; Redford High, Detroit, Mich. 1; German Club 4; National Honor Society 3,4; Treasurer 4; Junior Rotarian 4 CINDY MAYERHOFFER . General; John Adams High 1,2 CHUCK McKINNIS .. . General; A Capella 2,3,4; . . . General; A’cappella . Clerical; Business | Choraliers 2,3,4; Swimming 2; Ecology Committee 4 KAREN McLEOD .. . Stenography; Hall Guides 3,4; Human Relations Club 4; Science Club 2; Y-Teens 1 SUSIE McMANUS . .. College Prep; MISKODEED 4, Copy Editor 4; BRIGADOON 2; CAROUSEL 2; Human Relations 4; Latin Club 1,2,3,4, President 4; Y-Teens 1; A Capella 4; Chamber Singers 4; National Honor Society 3,4; Quill and Scroll 4 BARBARA MELTER .. . General; Marian High 1,2,3; Future Medical Careers Club 4 JOE MELTER ... General MARTY MEYERHOFER .... Clerical; Y-Teens | 1,2,3,4; GAA 2,3,4, Point Chairman 4 MARY MICHELLE .. . General; French Club 2; Y-Teens 1,2,4; FTA 4 | KATHY MICINSKI...College Prep; MISKODEED | 3,4, Student Life Editor 3,4; French Club 1,2,3,4, Treasurer 3, Vice President 4; Hall Guides 2,3; Red Cross 3; Y-Teens 1,2,3,4; National Honor Society 4; Quill and Scroll 4; MY FAIR LADY 3 KEN MILES ... Trade; Football 1 NANCY MILES (THOMAS) .. . General ‘BONNIE MILLER .. . General; Hall Guides 3,4; Y-Teens 1; GAA 3,4; BRIGADOON 2 BRAD MILLER ... General; Audio Visual 4 MARK MILLER... College Prep; Baseball 1,2,3,4; Football 1,2,3,4; M-Men 2,3,4; Wrestling 1,2,3,4; National Honor Society 4 MICHELLE MILLER . .. Home Ec; Main Twp. High 1,2; Hall Guides 3,4 RICK MILLER . . . College Prep; Football 1,2,3,4; Baseball 1,2,3,4; Senior Class President; Junior Class Vice President; M-Mens 4; Office Assistant 4; Wrestling 2,3 VIRGINIA MILLER... General TOM MINGLIN ... General; Hall Guides 2,3; Hi-Y 4; Cross Country 1,2; Track 1,2 BRUCE MISHLER ... Clerical; MY FAIR LADY 3; Hall Guides 1,2,3,4 KAREN MOORE (SILVERS) ... General GLORIA MOORE ... General; Nurse’s Assistant 3; Red Cross 2,4; White Caps 2 JOHN MORTIMORE ... College Prep SUE MUHME (POWERS) ... General THOMAS MURRAY .. . General; Clay High 1,2,3 CONNIE MUSZYNSKI .. . Stenography; Business Club 3; Y-Teens 1,2; Band 1,2,3,4 N JANET NAGY ... General: Y-Teens 4 PETE NAGY .. . General; Student Council is Band 2; Basketball 1; Hi-Y 4 KEN NEEDHAM ... Trade; Organ 1,2 BILL NEHMER... General SUE NEISES . . . College Prep; BRIGADOON 2; Spanish Club 2,3; Y-Teens 1; Student Boosters 3; A Capella 3,4; Cecilians 3,4; Chamber Singers 4; GAA 3 KEN NELIANS . . . College Prep; Hall Guides 1,2: Baseball 1 KURT NELSON .. . College Prep; Student Coun- cil 4; BRIGADOON 2; Book Guild 1; Business Club 1; Debate 3,4; German Club 1,2; Hi-Y 1,2; Latin Club 3,4; Orchestra 1,2,3,4; Track 2,3 RON NELSON ... General; Wrestling 1,2 ANNE NEWCOMER .. . College Prep; Book Guild 1,2,3,4, Treasurer 4; Hall Guides 4; Red Cross 1h 237! MARY NICHOLS .. . College Prep; BRIGADOON 2; Business Club 3; French Club 1,2; FTA 1; Latin Club 4; Band 1,2,3,4; Orchestra 2,4; National Honor Society 4 REBECCA NIELSEN . . . College Prep; Office Assistant 4; FTA 1; German Club 2; Hall Guides 2,3; Science Club 2,3; A Capella 4; Cecilians 4; National Honor 4 TOM NIX... College Prep; Baseball 2,3,4; M-Men 3,4 JIM NORRIS... General O BILL OBLINGER ... General CONNY ODLE General; A Capella 3,4; Cecilians 3,4 STUDENT COUNCIL PRESIDENT Frank Portolese takes off after an unknown target at MHS. Billy, rae y |S wee a ed : SENIORS AWAIT the opening number of the Indiana State University Percussion Ensemble featured at one of the second semester assembly programs at MHS. KATHY ODLE ... General; A Capella 3 JOANNE OLSEN . . . College Prep; French Club 1,2; Hall Guides 2,3; Spanish Club 3,4 JOANNE OLSZEWSK1I ... Clerical DIANE OVERHOLT ... General P GARY PARRISH ... General; Penn High 1,2,3 REBECCA PARKER ... General; Logansport High 1,2; HALF-a-SIXPENCE 4; STAR-SPANGLED GIRL 3; Art Club 3; Business Club 4; Y-Teens 1253 LARRY PARKS... College Prep; Wrestling 3,4 PAT PEIFFER ... Clerical JOE PENSKA ... General BETTY PERRI . . . College Prep; MISKODEED 3,4; Student Life Editor 4; BRIGADOON 3; Art Club 3; French Club 2,3,4, Secretary 4; FTA 2,3,4, Secretary 4; Hall Guides 2,3; Y-Teens 1,2,4; Na- tional Honor Society 4; Quill and Scroll 4 STAN PIECHOSKI ... Trade KEVIN PLETCHER... College Prep; Football 1; Wrestling 1,2,3; Band 1,2,3,4; Student Council RICK PLETCHER . .. General; Basketball 1,2,3,4; Football 1; M-Men 4 BOB PLONSKI . . . College Prep; ALLTOLD 3,4, Business Manager 4; Art Club 3,4; Hall Guides 3; Quill and Scroll 4; AFS 3 BASIL POHNOR ... General MARCIA POOLEY .. . College Prep; Matsusko Gakuen High School, Matsumoto City, Japan (AFS) Senior Class Secretary; Student Council PASE ALLTOLD 2,3; BRIGADOON 2: MY FAIR LADY 3; French Club 1; Spanish Club 2,3,4, President 2: A Capella 3,4, Vice President 4: National Honor Society 3,4, Vice President 4; Mishawaka Youth Council 3,4 FRANK PORTOLESE .. . College Prep; Student Council 4, President 4; ALLTOLD 3,4, Feature Editor; MISKODEED 3; Hall Guides 3; Spanish Club 1,2; Quill and Scroll 3,4, Vice President 4; Music Man 4 RON POWELL ... College Prep; Hall Guides PA Ce ke Science Club 2; Spanish Club 2; Football 1: Golf 1,2,3,4; M-Men 2,3,4 BILL POWER .... College Prep; Office Assistant 3,4; Science Club 1,2; Basketball 1; Football ee 3,4, Captain 4, Most Valuable Player; M-Men 2.3.4: Vice President 4; Track 1,2,3,4 FRAN PRINGLE College Prep; Nurse’s Assistant 1; MISKODEED 3,4, Senior Editor; 182—Senior Directory CINDERELLA 3; French Club 1,2,3,4, president 4; White Caps 1; National Honor Society 4; Quill and Scroll 4 JEANNINE RAMOS .. . College Prep; Hall Guides 3,4; Spanish Club 3; Y-Teens 1 DEBBIE RANDOLPH . . College Prep; CAR- OUSEL 2; CINDERELLA 3; Latin Club 2,3; Y-Teens 1,2; Student Boosters 3, Secretary; A Capella 3; Cecilians 3; GAA 2,3,4; Thespians 3,4 PAUL RANSBERGER .. . . Pre-Engineering; Band 1,2,3,4, Treasurer 4; Orchestra 1,2; Math Club 3,4; Science Club 3; Stage Crew 3,4; Latin Club 3 STEVE REDMAN ... General MARGARET REED... Home Ec; Business Club 3 CANDI REITER... Business; Marian High 1,2,3 DAN RICE ... General; Foxcroft Academy, Maine 1,2; Art Club 2,3 PAT RICHARDSON . . . General; A Capella 3,4; Cecilians 3,4 SUE RIEDERER .. . College Prep; BRIGADOON 2; MY FAIR LADY 3; Business Club 4; Latin Club 2,3, Secretary 3; White Caps 2; Y-Teens 1,2,3, Secretary 3; Student Boosters 3; A Capella 2,3,4, Secretary 4; Band 1,2,3,4; Cecilians 2,3,4; Madri- gals 3,4; FTA 3, treasurer 3; Cheerleader 2,3,4 Captain 4; Music Honor 2,3,4 DAN RIFFLE . General; Hall Guides 3,4; Baseball 1 MARILYN RIGLEY . . . College Prep; BRIGA- DOON 2; MY FAIR LADY 3; MIRACLE WORK- ER 3; CINDERELLA 3; STAR-SPANGLED GIRL 3; BLITHE SPIRIT 4; Business Club 2,3; French Club 2,3,4; Home Ec Club 1; GAA 3,4; National Honor Society; Thespians 3,4 SELNA RINGELSKI . . . Clerical; Y Teens 1,2; Boosters Club 2,3 BRAD ROBERTSON .. . College Prep; Board of Control 4; Student Council 1,3,4; Latin Club 3; Wrestling 1 GLADYS ROBERTSON . General; Office Assitant 4 GREG ROBERTSON ... General; German Club 4; Hall Guides 4; Science Club 2,3; Football 1,2,3,4; M-Men 2,3,4; Track 1,2,3; Wrestling 1 MAX RODGERS .. . Trade; Hall Guides 4; Red Cross 1,4; Science Club 2; Football 1,2; M-Men 4; Wrestling 2 ERIC RODTS . . . College Prep; Hall Guides 3,4; Science Club 2,3; National Honor Society 4; Math Club 2,3 PEGGY JO RYDZINSKI . . General; LaSalle High 1,2; Student Council 1,2; Cheerleader 1; Swimming 1,2 DANIEL SABADE .. . General; Math Club 2,3; Gold 2,3 RON SALYER... LARRY SANDERS .. . College Prep; MY FAIR LADY 3; Latin Club 3; Band 1,2,3,4; Football 1; Tennis 3 CHRIS SCHIDLER (IPE) . . . College Prep; Office Assistant 3; TE AHOUSE OF THE AUGUST MOON 3; Spanish Club 2,3; vice president 3; Y-Teens 1,2; GAA 3 TERRI SCHIFFER .. . College Prep; Junior Class secretary; Senior Class treasurer; Student Council 1,3; ALLTOLD 2,3,4, Editor-in-Chief 3,4; German Club, president 2; Hall Guides 2; Y-Teens 1,2; National Honor Society 3,4; Quili and Scroll 3,4 SHARRY SCHLEMMER ... General BECKY SCHMIDT .. . College Prep; MY FAIR LADY 3; STAR-SPANGLED GIRL 3; French Club 2,3,4; Hall Guides 3,4; Red Cross 1; Science Club 3; Y-Teens 1,2,3,4; Math Club 3,4; FTA 3,4, secretary 4 : TOM SCHNAIBLE .. . College Prep; Junior Class president; Office Assistant 2,3; ALLTOLD 3,4; MISKODEED 3,4; Baseball 1,2,3,4; Basketball 1,2, 3,4; Football 1,2,3,4; M-Men 2,3,4 DIANE SCHROEDER ... General; BRIGADOON 2; CAROUSEL 2; Art Club 3; Y-Teens 2,3; Band 1,2,3; Dance 1,2,3 LINDA SCHROEDER . Clerical; MIRACLE WORKER 3; MY FAIR LADY 3; Business Club 2,3; Band 1,2,3 BECKY SEMENAK . . . College Prep; Student Council 1,2; ALLTOLD 2,3; BRIGADOON 2; STAR-SPANGLED GIRL 3; MIRACLE WORKER 3; BLITHE SPIRIT 4; CINDERELLA 3; MY FAIR LADY 3; Art Club 3; Debate 1,2,3; German Club 1; Red Cross 1,2; Y-Teens 1,2,3,4; A Capella 3; Cecilians 3; National Honor Society 3,4; Thespians 3,4, Vice President 4; FTA 4 SANDY SHANE ... General KAREN SHANNON .. . General; White Caps 1,2 ALICIA SHINGLEDECKER .. . College Prep; MISKODEED 3,4; Organizations Editor; Art Club 3; Spanish Club 1,2,3,4, vice president 3; Y-Teens eNO teem Gautier brothers boost senior power 3,4; GAA 3; National Honor Society 4; Quill and Scroll 4 DON SHOCK. 3; M-Men 3,4 MICHAEL SHOEMAKER ... General; Football 1 SALLY SIERENS .. . Clerical; Business Club oF Home Ec Club 1; Y-Teens 3,4 JILL SKEETERS ... General; Business Club 3 4, vice-president 4; Y-Teens 4; A Capella 4; Cecilians 1; GAA 2,3,4 BILL SMITH wg French Club 1 DEBBY SMITH . General; Student Council 4; Hall Guides 3; Spanish Club 2 3; FTA 1,2 NANCY SMITH .. . General; Student Boosters 1; FTA 4; Nurse’s Assistant 4; Red Cross 4 STEVE SOLLIDAY ... Trade; Craftsmen Club eis . General; LaSalle 1,2,3; A Capella . College Prep; Penn High 1; Wrestling 1 RENEA SPRINGMAN ... Stenography; Business Club 3 DON SQUIBB . . . Trade; Craftsmen Club 3; Track 4 SUE STREICH .. . College Prep; MISKODEED 3,4, Academics Editor 4; Art Club 3,4; Debate 2: 3.4, Co-captain 4; Latin Club 2,3,4, Vice Presi- dent 4: Y Teens 2,3; A Capella Choir 3,4; GAA 2 GAIL STAMPER . . General; Office Assistant 2,3; French Club 2; Y- Teens 1,2,3 KEN STARR . . General: Marion High 1; Stigler High 2 FAYTHE STEELE ... General: MISKODEED 3,4; Business Club 4; French Club 2; Y-Teens 1,2 DEBBIE SWIENTAL . . General: Central High 1; FMCC 4 LINDA SZCZYPIORSKI .. . Clerical: Penn High 1,2; HALF A SIXPENCE: Readers Guild 3,4, secretary 4; Red Cross 4 SUZANNE TANSEY .. . General; CINDERELLA, BRIGADOON, MY FAIR LADY; STAR-SPAN- GLED GIRL; BLITHE SPIRIT; Art Club 2 ake Y-Teens 2,3,4; Thespians 4, Scribe; FMCC president 4 DERINDA THOMAS .. . General; Central High Ae GARY TRANTER. ... General: Track 1,2 CAROL TOOMBS ... General; GAA 3,4 JOE TRIMBOLI . . College Prep; Board of Con- trol 2; Junior Class treasurer; Student Council 4; ALLTOLD 4; International Relations 4, secretary; Red Cross 4; Science Club 2: Baseball W2;3:45 Football 1,2, 3 4; M-Men 2,3,4, president 4 JAMES TUMA . . College Prep; Book Guild 1,2; Science Club 3 Ae CURT UNRUH .. . General; Student Council 4; Ecology Committee, chairman 4 V BETSY VALLANCE ... General JOYCE VAN ARSDALE . . . Stenography; Hall Guides 3; Y-Teens 1,2 DENNY VANCE ... Trade DIANE VANCE ... Bookkeeping; Student Coun- cil 1; Office Assistant 3,4; Business Club 2,4; Hall Guides 3; Y-Teens 1,2,3,4 JOHN VAN DEN ABEELE . Pre-engineering; Spanish Club 2; Student Boosters 3; Band 1,2,3,4; Orchestra 3,4; Dance Band 4; Pep Band 2,34: Math Club 4, Sergeant-at-arms; Junior Rotarian 4; National Honor Society 3,4 LINDA VANDERBEKE .. . College Prep; CIN- DERELLA 3; BRIGADOON 3; MY FAIR LADY 3; French Club 2,3; Y-Teens 1,2,3, treasurer 3; Student Boosters 3; A Capella 3,4; Chambers 3,4; Madrigals 3,4; GAA 3,4; Thespians 3,4 DEBBIE VAN RIE... College Prep; ALLTOLD 3; FTA 1,2,3,4, president 4; French Club 2,3; Math Club 2,3,4, secretary 2, vice president 4; A Capella 3,4; National Honor Society 4 MARLENE VINNEDGE ... General “RICK WATSON ... W JANICE WAGNER ... General; Student Council 4; Office Assistant; Hall Guides 2 PAUL WALKER . .. College Prep; Valedictorian; German Club 4; A Capella 3,4; Chambers 3,4; Choraliers 3,4; Madrigals 4; National Honor Socie- ty 3,4, president 4; Music Honor 2,3,4, vice presi- dent 4; Math Club 3,4 TOM WALLACE ... Capella 3; Football 1,2,3 General; Red Cross 1; A VICKY WALLACE ... General THERESA WARNER .. . General; Hall Guides 4; Y-Teens 1,2; GAA 3,4 ROBERT WATKINS . . . General; Latin Club 2; Readers Guild 1; Science Club 2; Baseball 1 ROGER WATKINS . . . General General; Office Assistant 2,3,4; Basketball 1,2,3,4; M-Men 2,3 CHARLOTTE WHITE ... Stenography; Art Club 3; Business Club 4; Hall Guides 3,4 DEBRA WHITE . . . Bookkeeping; BRIGADOON 3; A Capella 4; GAA 3,4 PEGI WHITT ... General; Office Assistant 2,3,4; Art Club 3; Y-Teens 1,2,3,4; A Capella 4 MARIE WILEMON ... Home Ec; Choraliers 3,4 STEVE WILK ... College Prep; Wrestling 1 LYNN WILLIAMS ... General; Football 1 DAVID WILSON ... Accounting; Gym Assistant 4; Football 1; Track 3,4; National Honor Society 4 JIM WISEMAN . . . Trade; Office Assistant 3; Basketball 1,2,3,4; Football 1,2,3,4; M-Men 2,3,4; dirack 1-23 4 PATRICIA WITWER ... General; BRIGADOON; Spanish Club 3; Y-Teens 1,2; Student Boosters 3; A Capella 3; Cheerleader 1; GAA 2,3,4 GEORGE WOOD ... General: Golf 1 CHRIS WROBLEWSK! .. . College Prep; Student Council 4; ALLTOLD 3,4; BLITHE SPIRIT 4; HALF-A-SIXPENCE 2; MY FA!R LADY 3; German Club 2,3,4, secretary 3, president 4; Y-Teens 3; A Capella 4; Cecilians 4; Chambers 4; National Honor Society 4; FTA 3 i¢ DEBBIE YOUNG ... College Prep; MISKODEED .3,4, Faculty Editor 4; Latin Club 1,2,3,4; National Honor Society 4; Quill and Scroll 4 DIANE YOUNG ... General KAY YOUNG (POLLOCK) ... General; Business Club 3; Hall Guides 3; Latin Club 2,3; Red Cross 1; Y-Teens 1,2; FMCC 4 JUDY YOUNG .. . Clerical; BRIGADOON; Hall Guides 2,3; Red Cross 4; Y-Teens 1; Choraliers 1,2,3 Z CINDI ZIEKE .. . Stenography; Business Club 3,4; Y-Teens 2,3; GAA 2,3; National Honor Society 4 LETTERMEN Gary and Gray Gautier work on the form that has made them an asset to MHS. JavEMeyY 45) MISKODEED Index places the faces A A CAPELLA CHOIR 61 Addison, Michael T. 85,153,97 Adkinson, James 156 Airgood, Roxy 156 Aitkens, Denise 140 Aker, Gary 86,101,148 Aker, Mark 140 Aldrich, Gary 156 Aldrich, Ray 97,124 Alexander, Betty 124 Alexander, Dennis 156 Alexander, Mary Kay Alford, William 156 Allison, Robin 148 ALLTOLD 74,75 Alwine, Carl 140 Alwine, Cindy 124 Alwine, Gary 156 Alwine, Ted 84, 156 Ammerman, Gary 27,72,100,101,124, 187,189 Anders, Alvin 96,97,140 184—Index Anders, Gene 148 Anders, Ray 140 Anderson, Brenda 140 Anderson, Danny 60,124 ANDERSON, MR. DELMAR 194 Anderson, Janice 124 Anderson, Michael 84,156 Anderson, Patrick 84,97,156 Anderson, Peter 85,97,148 Anderson, Tim 156 Andrews, Pat 140 Andrews, Ronald 156 Andrews, Terry 148 Angleton. Blake 38.82 Armel, Don 148 ARMEL, MR. KENNETH 54,117 Armey, John 140 Armstrong, Barbara 140 Armstrong, John 124 Armstrong, Lonnie 156 Arnold, Linda 124 Armstrong, Lonnie 156 Arnold, Linda 124 Arata, Susan 140 ART CLUB 66 Asbury, James 148 Ashbaugh, Carolyn 156 Ashbaugh, Dean 96,124 Asher, Andrea 140 Asher, Jennifer 156 Asper, Randy 148 Atkinson, Gary 53,156 Atkinson, Ray 53,140 Austin, Randall 148,156 Austin, Sue 61,140 B Badders, Mark 69,124 Badders, Pamela 140 Baer, Kathleen 148 BAESTLE, MR. AUGUST 107,117 BAILEY, MRS. ANNE 107 Baiz, Alex 84, 156 Baiz, Barb 42,61,148 Baiz, Edward 69,124 Baiz, Mariam 140 Baker, Andrew 78,82,140 Baker, Douglas 156 Baker, Lyle 140 Baker, Ronald 156 BAKER, MR. WARD 43,63,106,107 Balbo, Alfred 156 Baldoni, Barbara 148 Baldoni, Mary 156 Balentine, Vicki 156 Ballard, Theodore 124 Balmar, Johnnie 156 Banghart, Randy 156 Banker, Donald 148 Banks, Jame s 140 Banks, Yvonne 156 Barbera, Pat 148 Barbera, Phil 125 Barclay, Roger 140 Bargo, Clark 148 Barker, Paul 22,52,55,125 Barkes, Thomas 85,96,97,148 Barner, Scott 156 Barnes, Barbara 140 Barnes, Debbie 125 Barnes, Jack 156 Barnette, Brad 156 Barnette, Brenda 4,17,125 Barnette, (Eiswald) Brenda 4,17,25 Barnette, Bruce 140 Barnette, Dale 97,125 Barnette, Donna 156 Barnette, Michael 156 Barnhart, James 140 Barr, Nancy 140 Barett, Beth 124,125,169 Barrett, Carol 156 Barrett, Gary 156 Barrett, Pamela 36,37,125 Barrier, Debra 148 Barth, Douglas 148 Bartsh, Debra 53,156 BASEBALL 98 BASKETBALL 88,89,90,91,92,93,94 Bassier, Denise 157 Battenberg, Michael 55,87,90,94,140 Bauters, Celeste 125 Bayman, Denise 157 Beal, Joseph 84 Bean, John 148 Beard, Jess 148 Beason, Robert 148 Beehler, Cathy 140 Beehler, Edward 148 Beery, Darcia 125 Bell, Kathy 157 Bellovich, John 84,157 Below, Greg 140 Below, Gregg 157 Bemis, Deborah 157 Benford, Sharon 157 Benford, Thomas 20,99,125 ‘ BENKO, MRS. FLORENCE 107 Bennett, Cherri 157 Bennett, Debbie 148 Bennett, LouAnne 157 Benson, Charles 157 Bergin, Ann 18, 125 Bergin, Kay 140 Bergin, Patrick 157 Bert, Carey 140,142,166 Bert, Scott 148 BESINGER, MR. RICHARD 99,107 Bess, Laretta 148 Betzer, Ronald 82,96,125 Bevan, Kathy 140 Bice, LuAnn 140 Bicknell, Robert 140 Biddle, Christine 148 Bieganski, David 140 Bilancio, Dan 125 Bilancio, Toni 157 Biller, Pamela 148 Biller, Paula 125 Blair, Joanne 148 Blair, Margaret 24,25,38,39,64,125 Blake, Michael 148 Blake, Susan 140 Blankenhorn, James 140 Blankenhorn, Richard 157 Blasko, Lisa 148 Blimling, Gary 59,140 Bloomer, Larry 148 Bloss, Douglas 148 Blue, Beth 17,52,69,77,125,179 BLUE, MR. MERLE 108,179 Blume, Chris148 | BLUME, MRS. GILBERTA 120,121 I Boehlein, Cathryn 157 | Boettcher, Dennis 52,140 Bogaert, Richard 157 Boggs, John 125 Boler, Becky 148 Bolin, Betty 55,148 Bolin, Jerry 140 Bonar, Virginia 148 Bone, Vicki 140 Bonebrake, Ann 148 Bonebrake, Robert 42,85, 148 Bonnell, Mary 148 Bonnell, William 140 Bordner, Connie 125 | Bortone, Bruce 157 | STUDENT COUNCIL PRESIDENT Frank Portolese prepares to revive a fallen female football player et the Powder Puff Game. Joe Trimboli acted as referee at the game. Bosler, Kris 61,76,125 Bosler, Marianne 148 Botos, Dana 86,101,148 Bottorff, David 125 Bottorff, Cheryl 145 Bottorff, Denise 140 Bottorff, Diane 55,149 BOTTORFF, MR. RICHARD 107,186 Bottorff, William 157 Bower, Kristy 140 Bower, Lynne 149 Bowers, Charles 149 Bowers, Gary 157 Bowers, Larry 149 Bowman, David 125 Bowman, Jerome 84,157 MR. VICTOR BOYER, 107 Boyland, Geneva, 157 Boyland, Michael 85,149 Braddock, Gene 125 Bradley, Freddie 94,140 Braga, Claudio 174 Brandt, Gregory 149 BRAUNSDORF, MR. JAMES 40,106 Breedlove, Howard 80,82,96,100,140 Brennan, Paulette 69,126 Brenneman, Bryan 149 Breske, Michael 84,94,157 Bricker, Frank 156,157 Briggs, Vicki 149 Bright, Howard 157 Brink, Cindy 126 Brink, Gerry 157 Brink, Terry 157 Briscoe, Gary 126 Briscoe, Wanda 140 BRITTIAN, MRS. BETTY 120,121 Britton, Cheryl 157 Britton, Jerry 140 Britton, Verne 53, 149 Brockhoff, Barbara, 149, 151 Brockie, Norma 149 Brockway, Dan 126 Brockway, Keith 149 Bronk, Cecilia 157 Broomall, Douglas 149 Broomall, Janet 140 Brothers, Jerry 69,126 Brown, James 140 Brown, Joan 157 Brown, Joseph 149 Brown, Kathy 157 Brown, Randy 157 Brown, Sandra 126 Brown, Walter 157,165 BRUBAKER, MRS. MABEL 120 Bryan, Mary 52, 126 Bryant, Raymond 157 Buck, Carol 53,149 Bulger, Sally 157 MR. RAY BULLARD 121 Burkowski, Kathy 126 Burkus, William 149 Burns, Charlotte 158 Burns, Janice 140 Burns, Mickie 158 Burns, Pat 126 Burns, William 97,158 Buscoe, Kandis 140 BUSINESS CLUB 67 Butcher, Vicki 126 Butterfield, James 149 Butz, Roberta 158 Buwa, Timothy 149 MRS. NANCY BYRD 118 C Calderone, Philomena 149 Calentine, John 158 Callen, Gary 140 Camargo, Maria 149 Camparone, Larry 126 Campbell, Douglas 140 Campbell, Larry 126 Campoli, Brian 158 Canarecci, Carol 140 Canarecci, Thomas 96,99,126 Canfield, Janet 149 Carlson, Gary 126 Carmack, Bill 99,142 Carmack, Doris 158 MR. WILLIAM CARMICHAEL, 40,107 Carner, Denise 54,158 Carner, Ronald 142 Carney, Cindi 23,142 - Carney, Chris 16,24,69,126,134 Carter, Dennis 126 Carter, Linda 126 Carter, Pamela 149 Carter, Shirley 126 Casper, Joseph 142 Cates, Kenneth 94,101,150 MR.CARROLL CECIL 55,108 Cerri, Mark 126 MISS MARIE CHADWICK 108 MR. BRUCE CHAMBERLIN 39,106 Chamberlin, Laurie 33,142 Chamberlin, Sallie 53,158 MR.WARREN CHAMBERLIN 121 Cheerleaders, 71 Chance, Chery! 3,54,158 Chance, Jeffery 142 Chapman, Rebecca 126 Chase, Troy 101,142 MR. JOHN CHELMINIAK 98, 108 Chelminiak, Lee 22,150 Chilcote, Nancy 126 Chizum, Terry 150 Christmas, Beverly 150 Church, Roscoe 150 Church, Roxana 158 Claeys, Debbie 142 Caleys, Jackie 67,69,126 Claeys, Linda 150 Clardy, Curt 150 Clark, Gary 126 JUNIOR ANN POZWILKA practices her blocking and punching techniques at the YMCA Karate class. Ann was the only girl in the class. Clark, Linda 150 Clark, Lori 142 Clavili, Barry 142 Claxton, James 142 Clayborn, Patricia 126 Claypool, Carolyn 142 Clayborn, Sheila 150 Clayton, Anita 150 Clayton, Michael 126 MRS. ESTER CLAXTON 120 Cleveland, Ronald 150 Clevenger, Walter 142 Cline, Diana 158 Cline, Sharon 126 Cline, Terry 158 Clough, Linda 158 Coat, Cindy 150 Cocquyt, Maurice 158 Cochran, Terry 158 Coddens, Jenny 150 Cole, Bradford 158 Cole, Denise 142 Cole, Diane 158 Cole, Jack 142 Cole, Penny 142 Coleman, Michael 84,94,158 Colley, Deborah 150 Collins, Bonnie 158 Collins, Curt 184 Collins, Kevin 97,158 Collins, Lisa 30,126 Collins, Terry 150 Colpaert, Kevin 142 Colvin, Harold 126 Comer, Jack 55,82,96,99,142 Conley, Nora 158 Connon, Judy 3,54,158 Connon, Kenneth 158 Conrad, Bonnie 126 Contadelusi, John 158 Cook, Daniel 84,158 Cook, Danny 55,84,158 Cook, Debbie 150 Cook, Jere 84,158 Cook, Robert 158 Cooper, Debbie 150 Cooper, Joseph 150 Cooper, Steve 142 Copp, David 86,101,150 Corbin, Paula 158 Corey, Rosa 150 Corey, Terry 142 Corvn, Kathy 55,150 Coryn, Timothy 126 Cosby, Richard 150 MR. RAYMOND COSNER 108,119 Costra, Donald 97,150 Costa, Gregory 158 Coyner, Brian 84,158 Coyner, Jeff 22,142 Cox, William 126 Craig, David 126 Craven, Vera 150 Creakbaum, Jon 150 Crocker, Roma 21,127 MR. DONALD CROMER 108 Crook, Cecil 48,49,82,127 Crook, James 82,127,130 Cross Country 86 MRS. DEBORAH CULP 52,55,118 Cunningham, James 82,85,96,101,150 Cunningham, Kathy 38,39,65,127 Cunningham, Pamela 150 Cunningham, Patti 142 Cunningham, Penny 158 MRS. WILLA CUNNINGHAM 108 Curry, Carolyn 4,24,66,158 Curry, Richard 41,98,141,142 Czosnowski, Lynn 158 D MR. AL DALKOWSKI 118 MR, JOHN DANAHER 99,108 Darbin, Michael 127 Dare, Chris 55,127 Dare, Cynthia 10,55,150 Dare, Shannon 55,158 Darnell, Dale 150 Davenport, David 62,142 David, Michael 158 Davis, Daniel 158 Davis, Greg 142 MRS. JEANETTE DAVIS 111 Davis, Jo 17,158 Davis, Jody 150 Davis, Linda 69,127 Davis, Pat 69,127 Davis, Sharee 158 Davis, Steve 150 Davis, Steve 142 Davis, Susan 142 Davis, Susan 158 Deal, Christopher 142 Deal, Michele 158 Dean, Robert 158 DEBATE CLUB 38 Deblock, Roane 150,154 DeBroka, Edward 84,97,158 DeBroka, Mary 127 DeBruyne, Dale 158 DeCauwer, Gary 158 Decker, Scott 29,150 Deethardt, Cheryl 52,158 DeGeeter, James 127 DeGeyter, Christine 150. DeKeizer, Kenneth 15% DeLaruelle, Kevin 127 DeLaruelle, Teresa 150 DeLaurelle, Bruce 142 DeLaurelle, Cindy 127 DeLaurelle, Mark 150 DeLoof, Linda 30,127,130 DeMaegd, Ethan 142 DeMaegd, Linda 127 DeMaegd, Roy 158 DeMeester, Cindy 55,142 DeMeester, Gary 72,127,187,189 DeMetz, Donald 84,94,158 DeMeulenaere, Carol 127 DeMeulenaere, Joseph 33,127 DeMeulenaere, Steven 94,158 DeMeyer, Marlene 150 DeMoss, Sue 142 Dene, Sue 150 Densel, Ronald 158 Dentino, Dan 96,97,127 Deranek, Sue 150, 154 Derbin, Carol 142 Derrickson, Oletha 127 DeSmith, Ronald 158 DeVliegher, David 158 DeVolder, Nancy 127 DeVolder, Phillip 127 DeVolder, Ralph 150 DeVriese, Sue 158 DeWeirdt, Jeanette 158 DeWitt, Debbie 150 DeWulf, Debbie 142 DeWulf, Eileen 71,127 DeWulf, Sandy 158 Dicken, Mark 54,69,72,128,182,187,189 Dickeson, Michael 150 Dietrich, John 97,150 Ditsch, Douglas 128 Dixon, Sherri 158 Doerr, Pamela 142 Doherty, Judith 150 Doles, Ricky 75,158 Dome, Charie 142 Donoho, Steve 142 Doolin, Dave 142 Doolittle, Roland 150 Doty, Robert 58,89,90,98,128,139 Doyle, Vicki 55,45,128 Dresser, Debbie 150 Dresser, Richard 84,97,158 Drew, Joan 158 Drew, Lisa 142 Drury, Theodore 142 Dunn, Geannette 142 MISS MARY DUNN 67,108 MRS. MARY DURR 120 Dutoi, Dean 158 Dycus, James 150 Dye, Holly 150 Dye, Marshall 128 Dykes, Sherry 150 Dykes, Terry 158 Dylewski, Pamela 142 Dzvonar, Donald 128 IS Eakins, Robert 150 MRS. MYRNA KAY EARNHART 118 Eaton, Paula 150 Eberhardt, Beth 158 Eberhardt, Richard 54,128 Eberhardt, Thomas 142 MR. MAX EBY 105,116 Edwards, Daniel 142 Edwards, Loretta 158 Edwards, Sharon 158 Eggers, Darrell 150 Einfalt, Dorlan 142 Einfalt, James 150 Eisenhart, Terry 150 Eiswald, Donald 4,27,81,82,83,99,128 Eling, Mariann 142 Eling, Mary 158 Eling, T erry 128 Eller, Jill 128 Elliot, Flint 128 Elliott, Jeffrey 158 Elliott, Kathy 150 Elliott, Laurie, 45,128 Ellsworth, Debbie 142 Ellsworth, Terry 151 Elson, Julie 52,142 Emerick, Judy 142 Emery, Claire 151 Emery, Connie 128 Emery, Darlene 151 Emery, Jeannie 142 Engel, Karen 151 Epperson, Kathy 128 Epperson, Laura 142 Ermeti, Lisa 38,55,60,68,69,128 Ermeti, Susan 53,151 Erwin, Martin 52,87,142 Esary, Ronald 151 MR. CHARLES ESPERSETH 108 Estes, Rhoda 158 Etherton, Scott 84,94-158 Evans, Michael 151 Evans, Vicki 151 Everett, Nigel 151 Everts, Rick 89,90,142 Ewald, Gary 151 Ewald, Mary Ann 142 S Fagan, Gail 71,143 Fagan, Mary Kay 71,90,128 Fain, Greg 143 Fairres, Richard 158 Farlin, Wandy 158 Farling, Charles 143 Farr, Terry 151 Farris, Billie 158 Farris, Linda Pia 143 Faulkner, Vickie 49,151 Index—185 Teachers MRS. BETTY FAVORITE 108 Favorite, Sharon 52,143 Favorite, Susan 52,75,140,143,147 Ferrettie, Thomas 143 Fielder, Chery] 158 Fielder, Pamela 143 Fields, Beverly 128 Fields, Dennis 68,128 Fifer, Joanne 54,143 Fike, Pamela 151 Firmani, Diane 29,53,143 Fischer, Eileen 128,133 Fischer, Kathy 151,153 Fischer, Cecelia 156,158 Fisher, Jill 151 Fisher, Vicki 158 Fitz, Sandre 158 Fjerstad, Paul 151 Flaherty, Pat 32,53,140,142,143,16€ MISS PENNY FLATT 110 Fleck, Darryl 128 MR. EDWARD FLEMING 114 Fleming, Harold 158 Flood, Nancy 158,161 Floridia, Vince 17,18,68,128 Flowers, April 158 Flowers, David 84,158 MRS. JOAN FLURY 110 FOOTBALL, 80-85 Ford, Theresa 151 Fore, Scott 74,75,143,145,147,168 Forst, Debbie 151 Forsythe, Rick 151 Foster, Kathy 158 Foster, Peggy 143 Foster, Peggy 158 Fowler, Daniel 88,90,92,99,128,139 Fowler, Steve 82,94,96,141,143 Fox, Connie 151 Fox, David 151 Fox, Janet 69,128,169 Fox, Jerry 13,58,75,124,128 Fox, Phillip 54,158 Fox, Phyllis 158 F ox, Susan 143 Fozo, Ken 156,158 Frame, Thomas 143 Francis, Frank 151 Francis, John 97,158 Franks, Jim 143 Fray, Debbie 53,55,64,143 Frazier, Kris 128 Freed, Cindy 52,128 MR. GARY FREELAND 110 FRENCH CLUB 64 Frick, Darwin 151 Fridrich, David 151 Fridrich, James 143 Friedman, Ann 143 Friedman, Jim 96,143 Frohwerk, JoAnn 143 Fry, Brian 158 Fry, Chris 128 Fry, Jim 128 Fry, Karen 143 Fry, Susan 151 Fryar, Gail 158 F.T.A. 64 Fulkerson, Kenneth 55,156,158 Fuller, Charlotte 151 Fuller, Pamela 151 Funkhouser, Daniel 55,158 Funkhouser, Bob 55,151 GAA. 71 Gaby, Michael 84,94,158 Gaines, Karen 143 Galbreath, Donna 143 Gall, Gregory 143 Galloway, Patty 128 Gamble, Chet 128 enjoy vacation family trips Gannon, Michael 58 MRS. CAROLYN GARBER 110 Garda, Susan 21,61,151 Gardner, Sallie 143 Gardner, Sherry 128 Gardner, Stanley 158 Garman, Michael 143 Garman, Penny 159 Garn, Judith 159 Garrage, Pete 96,100,128 Garrett, Diana 159 Garrison, Kathy 151 Gaskill, Gary 151 Gaskill, Terry 159 Gautier, Chris 87,159 Gautier, Gary 88,89,90,91,92,129,139,185 Gautier, Gray 90,91,129,139,185 MRS. BARBERA GAYLOR 120 Gear, Gary 151 Geer, Daniel 159 Geer, Paul 159 Geisel, Larry 84,159 Geist, Beverly 54,159 C eldner, Danny 151 George, Connie 151 George, Jeff 143 George, Julie 159 George, Vicki 129 Gephaert, Michael 84,159 MRS. BETTY GERARD 120 Gerard, Cathy 143 Gerard, Craig 159 Gerard, Dennis 143 MR. GERALD GERARD 112 Gerard, Jill 54,55,151 Gerard, Lynne 151 Gerard, Rebekah 55,159 GERMAN CLUB 64 Germano, John 53,87,96,151 Geschwender, Domingo 143 Geschwender, Julie 159 Getha, Michael 151 Gevaert, Randy 159 Gevaert, Thomas 129,151 Geyer, Sue 55,141,151 Ghant, Sharon 159 Gherardi, Gerry 129 MR. JOHN GIBSON 38,39,114 Gilbert, Andrew 159 Gilbert, Carl 151 Gilbert, Kathleen 143 Gilchrist, Denise 143 Gill, Cindy 54,159 Gill, David 159 Gill, Dwayne 151 Gill, Kathy 71,129 Gill, Stanley 159 Gill, Stephan 159 Gillespie, Daniel 159 Gilmartin, John 129 Gilmartin, Ronald 84,159 Giszewski, Charles 129 Givens, Jeff 82,143 Glantx, Robert 143 Glassburn, Mary 143 Glassburn, William 159 Gleissner, Robert 86,96,98,143 Glover, Bonita 151 Glover, Dennis 159 Gnivecki, Kathy 151 Goebel, James 129 Goebel, Karen 143 Goegebeur, Paul 159 Goethals, Joan 17,70,129 Goethals, Mark 159 MR. JOHN GOLBA 119 Golden, Kirk 143 GOLF 79 MR. CHARLES GOLLATZ 110 MRS. VERA GOLLATZ, 110 Good, Ronald 82,129 Goodwin, Judy 151 Gorny, Laura 129 Gorny, Robert 151 Gorny, VAlerie 159 Gosztola, Timothy 159 MRS. LOIUSE GOULD 111 Gould, Michael 159 Gradeless, Lori 143 Gradeless, Ronald 84,94,159 Graham, Julie 151 Gramenz, Dennis 143 Gramenz, James 151 Gramenz, Janet 151 Grant, Lewis 159 Graser, Gerald 151 Gratzol, Jon 37,85,101,151 Gratzol, Julie 159 MRS. EDNA GRAVES 121 Graves, James 159 Graves, Leslie 159 Graybosch, Alan 159 Grayson, Mary 53,54,143 Grayson, Thomas 2,55,75,129 Green, Richard 151 Green, Mark 98,143 Greene, Cathy 151 Greenwood, Marta 53,141,143 Gregory, Richard 151 Griggs, Roger 129 Gronning, Chris 86,96,101,151 Groth, Gary 64,143 Groves, Robert 7,129 Grudzinski, Al 129 Grudzinski, Bridgette 151 Grudzinski, John 129 Guidi, Attea 159 Guidi, Kim 82,143 Gulata, Candy 129 Gulatta, Terry 151 MRS. ANN GULYANICS 111 Gunter, Allen 101,129 Gunter, Patsy 159 Gunter, Tina 159 Gurski, Joan 159 Gurtner, Craig 151 Gushwa, Gayle 58,129 Gushwa, Karen 151 Guyton, Carol 55,129 Guzman, Mary 151 H Haberle, Kathy 159 Haddock, Glen 100,143 Hafer, Carl 143 Haga, Mark 159 Hagedorn, David 143 MR. ROBERT HAHN 111 HALL GUIDES Hall, Pamela 151 Hall, Suzanna 159 Halterman, Kathy 29,143 Hamilton, Peggy 151 Hamman, James 143 Hamman, William 143 Hammer, Pat 129 Hammock, Jann 151 Hanback, Sam 151 Handley, Dale 151 Haney, Joseph 101,151 MRS. BETTY HANKS 120,121 Hans, Mark 55,143 MISS MILDRED HARDEN 116 Harder, Karen 159 Hardman, James 143 Hardman, Joseph 129 Harker, Brian 87,101,151 Harmon, Chery! 159 Harper, Ben 143 Harper, Ruth 151 Harrell, Chery! 143 Harringer, David 100,130 Harris, Patty 45,61,130 Harris, Terry 151 Harrison, Becky 151 Harrison, Tina 151 Hass, Christine 143 Hartley, Edward 82,101,143 Hartley, Kevin 97,159 Hartsough, Joyce 151 Hartz, Deena 159 Harvey, David 55,143 Harvey, Timothy 130 Havens, James 151 Haverstock, Kent 151 Hawkins, Lori 143 Hawkins, John 159 Hawkins, Teresa 152 Hawn, Steven 143 Hayden, Chris 143 Hayden, Monica 152 Hayden, Rosemary 130 Hayes, Andy 159 Hayes, Rita 130 Hazelwood, Debbie 159 Hazelwood, Robert 143 Hazen, Debbie 143 Heckaman, Ralph 143 Heeter, Bonnie 152 Heeter, Marcia 159 Heintzberger, Michael 130 Hembrecht, Judy 130 JIMI HENDRIX 196 MR. AND MRS. BOTTORFF and children take time out from their summer-long travels across the west- ern states to pose for a picture at a lookout point in Colorado. Henke, Toni 159 Hensel, Wayne 159 Hensley, Michael 159 Henson, Judith 159 Henson, Melvin 152 Herron, Charlotte 62,152 Herron, Dorothy 130 Herron, James 152 Herron, Kathy 159 Hesch, Connie 130 Hesch, Mickey 62,160 Hess, Candi 152 MISS MARY HESS 111 Hess, Terence 54,160 Heyse, Donald 143 Hibschman, Roger 143 Hickey, George 130 Hickey, Tom 160 Higgins, Maureen 130 Highland, Belinda 130 Hildebrand, Becky 160 Hildebrand, Beth 152 Hill, Toni 84,160 Hillard, Candace 160 Hiller, Robert 85,101,152 Hinton, Timothy 84,160 Hitchins, Ann 160 Hively, Randy 81,82,143 Hively, Vivian 160 Hixenbaugh, Debbie 152 Hixenbaugh, James 84,160 Hixenbaugh, Jane 143 Hockman, Shawna 152 Hodapp, Richard 160 Hoffman, David 152 Hoffman, Paul 61,130 Holbert, James 130 Holbert, Sharon 152 Holcomb, Patti 48,54,160 Holdeman, Adele 143 Holdeman, Lynette 131 Holewceynski, Mary 143 Holland, Becky 152 Holland, Ronald 152 Holland, Timothy 160 Hollingsworth, Ron 131 Holloway, Jan 143 Holmes, Debbie 152 Holmes, Joann 143 Holmes, Mark 143 Holmes, Rosemary 160 Holt, Kerry 86,101,152 Honaker, Mike 143 Hood, Debra 131 Hook, Mandy 30,160 Hook, John 143 Hook, Steve 143 Hopper, Brenda 131 Horvath, Jack 160 Hoskins, Karen 131 Hostetler, Lori 160 Houck, Debbie 160 Houck, Debbie 143 Houck, Harold 143 Houghton, Ellen 160 Housand, Chery! 152 Housand, Linda 131 Housand, Raymond 152 Housouer, Kent 17,52,55,131 Hovinmaa, Kari 32,131 Howard, Diane 160 Howard, Jeff 82,100,131 Howland, Mariann 131 Howsam, Linda 143 Hubanks, Rick 143 Huemmer, Jim 160 Huff, Ed 160 | Hufkens, Maurice 160 Hufkens, Wayne 131 Hugo, Pat 131 | Hulecki, Pat 143 Hull, Howard 69,131 | Hull, Kim 54,160 | HUMAN RELATIONS 61 Humes, Judy 131 , Humes, Mary 160 | Humphrey, Rhoda 152 | Hunsberger, Becky 160 Hunsberger, Bob 62,160 Hunt, Ron 143 Hunter, Jim 94,152 Hupp, Greg 143 Hurley, Sue 152 Husband, Ron 152 Huston, Jim 152 Huston, Marlene 11,131 Huston, Teresa 131 Hutton, Kathy 152 Huyvaert, Bob 69,131 | Ice, Diana 160 Ice, Mary Kaye 152 Imus, Katie 152 Inghels, Janet 53,143 Ingram, Debbie 143 Ipe, Debra 131 Ipe, Bill 82,152 lrions, David 94,152 Iron, Fred 152 Irvine, Lynn 131 luston, Julie 152 J Jackson, Pam 131 Jacobsen, Debra 71,92,143 Jaffee, Janet 131 James, Daniel 160 James, Donna 152 James, Bob 143 Jannings, Stan 152 Janowiak, Kirk 84,160 MR. MICHAEL JELLICOE 111 Jennings, James 160 Jadway, Kevin 84,160 Johnson, Christine 131 Johnson, David 160 Johnson, Del Rae 45,131 Johnson, Ellen 160 Johnson, Jan 152 Johnson, Janet 19,143 Johnson, Mary 160 Johnson, Michael 160 Johnson, Patrick Dan 143 Johnson, Peggy 152 Johnson, Ralph 160 Johnson, Randy 101,152 Johnson, Rita 131 Johnson, Robert 86,96,160 MR.WALTER JOHNSON 113 MISS JUNE JOHNSTON 111 JoJo, Shirley 131 Jonas, Michael 152 Jones, Darlene 152 Jones, Denis 82,152 Jones, Doris 160 Jones, Kenneth 131 Jones,, Linda 143 Jones, Peggy 152 Jones, Richard 131 Jones, Robert 84,85,152 Jones, Robert M. 74,101,143,146 Jones, William 160 Jordan, Dan 143 Jordan, Jim 55,72,75,131,189 Jordan, Pamela 160 K Kabzinski, John 86,100,152 Kabzinski, Mary 152 Kahlenbeck, Gail 152 Kalil, Gregory 131 MISS SUZANNE KAMM 113 Kapatan, Mantea 152 MR. CHARLES KARST 41,118 Karst, Lori 144 Keel, Rex 86,97,160 Keen, Don 152. Keen, Scott 84,94,160 Kellett, Cheryl 160 Kelly, Donna 152 Kelly, Kathy 131 Keltz, Brian 152 Kempf, Larry 152 Kensinger, Mark 144 Kensinger, Paul 152 Kent, Kristi 160 Kerchner, Jeri Lynn 160 Kerchner, Linda 152 Kernn, Douglas 152 Kerr, Marcia 144 Ketring, Brenda 160 Keyser, Robert 144 Kiler, Harold 144 Kilgas, Wanda 144 Killebrew, Ed 93,94,101,152 Kime, Luanne 131 Kimmel, Carol 76,132 Kindig, David 85,97,152 Kindig, Kim 160 Kindley, Robert 97,160 Kinzie, Cheryl 144 Kinzie, Dennis 160 Kirk, Gregory 144 MR. JAMES KITE 120 MR. RAY KITE 120 Kitson, Diane 152 Kizer, Lance 132 Kizer, Timothy 94,160 Klein, Christopher 82,101,144 Klein, David 94,144 Kleiser, James 132 Kleiser, Paula 160 Kline, Connie 160 Kline, David 144 Klinedinst, Rick 144 Klingaman, James 132 Klopenstine, Betty 132 Klopf enstein, Carol 132 Knisley, Nancy 52,67,69,132 Knudson, Gloria 152 Kobb, Dennis 132 Kobb, James 152 Kobold, Lewis 58,69,90,132,139 Kobold, Mark 94,152 Kochendofer, Richard 132 Kocsis, Cathy 160 MR. KENNETH KOGER 104 Koger, Lynn 144 Kohler, Vickie 144 Kohler, Walter 160 Koldyke, Monte 85,152 Mrs. Garnet Kolezar 120 Kolkiewicz, Judith 160 Kollar, Gail 152 Kollars, Debbie 54,152 Kollars, Stephen 160 Koontz, Richard 152 Koontz, Richard 151 152 Koontz, Robert 144 Korn, Laura 132,50 Kovach, Charles 144 MR. JULIUS MINNE listens sympa- thetically to Junior Gai! Fagan as she relates a close call in Driver’s Educa- tion, when she almost hit a tree during summer school. Kovatch, Carmela 152 Kovatch, Ed 132 Kowalski, Zann 43,58,67,68,69,76,132 Kronewitter, Cheryl 160 Kronewitter, Ed 132 Kronewitter, Jean 132 MR. RONALD KRONEWITTER 104 Kronewitter, Ronald 152 Kuczmanski, Larry 84,160 Kuharic, Deborah 160 Kujawa, Bruce 144 MISS RITA KUNKLE 113 Kurnyak, Connie 152 Kurnyak, Louis 144 Kwasny, John 132 Kyle, Deborah 160 L Lackey, Joseph 152 Lackey, Owen 55,144 Lacy, Amy 160 LaDow, Brian 54,85,98,152 Laird, Fred 144 Lamb, Debbie 59,69,76,77,132 Lambrechts, Linda 160 Lamirand, Bob 132 Lampert, Christine 152 Lancaster, Larry 16,82,96,100,132 Lang,Lois 152 Lang, Pamela 160 Langel, Gregory 160 Lanning, Jean 55,144 Lanning, Linda 55,152 Lanning, Terry 160 Lanning, William 160 Lanoo, Brian 160 LaPorte, Lacy 152 Lardon, Margaret 132 Lardon, Mark 132 Laskowski, James 96,132 LATIN CLUB Laws, Marcia 144 Laxon, Sondra 152 Leach, Martha 152 Leake, Suzanne 144: Leazenby, Randy 160. Leazenby, Richard 132 Lechlitner, David 85,101,152 Lechlitner, Herbert 132 Lechlitner, Michael 52,82,144 Leda, Debbie 152 Lee, Robin 160 Lema, Sandy 17,144 Leniski, Charmaine 132 Leniski, Joseph 48,84,95,160 Leniski, Randy 152 MRS. GAYLE LERNER Lese, Marianne 152 Leslie, Debbie 46,132 Leslie, Linda 60,132 Leuthold, Teri 152 Lewandowski, Mark 153 Lewellen, Janel 132 Lewellen, Karen 37,153 Lewinski, Mark 132 Lias, JoAnn 160 Lidolph, Becky 133 Lidolph, Beverlee 153 MRS. MARCIA LIGGETT 108 Lindenberg, Randa 133 Lindorf, Sharon 144 Lingo, Kenneth 153 Little, John 144 Little, Linda 161 Livengood, William 144 MR. JAMES LLOYD 37,113 Lochmondy, John 95,96,133 Logan, Rosemary 161 Long, Janet 161 MR. JOHN LONG 111 Louellen, Ronald 84,161 Loughlin, Bridget 9,63,133,170 Love, Debbie 144 Love, Richard 84,94,161 Lovette, Jennifer 21,153 Lovette, Terry 144 Lovette, Timothy 41,133 Lowe, Susan 161 Lucchi, Beverly 161 Luke, Beverly 153 Lukens, Mick 133 Lute, Vicky 153 Lynch, Clint 133 Lyvers, Michael 144 Lyvers, Ray 153 Lyvers, Thomas 144 M Mabie, Susan 153 MacLean, Brenda 153 Madon, Kevin 153 Madon, Steve 133 MADRIGALS Maenhout, Cynthia 133 Maes, Oranda 133 Maggaert, Helen 133 Maggert, Sharon 133 Makielski, Carol Makielski, Cathleen 161 Malone, Cindy 153 Malstaff, Lance 161 Mandich, Malena 144 MRS, HAZEL MANIS 121 Mann, Paula 153 Mann, Robert 153 Marchant, Gregory 161 Mariotti, Nancy 52,144 Mariotti, Richard 161 Mark, Stella 144 MR. JOHN MARKER 113 Markham, Michaeel 84,161 Markin, Debbi 153 Markin, Deidree 133 Marks, David 't33 Marrs, Pam 161 Marsh, John 24,68,69,133,180,76,171 Marsh, Nancy 52,161 Marshall, Diana 133 Marshall, Richard 144 Martens, Linda 144 Martin, Claudia 161 Martin, David 161 Martin, Donna 161 Martin, Jeannette 161 Martin, John 161 Martn, Michael 144 Martin, Rick MISS THELMA MARTIN 112 Martin, Vickie 144 Martsolf, Susan 161 Marzotto, John 82,85,90,94,153 Mason, Anna 161 Mason, Debbie 153 Masterman, Becky 153 Masterman George 133 Math Club Matthias, Cindy 161 Matson, Linda 153 Mathewa, Beth Ann 161 Matthews, Karen 161 Mattson, Brenda 161 Matz, Bonnie 144 Matz, Larry 153 Matz, Pam 144 Matz, Bob 161 May, Debbie 144 May, Debby 161 May, Laurel 161 May, Linda 161 May, Ronald 42,54,153 May, Stanley 40,26,69,130,133 MISS BARBARA MAYER 77,115 Mayerhofer, Cindy 133 Mazurkiwicz, Mike 153 McCloud, Karen 62 McConahay, Mike 153 McCool, Cherly 54,153 McCool, Elaine 55 McCraken, Diane McCullough, Tim 85,97,153,151 McDolald, Lynn McDougal, Douglas 103,153 McFarland, Cris 144 McGann, Michael 86,101,144 McGann, Patricia 153 McGee, Gary 144 McGee, Rick 95,144 McGillem, Alan 153 McGookin, James 153 McKelvey, Rebecca 144 McKinnis, Chuck 134 McLane, Karen 6,7,144,28 McLaughlin, Brian 144 McLaughlin, Michael 42,153 © McLemore, Daniel McLemore, Thomas 153 McLeod, Karen 134 McManus, Susie 43,65,69,76,134 McMurtrie, Kathy 54,144 McQuade, Lorraine 54,144 McPhail, Michael! 153 Mechling, Beatrice 144 Meidel, Cindy 144 Meidel, Mark 144 Meidel, Sandra 161 Meixel, Chery! 66,144 Meixel, Jeanne 144 Melin, Jill 161 Melin, Russ 97,144 Mell, Denise 153 Mell, Jack 82,144 Meller, Rick 161 Melson, Carolyn 161 Melter, Barbara 133 Melter, Joseph Melter, Ronald 153 Melton, Charles 144 Melton, Ed 144 Merey, Diane 144 Meribela, Annette 144 Meribela, Mario 144 Meribela, Paul 85,153,101 Merritt, Barbara 144 Merritt, Donna 161 Messer, Donald 144 Metzner, Mary Lou 161 MRS. DOROTHY MEYERHOEFER 120,121 Meyerhoefer, Marthy 134 Myers, Dale 161 Meyers, Linda 153 Michaella, Dawn 161 Michele, Mary 134 Micinski, Kathy 64,76,134 Micinski, Steve 82,96,97,144 Midday, Margie 161 Mihajlovich, Louis Jr. 84,94,161 MR, LOUIS MIHAJLOVICH 84,97,113 Mikulyuk, Cheryl 161 Mikulyuk, David 144 Miles, Kenneth 134 Miles, Nancy (Thomas) 134 Miles, Vickie 161 Millage, Dennis 161 Miller, Bonnie 30,134 Miller, Brad, 134 Miller, Charlene 153 Miller, Craig 53,161 Miller, Dean 153 MR. JAMES MILLER 97,100,113 Miller, Kathlyn 54,144 Miller, Linda 161 Miller, Lucy 144 Miller, Mark 69,82,96,97,99,134 MR. MARTHA MILLER 113 Miller, Michael 161 Miller, Michelle 144 Miller, Michelle 134 Miller, Rick 29,82,96,99,101,134 Miller, Rusty 144 Miller, Sheila 161 Miller, Virginia 134 Miller, Wayne 144 Miller, William 97,161 Million, Mike 144 Mills, Darlene 144 Mills, Keith 144 Index—187 Minglin, Thomas 134 MR. JULIUS MINNIE 121,187 Minnie, Steve 153 Mishler, Bruce 22,134 MISKODEED 76,77 Mitchell, Colleen 153 Mitchell, Sandra 161 Mitchell, Tyrone 156,159,161 M-MEN 101 Moe, Barbara 161 Montel, Diana 144 Montgomery, Thomas 161 Montgomery, Tony 95,153 Moody, Michael 161 Moore, Debbie 161 Moore, Diana 153 Moore, Gloria 134 Moore, James 86,96,98,101,153 Moore, Karen (Silvers) 134 Moore, Richard 153 Moore, Sharon 162 Mordenti, D. J. 144 MRS. DORIS MOREY 113 Morgan, Darlene (Woodruff) 144 MRS. HELEN MORGAN 120 Morin, Alaine 54,144 Morris, Cherie 162 Morris, Cynthia 153 SOPHOMORE JILL NEVEL hangs an Original poster advertising the Stu- dent Council’s Midsemester Dance. Jill is a two year council member at Mishawaka High. Morris, David 162 Morris, Matt 75,98,153 Morissette, Daniel 85,91,153 Morissette, Timothy 97,162 Morse, Melinda 144 Morth, John 153 Mortimore, John 134 Morton, Rewis 153 Muhme, Sue (Powell) 134 Mullins, Ernest 144 Murry, Steven 144 Murry, Thomas 134 MUSIC HONOR 68 Muszynski, Connie 54,134 Myers, Donald 95,162 Myers, Paula 162 Myers, Sheila 153 Myers, Valerie 6,153 N Nagy, Janet 46,135 Nagy, Peter 135 Nagy, Thomas 153 Nard, Rita 162 Natali, John 153 National Honor Society 68 Naugher, Jeff 153 Neece, Renee 153 Needham, Debbie 162 Needham, Kenneth 135 Needham, Martha 2,144 Neely, Linda 153 Neff, Cheryl 153 Nehmer, William 135 Neises, Diane 144 Neises, Karen 162 Neises, Sue 135 Nellans, John 153 Nellans, Kenneth 135 Nelson, Darlene 162 Nelson, Dennis 162 Nelson, John 144 Nelson, Kurt 53,100,135 Nelson, Perry 162 Nelson, Ronald 135 Nelson, Stevie 162 Nelson, Thomas 144 Nevel, Jill 33,150,153,188 Newcomer, Anne 135 Newland, Donna 144 Newland, Shelly Newman, Sharon 135 Nichols, Carol 144 Nichols, Cathy 162 Nichols, James 24,154 Nichols, Jean 144 Nichols, Kathy 53,162 Nichols, Mary 55,69,135 Nichols, Pamela 162 Nichols, Pamela 144 Nichols, Patricia 162 Nichols, Thomas 162 MISS MARY NICHOLSON 113 Nicodemus, Pamela 144 Nicolini, Bonnie 144 Nicolini, Gail 144 Nielsen, Linda 162 Nielsen, Rebecca 69,135 Nielsen, Robert 86,154 MR. WILLIAM NIEMAN 119 Niemier, David 162 Nisley, Roxanne 151,154 Nix, Diane 162 Nix, Thomas 99,135 Nixon, Cindy 154 Nixon, Stephen 97,162 Nolen, Michele 162 Nolen, Sonia 154 Norris, Charles 154 Norris, James 135 Norris, John 162 Northcutt, David 162 rthstine, James 154 owicki, Steve 144 Null, John 162 MRS. HARRIET NYE 36,114 O Oblinger, William 135 Obren, George 162 O'Conner, Martin 62,156,162 O'Connell, Andy 84,162 O'Dell, Cathy 154 Odile, Conny 52,135 Odle, Kathy 135 Oklak, Dennis 97,145 Oler, David 162 Olinger, Rita 135 Olsen, Joanne 135 Olszewski; Cecilia 154 Olszewski, Julia 135 ORCHESTRA 52,53 Osborn, Kathleen 162 Osborne, Randy 162 O'Shea, Kevin 85,154 Osmanski, Joanne 145 Osmanski, Mary 162 Oswalt, Sherrie 162 Osza, Sue 145,55 Otterstein, Becky 162 Overhalt, Diane 135 Overholt, Gerald 154 Overman, David 84,94,162 MR. VICTOR OVERMAN 96 Overpeck, Karma 154 P Pace, Paul 145 Pace, Yvonne 145 Packnard, Bernard 145 Pajor, Kent 54,162 Palatinus, Joe 154 Palatinus, John 162 Palmer, James 162 Paridaen, Martin 49,135 Parish, Beverly 145 Parker, Dennis 162 Parker, John 82,145 Parker, Karla 154 Parker, Nancy 55,162 Parker, Rebecca Ann 135 Parks, David 85,154 Parks, Larry 97,135 Parrish, Gary 135 Patterson, Cathy 145 Patterson, Richard 162 Paulsen, David 162 Pawlowski, Jeanne 154 Peah, Michelle 154 Pearson, Larry 145 Peebles, Dwight 162 Peiffer, Debbie 154 . Peiffer, Patty 135 Penn, Wendy 154 Penrod, Michael! 145 Penrod, Ricky 163 Pensha, Joe 135 Perkins, Michele 55,154 Perri, Betty 64,69,76,135 Perri, Pat 163 Perri, Sam 154 Persun, Jamie 145 Persun, Rick 145 Pesut, Randa! 163 Pfender, Pamela 154 and swings through successful year MR. KENNETH PHILLIPS 121 MR. WILLIAM PHILLIPS 114 Piechoski, Stanley 62,135 Pietrzak, Curt 145 Pinkstaff, Kathy 154 Pitts, Linda 145 Place, Dawn 145 Place, Deborah 163 Platner, Nancy 145 Pletcher, Arthur 163 Pletcher, Kevin 135 Pletcher, Nancy 154 Pletcher, Rick 90,135,139 Plonski, Bob 75,135 Plummer, Jil] 145 Plummer, Joseph 154 Plummer, Ray 163 Podemski, Jacqueline 154 Phonov, Basil 135 Pola, James 163 Pola, Theresa 163 Polit, Robin 97,145 Pom Pom Pooley, Marcia 69,122, 135 Poorman, John 154 MR. DON PORTOLESE, 114 Portolese, Frank 58,68,75,124,135,145 Portolese, Jayne 154 Potts, Garry 84,97,163 Potts, Larry 84,97,163 Potts, Nancy 145 Powell, Cherrie 135,136 Powell, Gary 85,154 Powell, Ronald 98,136 Power, Barry 163 Power, Craig 55,145 Power, William 82,100,101,136 MRS. KATHY POZGAY 114 Pozwilka, Ann 10,75,145,185 Praklet, Diane 163 Praklet, Pamela 163 Pratt, Bruce 163 Pratt, Phillip 145 poe Prawat, Diana 145 Price, Donald 163 Price, Patricia 163 Pride, Randy 163 Pringle, Francis 5,64,76,136 Pringle, Susan 101,163 Purcell, Barbara 163 Putman, Deborah 154 Putz, James 156,163 Q Quam, Kenneth 95,163 Quam, Kirk 95,154 Querry, Nancy 163 Quick, Rayette 154 Quig, Jo Anne 163 Quill Scroll 69 Quiroz, Eleberto 156,163 R Radabaugh, William 154 Radcliff, Tracy 145,165 Railing, Joseph 163 Railing, Vee 163 Rarner, Wes 154 Ramos, Jeannine 136 Raiasey, Sandra 163 Rar. dolph, Debbie 70,136 Randolph, Fanny 163 SCIENCE BUFFS Mark Dicken, Jim Jordan, Gary Ammerman, and Gary DeMeester take a downward view at the photographer, as they prepare for their Miskodeed portrait. Randolph, Greg 85,94,154 Ransberger, Lynn 54,145 Ransberger, Mike 145 Ransberger, Paul 16,54,136 Rast, Robert 154 MISS AUDRA REA 104 Rea, Kim 163 Reaker, Sharon 163 Reasor, Elaine 163 Reasor, James 145 Red Cross 70 Redman, Kathy 163 Redman, Steve 136 Reed, Denise 154 Reed, Lydia 145 Reed, Margaret 136 Reed, Michele 161,163 Reeder, Terry 163 Reid, April 163 Reidenbach, Brenda 154 Reiter, Candi 136 Reiter, Sandy 163 Reiter, Timothy 86,154 Renfroe, Nancy 154 Rentz, Randy 136 Reynolds, Diana 156,163 Reynolds, Jill 163 Reynolds, Marsha 145 Reynolds, Robert 163 Rhoade, Susan 163 MR. GLENN RHOADES 120 Rhoer, Gary 163 Rice, Dan 19,50,136,174 Rice, George 80,82,94,145 Rice, John 163 MR. THOMAS E. RICE 105 Rich, Candy 145 Rich, John 136 Rich, Sandy 163 Richards, Delores 154 Richards, Pat 136,152 Richards, Randy 163 Richmond, Timothy 157,163 Richter, Robert 145 Ridenau, Chris 145 Ridenour, Terry 163 Riederer, Sue 53,71,136 MR. WARREN RIETVELD 49,114 Riffle, Carol 154 Riffle, Daniel 136 Rigley, Marilyn 69,136 MISS ANNA RILEY 121 Rimbey, David 154 MR. HAROLD RINEHART 121 Ringelski, Michael 163 Ringelski, Selma 136 Rish, Neil 95,163 Ritter, Mike 145 Robbins, Leonard 163 Roberts, John 154 Roberts, Robert 163 MR. DAVID ROBERTSON 115 Robertson, Brad 136 Robertson, Gladys 136 Robertson, Greg 82,136,181 Robertson, Rebecca 145 Robertson, Rick 82,84,94,96,145 Robertson, Rodney 145 Robison, Eldon 163 Robinson, Mark 97,101,145 Robinson, Susan 161,163 Robinson, Terri 163 Rodgers, Max 82,96,136 Rodich, Terri 163 Rodts, Diane 154 Rodts, Eric 69,136 Roesenei, Thomas 163 Roesener, William 154 Roettgen, Cindy 154 Rogge, Cathy 145 Ronan, Chris 38,145 Ronconi, Edward 145 Rose, Debbie 145 Rose, Deena 154 Rose, Kathy 145 Rose, Michael 163 Roseander, Cathryn 163 Rosell, Jan 145 Rosenburgh, Becky 154 Rosenwasser, Daniel 163 Rosenwasser, Imy 145 Rosier, Mary 136 MR. MILTON ROSS 109 MR. WALTER ROSS 95,114 Roush, Bradley 54,163 Roush, Jeff 154 Roush, Scott 145 Rucano, 163 Rupard, Gary 82,145 Rutkowski, Lynn 145 Rutkowski, Mark 163 Rydzinski, Peggy 136 S Sabade, Daniel 98,136 Salter, Debbie 145 Samuels, Gail 154 Samuels, Sue 145 Sandefur, Kathy 163. Sanders, Larry 17,55,136,145 Sailor, Valerie 163 Sarkisain, Nancy 154 Saros, Christine 154 Sater, Donald 163 Sayer, John 145 Sayer, Merri 154 Scarberry, Joanna 154 Scarberry, Ronald 145 Schaffer, Kathy 145 MR. ROBERT SCHALLIOL 104 Schaphorst, Richard 84,95,163 Scheibelhut, Jean 163 = Scheibelhut, Jeanne 6,66,145 Scheibelhut, Kathryn 163 Schelstraete, Carolyn 154 Schilder, Christine (Ipe) 136 Schiffer, Lynn MR. RICHARD SCHIFFER 104 Schiffer, Terri 74,75,69,136 Schimizzi, Josephine 154 Schlemmer, Sharry 136 Schlundt, Marrianne 16,26,53,154 Schlundt, William 26,95,145 Schmanski, Mark 163 Schmidt, Becki 136,137 Schmitt, Joseph 95,163 Schmitt, Marc 37,97,154 Schnaible, Tom 83,85 82,90,96,99,136,137 Schoen, Ray 163 Schortgen, Mariella 163 Schrader, Dave 75,94,154 Schrader, James 84,94,163 Schroeder, Craig 54,95,163 Schroeder, Diane 137 Schroeder, Linda 137 MR. LOUIS SCHROER 49,114 Science Club 73 Seaman, Rebecca 154 Seggerman, Carol 163 Sellers, Sue 154 Semenak, Becky 10,25,69,137 Senff, Stephen 163 Serge, Marisa 163 Severa, Frank 84,94,163 MR. CLYDE SEVERS 114 Sexton, Tom 163 Shafer, Cindy 38,75,140,145 Shafer, Linda 163 Shaffer, Lea Ann 145 Shane, Sandie 137 Shannon, Karen 137 Sharkey, Michael 55,154 Sharp, Joyce 50,54,154 Sharp, Patty 163 Sharp, Ray 154 Sharp, Steve 154 MISS PEGGY SHAUM 116 Shaw, Gilbert 163 MR. JERRY SHAW 50,94,100,119 Sheets, Donna 145 Shelby, Sam 52,145 Shelby, Tim 84,97,163 Sherrill, Cynthia 21,154 190—Index Sherrill, Rand y 145 MRS. JANET SHIELDS 116 Shillihg, Connie 154 Shindledecker, Alicia Shingledecker, Alicia 27,65,68 76,101,137 Shingledecker, David 163 Shingledecker, Kathy 16,145 Shingledecker, Patti 163 Shirf, James 145 Shirk, Cynthia 154 Shock, Donald 20,78 80,82,137 Shoemaker, Anita 145 Shoemaker, Michael 137 MR. WALTER SCHRADER 57,116 Shriver, Becky 137 Shriver, Richard 137 Sierens, Sally 137 Sierens, Sandy 163 Sigler, Dorothy 154 Silvers, John 85,151,154 Silvers, Sandra 154 Silvers, Sheron 154 Silvers, Susan 164 Simbeck, Agnes 164 Simbeck, Donald 154 Siple, Patrick 55,100,154 Siri, Joseph 145 Siri, Larry 155 Siri, Michael 38 54,145 Siri, Rick 164 Skeeters, Jill 22,67,68,137 Skene, Mark 8,54,137 Slagle, James 145 Slates, Donna 145 Sloan, Robert 155 Slone, Elaine 155 Slone, Thomas 54,145 MR. ALVIN SMITH 97,116 Smith, Carolyn 155 Smith, Cheryl 164 Smith, Connie 164 Smith, Debby 137 Smith, Donald 145 Smith, Gordon 38,145 Smith, Jeffrey 145 Smith, Jessie 95,155 Smith, Karen 145 Smith, Kirk 164 Smith, Laura 164 Smith, Nancy 137 Smith, Rebecca 155 Smith, Robert 164 MR. ROBERT SMITH 30,105,192 Smith, Sharon 164 Smith, William 137 Smoker, Steven 85,155 Snyder, Ted 42,155 Snyder, Vernon 99,145 Sobe cki, Ronald 84,164 Solliday, Steven 137 Sommer, Donald 145 Sommer, Theresa 164 Sostack, Carol 145 Soule, Steven 164 Spagnola, Albert 155 Spain, Suzanne 164 Spanish Club 64 MRS. LA VERNE SPEISER 104 Speiser, Tame 155 Spencer, James 55,145 Spencer, John 155 Spite, Tabitha 145 MRS. ALMEDA SPRAGUE 120 Springman, Curt 164 Springman, Renea 137 Squibb, Donald 137 Squibb, Kim 156,164 Squibb, Terry 164 Stafford, Kenneth 164 Stalcup, Darlene 164 Stage Crew 27 Stamm, Todd 82,145 Stamper, Gail (Gilvin) 137 Stanage, Stephen 164 Stanisci, Nietta 3, 164 Stanley, Cynthia 145 Stanley, Jon 164 _ Starke, Charles 96,98 ,145 MRS. THELMA STARKWEATHER 120 Starosta, Gary 145 Starr, Kenneth 138 Starr, Sue 164 Stebbins, Gary 145 MISS JUDY STEBBINS 63,116 Stebbins, Larry 146 Steele, Faythe 138 Steele, Karen 54,164 Steffens, Gordon 146 MRS. SHERYL STEGICH 110 Stein, Joan 146 Stein, Roseanne 138 Stein, Sharon 164 Steinke, Douglas 97,155 Steinke, Greg 101,138 Stephenson, Kathy 164 Sterzik, Jeff 97,164 Stewart, James 146 MR. EARL STINE, 110 MISS HELEN STODDART, 110 Stoeckinger, Louanne 164 Stoekinger, Marianne 164 Stokes, Becky 138 Stokes, Kathy 146 Stone, Kenneth 138 Stopper, Janet 164 Stout, Donna 164 Stout, La Ann 51,142,146,166 Strader, Ralph 138 Strahan, Gary 164 Strahan, Richard 164 Strantz, Charles 66,137,138 Strantz, Frank 164 Strantz, Liz 164 Strantz, Michael 146 Stratton, Deborah 164 Straughn, David 138 Straughn, Paul 164 Strauser, John 101,155 Streich, Charles 82,146 Streich, Susan 65,69,76,138 Stringer, Drennon 82,97 A46 Stringer, Theresa 164 Strock, Glenn 138 Strock, Jackie 164 Strock, Jerry 101,146 Strock, Vicky 155 Stroh, Terry 146 Student Council 58,59 Stuff, Donald 146 Stuff, Roger 86,101,138 Summers, Phil 59,138 Swadner, Dan 17 Swadner, Kurt 54,138 Swadoner, Mark 146 Swartz, Jeanna 37,155 Swartz, Sue 164 Swayzee, Sue 164 Sweeney, John 39,146 JUNIOR WALTER CLEVENGER de- livers one of his sermons in one of the area churches, using a reference from the Bible. He plans a life work in ministry. Sweeney, Julie 164 Swiental, Debbie 138 Swimming 95 Szypiorski, Linda 138 T Tagliaferri, Mark 40,155 Tam, Garry 164 Tam, Janet 30,164 Tansey, Suzanne 38,39,50,138 Tate, Gary 164 Taverneier, Randal 164 Taylor, Cathi 155 Taylor, Debbie 164 MR. JOHN TAYLOR 94,116 Taylor, Leigh 164 Taylor, Mark 155 Teeter, Glenda 146 MRS. HELEN TEETERS 116 Templeton, Tom 50,96,101,155 Tennis 87 Tesch, Kevin 138 Tevault, Mary 155 Tevault, Michael 146 Thacker, Max 146 Thespians 68,69 Thibodeau, Michael 155 Thiel, Paul 155 Thielking, Tom 146 Thomas, Anita 164 Thomas, Ann 146 Thomas, Derinda 138 Thomas, Judy 155 Thomas, Julia 155 Thomas, Robert 69,138 Thomas, Sharon 146 Thomas, Sharon (Armstrong) 138 Thompson, Barry 155 Thompson, Carol 146 Thompson, Thomas 155 Thorton, Kim 89,155 Thornton, Mark 22,54,95,164 Thornton, Vicky 53,54,155 Tindall, June 54,146 Tkach, Andy 53,101,155 Tolley, Jackie 164 Tomaszewski, Amy 146 Tomber, Deborah 164 Tompskins, George 155 Toombs, Carol 138 Toops, Frank 155 Torian, Sarah 155 Toth, Barry 155 Toth, Bryan 164 Townsend, James 146 Tracas, Ronald 8182,96,138 Track 100 Tranter, Gary 17,138 Trimboli, Frank 97,155 Trimboli, Jenny 146 Trimboli, Joseph 6082,96,99,138 Troiola, Wayne 84,94,164 MR. BASIL TUDOR 121 Tuma, James 138 Tuma, Sally'55,164 Tuttle, Debbie 164 Tyler, Marcia 164 U Unruh, Curt 73,138 Ushers Club Vaerewyck, Brian 164 Valko, Kurt 146 Vallance, Betsy 138 Vallance, Valerie 164 VanArsdale, Joyce 138 VanArsdale, Roger 84,97,164 VanBruaene, John 85,97,151,155 Van Camp, Jean 146 Vance, Dennis 138 Vance, Diane 138 Van Den Abeele, John 22,52,55,69,72,138 MR. HENRY VAN DE PUTTE 121 MR. OSCAR VAN DE PUTTE 121 Vanderbeke, Linda 17,138 MRS. ALPHA VANDER HAYDEN 121 Vander Heyden, Mark 164 MRS. ELIZABETH VAN DE VOORDE 121 Van De Voorde, Vickie 164 Van De Wille, Susan 146 Vandygrift, Ralph 164 Van Geoy, Debra 146 Van Laecke, Jeannette 155 Van Ooteghem, Richard 85,151,155 Van Rie, Debra 65,69,72,138 Van Rie, Sue 164 Van Valin, Brent 146 Van Zant, Fred 155 Varner, Sandra 164 Veal, Pamela 155 Veal, Robert 155 Vena, Bruce 164 Vergauwen, Julius 164 Verhamme, Phil 49,146 Verhamme, William 82,146 Verspelt, Vicky 164 Verstraete, Debra 155 me hae Pom Vickery, Donald 139,146 Vicsek, Diane 164 Vicsic, John 97,155 Vinnedge, David 155 Vinnedge, Marlene 139 Vollmer, Patricia 146 Von Bergen, Debby 52,141,146 W Wachs, Michael 146 Wagner, Cathy 77,146 Wagner, Debra 155 Wagner, Janice 139 Wagner, Kirt 164 Wagner, Robert 156,164 Wagner, Terry 155 Waidner, Deborah 55,147 Walker, Paul 69,139,176 Wallace, Carolyn 164 Wallace, Pamela 155 Wallace, Thomas 139 MISS BARBARA WALTERS 118 Walters, Bill 82,96,155 MR. JOHN WALTERS 121 Wanbaugh, Randy 155 Wanbaugh, Sue (Dunkleburger) 147 Ward, Dennis 82,94,101,147 Ward, Hope 147 Ward, Jerry 164 Warner, Diana 147 Warner, Terry Ann 139,181 Warren, Carolyn 147 Watford, Sandra 147 Watford, Stephen 155 Watkins, Robert 139 Watkins, Roger 139 Watson, Dean 155 Watson, Rick 88,92,139 Watt, Jackie 164 MISS MARY ANN WATT 52,109 Watts, Jackie 147 Waumans, Debbie 164 MR. LLOYD WAYNE 118 Weaver, Kevin 164 Webb, James 155 Webber, Jenie 164 Webber, John 147 Weber, Michael 147 Weber, Steven 155 Weeks, Danny 94,147 Weeks, Mike 85,155 Weeks, Nancy 156,164 Weesner, Teresa 155 MISS ROSA WEIKEL 66,107 Weiss, Debbie 148,155 Welch, Marica 65,164 Welch, Wanda 155 Welch, Wendy 155 Wenker, Deborah 164 Wennerstrom, Pauline 147 Wenta, Cathy 147 Wenzel, Darlene 164 West, Karen 52,155 Whalen, Michael 164 MRS. ISABELL WHETSTONE, 120 Whitaker, Thomas 164 White, Brenda 164 White Caps 70 White, Charlotte 139 White, Debbie 139 White, Donald 147_ White, Jacki 155 White, Jeff 155 White, Meshell J. 155 White, Nancy 164 White, Nancy 147 White, Pat 164 White, Wanda 147 Whitt, Janice 155 Whitt, Pegi 139,153 Wichs, Barbara 164 Wilburn, Jackie 164 Wilcox, Steve 101,155 Wilder, June 164 Wileman, Richard 164 Wilemon, Marie 139 Wilemon, Tina 147 Wiley, Janet 37,164 Wiley, Thomas 147 Wilk, Steven 139 Wilkins, Joy 164 Willekens, Linda 147 Willekens, Louis 164 Willekens, Lydia 147 Williams, Claude 147 Williams, Cyndee 155 Williams, David E. 86,155 Williams, David L. 86,100,155 Williams, Debbie 155 Williams, Deborah 147 Williams, Gregory Williams, Larry 155 Williams, Lawrence Williams, Lynn 139 Williams, Susan 155 Willoughby, Deborah Wilma, Barbera 155 Wilma, Chery! 165 Wilma, James 155 Wilma, Nancy 165 Wilson, Dan 147 Wilson, David 100,155 Wilson, David 69,86,139 Wilson, Kathy 53,165 MISS LYNETTA WILSON 105 Wilso n, Robert 147 Wilson, Steve 165 Windomaker, Susan 154,155 Wise, Pamela 147 Wise, Wendy 70,155 MR. CARL WISEMAN 86,100,113 Wiseman, James 82,100,139 Wiser, Dennis 147 Wiser, Janis 155 Wiser, William 155 Witt, Danney 165 Witwer, Patricia 139 Wolf, Maria 155 Wolf, Marty 147 Wood, George 139 Wood, Kenneth 54,155 MR. MARVIN WOOD 92,94,1 00,118 Wood, Mike 47,147 Wood, Richard 155 Woodruff, John 82,147 Woodruff, William 54,97,165 Woods, Sandra 155 : Woody, Steve 155 Wooley, Barry 155 Wrestling 96,97 Wright, Joyce 52,139 Wright, Robert 94,165 Wroblewski, Chris 33,64,69,139,176 MR. VICTOR WUKOVITS 110 MR. VICTOR WUKOVITS, JR. 112 Wycikowski, Ed 165 Y Yakym, Rudy 33,139 Yakym, Vicki 147 Yancy, William 147 Yansy, James 165 Yeakey, Chris 165 Yeager, Joseph 155 Yocum, Michael 54,165 Yoder, Carla 165 Yoder, Nancy 54,155 Yoder, Terry 147 Young, Connie 21,40,165 Young, Debbie 69,76,127,139,175 Young, Diana 139 Young, John 139 Young, Judy 139 Young, Kay 50,139 Young, Kevin 165 Young, Lori 155 Young, Pamela 139 Young, Richard 155 Young, Rose 147 Young, Vickie 155 Y-Teens 70,71 PRINCIPAL ROBERT D. SMITH stops off at Sue Students, Mr. Smith enjoy good times Z Zakrocki, Garry 147 Zalas, John 98,155 Zavor, Charles 165 Zehner, Edward 155 Zehring, Gene 147 MR. FLOYD ZEIGER 109 Zeller, Connie 155 Zemialkowski, Julie 147 Zieke, Cindi 69,139 Zirille, Frank -155 Zirille, Joni 147 SENIORS BECKY LIDOLPH and Peggy Blair wait their turn at tryouts for ‘Music Man.” Windomaker’s for lemonade while checking progress on the floats, for the homecoming parade. LAUGHING SADIE HAWKINS party-goers are Cindy Shafer, Gene Zehring, Denny Ward, Theresa Stringer, and Mike Siri pose for their ‘’formal”’ portrait. Index—191 UReflecting—1 BEAUTY IN A backyard is caught by photographer Bob Jones. Trees illumined by sunset’s light said ‘‘peace.”’ | OPPOSITE PAGE, the wonder of a child and her puppy isa timeless beauty. Fresh life, little things express life’s splendor. A HAZY SHADE OF WINTER under the glow of street lights on a serene night makes a sleepy restful street scene. seene. Beauty Beauty celebrated In quiet, or in crowds... The golden glow of sunset on the beach The peaceful smile of one in love, A tiny child’s wonder, Or the whole exquisite beauty Of silence... solitude... alone. Knowing ugliness, sadness, and pain Gave beauty’s soul new meaning, Made beauty’s joy complete. For every one there were Solitary joys... celebrating beauty Discovered in awareness Of each individual. ee OOS i | | oh ie iia 194—Reflecting Turning on to countless things Was a valuable part of the search... A search that took individuals Down many different roads... Some turned on with drugs, Others turned to yoga, Sensitivity, and religion. . . Some turned on to books So much to learn outside of school... Go crazy trying to fill your head! Some turned on to the road, Heading out on their own, Bucking the norms to make it Alone... Many turned on to each other Turning on Breaking stereotype barriers With the quiet trust of love, Turning on in conversation, Private laughs, total happies. . . Turning on to music, Till the pulse and you were one, Black soul, hard rock, Quiet, peaceful, freaking, Was a turn-on many shared... Painting, writing, quietly Contemplating... Turning on was not limited To any age or group... It happened in the mind and life Of every individual. YOGA IS ONE way to turn on to purity of body and spirit. Ann Bergin and Carol Kimmel give themselves to its discipline. MUSIC OPENED NEW horizons of emotion and thought. Some listened quietly; others like Tom Grayson freaked. ie a Reflecting—195 ELLIOT Today Today is a reflection of yesterday, Events of a year were present in Rapping, writing, and serious thinking... Continuing war in Southeast Asia Caused many to question the Role of our nation... Unemployment soared; Nixon took steps... Women’s Lib spoke up loudly, New job fields were opened A third walk on the moon brought Americans together; discrimination tore us apart... Deaths of rock idols Janis Joplin and Jimi Hendrix caused many to question the glamor of drugs... Agnew won fame with his rhetoric And golf shots, while Ralph Nader waged his war of investigation... An earthquake in Los Angeles terrified The west, as the Manson murders had done. . . Battles against pollution, waged nation-wide, Brought new fear and new reform... In a year of alienation, awareness, and life, Changes came about in each individual. CONSUMER EXPERT, RALPH NADER and his youthful “raiders’’ aroused consciences through his investigations. BELOW, South Vietnamese and U.S. troops go into battle. Cambodia, Laos, and the Calley trial caused Americans to question war. RIGHT AND BELOW, guitarist Jimi Hendrix and blues belter Janis Joplin met with tragic drug deaths, causing new fear. — = ees le Reflecting— STUTTATEe TTTTITI (Aa e SOME SENIORS CHOSE college and further education. Susie McManus, like many others, registered for class at |USB. MANY WILL LEAVE the protective atmosphere of Mishawaka for the expansive involvement of a large city, such as Chicago. Reflecting—198 Becoming Looking toward the future, The world is ours To take, make, break, Or laugh at... Shaping a world Our children will change; Fighting others’ battles, But knowing individual victories, Even in defeat... Some will become parents, Some will be killed, Some fit into the norms, While others fight To change them... Time is ours... we seize the moment And living, grow into it. Waiting has been, and still is, But the future looms close, We have grown out as individuals. SENIOR DAN BALANCIO discusses his conscientious objec- tor draft status with Father Loren Nys, S.D:S. of Marian. KIDS AT HUMS School are a reminder that we will be the adults of their world and subject to their questions. Bae Dan Rice... cover... Deb’ Lamb... .. ssociateveditOr” 7] . . . Susie McManus . . . production manager ... Lisa life flows on Ermeti . . . Zann Kowalski . . . Debbie Young... within you relate! a 7 “Eileen Fischer ... Gary Ammerman... Jerry Fox... Fran Pringle .. . Kris Bosler ... Alicia Shingledecker without you - . . section editors ... Del Rae Johnson... Kathy Micinski . . . Betty Perri . . . Sue Streich Sg RORTIS Wroblewski ... assistants . . . Carol Kimmel .. . Pat Flaherty . .. layout... Bob Jones . . . Matt Morris ... dim Jordan... Rick Doles... Jon Gratzol . z. photography .. . Cathy Wagner .. . Vince Floridia. . . index ... Mark Dicken... business manager ... Beth Blue. . . editor-in-chief . . . Miss Barbara Mayer... adviser... peace... SUMMER Ae ce ee eee! Hot sun, ieyay lavelh as on the beach, ! New friends, rock festivals, — Wale) (elaleres Nae Oler-l eon Led to:'September:.... Tedious assignments, but still Thinking free, . DYktvclanarclavemelave(=)ecicclarenjarep A place to be; People to share with... Everyday a new experience, Happiness, tears, crazy games Of growing older and still Laughing at ourselves (Even when it hurt the most) “We got by with a little help From our friends’... Realizing just in time that “The darkest hour is always Just before the dawn.” The sun sets now... . STolanleMolavgncont-(- Maroy : ‘ A year ’s events Alects) in Our memories, ‘ Awakened by a familiar face, story, expression, ‘ Of mood...” | . Seniors leave now... Graduation was 3 “A long time comin’ and it’s gonna’ be a long Time gone’. | : As with every sunset, We anticipate the dawn... Questions still unanswered are the Ol at-)i clare ls smen an ce) ante)a aes e In the night we plead for answers, | In the light we see ourselves. 4 A sunset is an ending, | ’ But a promise of things to come. | 4 This was just a beginning... A turning point for some, Coming years will see.our idealism Tested, shaken, changed, or proven By war, human beings, questions, and Life... | 4 We leave confident we will always live : In the sunlight of our individuality. SS NS . . Ni 3 ty Na SQM ay FRR A WY ‘ a SY AN N: SN NN Ny AGS SS Ny AN SN AN ANS Yo SS REANAN RY SY SANS RAY SN . AN RRR RRRRG wh VAS NN SNR Y NN ws Ny S . ANN Y Sh te Aa) SN RS UNS NY x8 AN ROY ARS nN eS Way . i TAN RANT RRR VARS MS NS SNS AAS ‘ ARON . aN XN ERS AN SO WS NS aN es S AS Y Ww UN ‘t RSE RAN RAN ANN A SENSING EN SAREE ANY K AN ANS AY Aw ‘ Ni . RS NS YS ANRRE SISA RASAS . RON AS WS Ss RY S NN TA NY SASS SA a wo RNR RRS SS Rs RN SEN AN Sn ROR RA RAN SN NY SK LAS ‘ eet speretncres ion] peste: + LEG AN A Wy ws AN AN SY o AN AS SAAN EARN AS S Ny . A “ ‘ ‘ ‘ AN . ny wv eA NY wt ' .. wr RN AS SAN AY AS RNS RN ‘ Y NRO ANAS RS AN NAS SRA NN AN OS Sh ANY RRR x ‘ AM A AN AN aN . NS se i , Ni we WS A AN AS ANS IN AN ‘S “ ah AN CN ‘ HONS ‘y S ANN yy } wh ANN WY . S AAG ANY AN LAREN WN y NK AAS AN aN ‘ ° N ANN ental RNS RAN x SO AN ANS ASG Ais wy . RN . a Me NS aes Wey NOON SNARE AE RANE SN . y oS ANN AN RR sN x S x ‘ Sy RAN y “ AX ty EN AY AS Tay) ay AK Y x SY SY RAN Aww .., ay WV : SHAAN RNR RRS SSSA AN ARES easy se NS ‘ Nt RAR Ny ws RY NA RRS sy . SS SAI SSS RN ak RON ARES Sh RON Sin A SE NE ‘ aR ASSN Y ty RERRENN x SSSR . SEAN ihe Nt Ne ‘i SS Ess RRS AR tase Dao E pet a ne