McClellan High School - Lion Yearbook (Little Rock, AR)

Text from Pages 1 - 278 of the 1984 volume:

X I9 f 4 Ziihfhf X ' ,gk f-A Xfbx-. - VW! .Y ,, K M' V -My R W k 1 ,QA iMMN.X QMQMwQ AN Q , I D ml, .1 - . A A qw 2 1 ., Jgxk A-ywww I .L J . KM ix W X33 Y-'Y Ll,j-.E-9 ' 2,1 Aff' A 1 xi Nz W wi U ,J--fgf KM YfY 'Jw r' ' -. 'A A avr.-lj :E , Lfytixid hi Kg ' R if Q , iiv Q . xh UM , gf-1' X U Q X 'A- ' '-' 3 R-mf - 1 X J 1 V V T- X wwf ' i H-5.3 inf 'f' 4 . ,wm W1xw QWwwMf - y -L vQg..f 1'-.N 7 A ,,.,. x mf Q ,.,, J M fs 'W' V 5, XJ X , -. Q' f ,gi tak I. in ' .- ftiqb x if iii' M' A-3' f CW 931 W , ' ' X 1' . md, X-s,..2f 1 5 59' J kr this Q2 , if, I G . XJ' K, dip Yr f ' 'gf-' 'E 'WV N' 1 X, -- :A QM x ,,. -i f f gif J J- 97' a - Je J R x -5.-jf , J 2,41 V- ,, ..Q,, ,,,V 1 ' ,yi 94 X 4?-'I ij Rf -, n in ,f cg' - J ' f , O' 557 MIA-W if .. ' ax' Ny XJ' 'X p ' yn . . , ,,, - gg IJ, WO xi X G, O, .A '99 . f A J N R, of L H . LJ 9-BMJ ' sgvy xv- . ' Oc QM fwfr 'Q x xv. .Q ' if 9 ' Xe , M - x . A - ' -4 ,... 2' XX my QS? , K.: xv X, QM Xa Q. I ,A N . A X, , , NK, 1-4 ' xl fb if lx ,rj Xl T X xx XX k .x 9 I YM-N Q K x f Q 5, C' A VP fi' mv' 'J fn 'A X X ' lx ,N x X Y . Y X, I .-'- XXX! U XM! - it inf, x x x X, XX x X 3, I M AX N27 I MXM KV 3, Q,-'V X kr' A M Ev 1 Q1 QE, XS, XJX! X cy .X .I 1 A- N I k Q r . , xi xx! K-:x E ki E Ax Azxjibq X -Nrfkbx A Nb in Qf by ' xv Q' CV ' 1 fm 4 H C3 Ki kv if Q5 gm . ff xv f 5fL w Q f Q1 L iw XLT X1 , .P T! xy M by VX Nxvv X J AV? ,X I 1 RN ' XXFJ N N xx , fl 'Vg L 1 V ,FB f ' -5-1, 'T ' 1 xx! X X N., 1 - XJ X N - xx-I 7,1 amy. y'AX,T-I ' fax If X XI x KK lv, Tb ,K .QR dx, X'X'XxQJkl K-MQ X-3 yxbgx ,lj F -.,f K,,,.,,h rally Rfxx 'J Q7' , 'XJ , fxvx! Y xi Rb Q y..! A fx V Y CX-.57 VTX LQAQ9 EI Kool , Q N A lf ou, L Mg A Hump!-QN QTXDA . LMNQ Qui. A ,u A AZTNDQ ,gf-My ini' Q QSAA QGGQNEXQTEZ . C195 oi' my Qui , Q IQ WW 'Q PX wo? . QTQSK-'Q Y! 534 A. XADQKT NR xl bujmg w f75 9 my 8 ok 'Qs 339A iff Af? if? 'CAFE XZIQJCW 'gg 'Q '. E OQL ,E is EEWf s ef QZQEWEEE Egvylvff if QH ,,, 5252555 fwffwfwfwa 3555 dw' Waqlgfs Qilff' 'ff I S- D Lf 1 9-P A0213-q Q gig? fm UF WD Icwwg 0 OS QQ JQQQZG Q CFXEU ,DM 7 I Jjwfffffffv W ,J -'W ffl? lqoqwifla 'VJUPW O2 Q 77 nfw 55 V947 vrv,Kax J 17 'I F009 KK ' awww Q-,MA ,adm I lmwiwen 'V -Cm 'ws W5 7W?ff2'l6C'mf9L gzfff-fffffyy .op 75133210 spam M4 -I 'Mg C-7f2'2rvf:7,B WS:-,u 1 Q M I 5 P78 l 1 as 1 T ' M me ff Capping off Home- coming Week, many students attend the game. Arkansas' Drill Team of Distinction, the Lionettes, has established a tradition of percision and skill by enforcing a strict sys- tem of demerits for its members. Highlander, the advanced choir, has be- come the dreaded competition of other choirs in the state at regional and state competitions since this choir usually wins sweepstakes. Academically, our school has been proud of a traditionally advanced curriculum while emphasizing the benefits of college prepatory courses. We have renewed this emphasis by adding three advanced place- ment courses to the curriculum. McClellan also offers the largest choice of academic units in the state. Traditional spirit groups, class profiles, school events, legendary teachers with dis- tinctive class projects all continue to enrich the cultural tradition of our high school life. Lining up for the annual Home- coming Parade are the McClellan cheerleaders. Playing the piano is only one ofthe talents that Kara Jolliff, senior, displayed at the Sounds of Now. ff Crossing the Arkansas River at the annual Livestock Parade are the Lionettes. Performing his rendition of L'Alantown is ju- nior Brent Rose. Seni kous Alisa Mlmck rlde in the Homecoming Pa rade. A Z ei 2 Q ? 2 5' 'f Az H2 br X 5 5 X Z E X 2 if af F ii Q I 2 3 Q Q 2 Q 2 E 2 Z 2 Z 2 Q, 2 2 S' X, 3, 3, Z5 3 fi 3 if 2 3 5 E S 5 S 3 E 2 5 5 5 E ,Q fi tr is 5 E S 5 E 5 2 g S X ! x 3 i s 5 s xi i E v x 5 5 S s s E E E 2 ? Q 5 Q 3 E 1 E 'z 5 E 5 S , i 3 2 2 5 5 2 if 52 E E E 3 35 9 x 3 b A..... W MNMN W., ,,... HWW A W A, W WW AA .. . WMM AM WwWWHMm 5 Camping Out -El yone's summer calanders 1 with important events to attend between May and August. This was especially true for the newspaper and yearbook staffs, the Lionettes, cheerleaders, choir, and drama students. The newspaper and yearbook staffs attended the annual Arkansas High School Press Association Con- vention, which was held at Ouchita Baptist University, July 11-15. Stu- dents attended classes pertinent to their duties on each staff. The con- vention was highlighted by the criti- quing of the yearbook the last even- ing with an awards ceremony held the next morning. Brady Massey, senior drum major, and the flagline attended a camp at Missouri Southern State College in Joplin Missouri. The flagline won a superior rating for its show. Brady received the following distinctions: At an early morning practice, Lionettes take a break and await further instructions. Preparations For The Coming School Year Begin In The Summer superior rating for directing and march- ing routines and Outstanding Drum Major for the whole camp which con- sisted of approximately seven hundred people. The second week of August the entire band gathered at McClellan for two weeks of hard work. From 8:00 un- til noon, the band practiced marching techniques and formations and mem- bers learned scores of music in the afternoon. The cheerleaders also continued a tradition of excellence at summer camp. From July 17-22, fourteen cheerleaders and Mrs. Terri Fielder went to Ole Miss for their annual cheerleading camp. Winning superiors evening, the cheer- leaders were ranked fourth overall. Other promoters of school spirit, the Lionettes officers, attended the Dallas American Drill Team camp. From June 27-July 1, Toni Taylor, captain, Diane Reagan, first lieutenant, and Jennifer Linkous, second lieutenant stayed at SMU and was presented the Outstand- ing Achievement Award. Perhaps one of the most memorable events was the farewell party given to Mr. David DeArmond and Mr. Tom Schumacher. The event, held at Burns Park, had more than fifty people in at- tendance. The waterslide attracted many, but that was not the only reason that people attended. The choir and drama students wanted to say good-bye to two teachers whom they have ad- mired for many years. Plunging into the water, Senior Kathy Gal- lagher enjoys the farewell party at Burns Park. ---'fi-. -. ' ' :W -- 'Uivff - iw 'Ml rf, 'S The last stretch of the water slide is the best part for seniors Lisa Burgess and Anna Bullard. Llonette officers Jennifer Llnkous, Toni Taylor, and Diane Reagan put to use their skills learned at SMU. The yearbook staff listens intently to the critiquing of the 1983 Lion at summer camp. -A Backup singers Bill Monk, David Head, Kathy Venable, Susan Craig and Valesa Davis perforrn with robot like motions to the song Mr. Roboto- jim ua-5 l Singing the song Rosanna are Steve Leop- ard, Tom Falls, Scott Talley and Roger Daven- port. Performing the song Don't Tell Me You Love Me is 1983 graduate Greg Murtha. 10!Sounds Of Now From Fund Raiser To Major Production The Sounds Of Now Has Entertained Students For 13 Years he day was Thursday, March 26, 1970. The place was the McClellan High School gym. As the students crowded into the gym, Rae Holling- worth, Ted Barnes, and Dan Chandler walked to the microphones. This was not the beginning of any ordinary as- sembly. This was the beginning of a tra- dition that would last for more than a decade. This was the 1970 Sounds of Now. In 1970, Virginia Hollingworth, For- mer Choral Director, decided that some sort of fund raising had to be done in order to expand the schools, music li- brary. Mrs. Hollingworth also wanted to do something to increase the number of students involved in the choir pro- gram. Presenting a program which would allow students to show off their musical talents as well as a program which would be enjoyed by all students seemed to be the best and most worth- while decision. The many choir members chose six- teen songs which were popular songs in that year. Among the songs sung were Leaving on a Jet Planef' Raindrops Keep Falling,' and Aquarius!Let the Sunshine In. The students who performed at the 1970 Sounds of Now probably had no idea that they were a part of something that would be a lasting tradition. I e As the years passed, new stage tech- niques and scenery were used. The use of a backdrop became an essential part of this annual event. New sound sys- tems, which were purchased with the profits from previous shows, were also used. Later colorful programs with ar- tistic designs were added as well as a theme for the show. In 1977, choral director Virginia Hol- lingworth presented her last show. However, Mrs. Hollipgworth's retire- ment did not put Sounds of Now on a backburner. When David DeArmond took over as choir director in 1978, he continued the tradition of an annual Sounds of Now, expanding on Mrs. Hollingworth's ideas. Mr. DeArmond and the choral de- partment presented the Sounds of Now in the gym for four more years until the construction of the auditorium. Continuing a tradition of excellent entertainment, the 1983 Sounds of Now began with the illusion of floating plat- forms, and the use of smoky clouds, and flashing light. Obviously, the theme was Illusions Dressed in black pants and shirt and a tiger print tie, former student Steve Leopard introduced the 1983 Sounds of Now with his version of Mr. Robotof' Mimicking robots from the popular vid- eo of this song, the backup singers per- Laura Brantigan's hit song Please Stay is performed by senior Alisa Minick. formed with mechanical movements and expressionless faces. Portraying what has traditionally been known as a nerd, 1983 graduate, Beau Menely sang the popular song SWangini . Senior Alisa Minick per- formed Please Stay and Senior Bill Monk performed the Alabama hit Dixieland Delight. You and I, the song made popular by singers Eddie Rabbit and Crystal Gayle, was performed by seniors Karen Quinn and Scott Talley. Junior Brent Rose sang Billy Joel's hit song Allen- town, and Steve Buck performed the song Africa. The final act was senior Tom Falls and junior Kevin Breeding singing the song Every- bodyis Working for the Weekend. Through these performances the theme Illusions became the thir- teenth production of the Sounds of Now. Sounds Of Nowfll e Flnal Traditional End Of The Year Activities Reminds Students That Only A Few Weeks Were Left In COuHtd0Wn The School Year. he Miss MHS pageant, held April 23, continued a tradition of al- most two decades of recognizing the school talented beauties. One of the ten finalists selected in March would become the new Miss MHS: juniors, Janean Polanski and Wendy Childersg seniors Kara Jolliff and Toni Taylor, and 1983 graduates Diane Ball, Kim Graves, Karen Jones, Lisa Anderson, Robin Cal- houn, and Kim Mordecai. These fi- nalists were judged on talent, even- ing gown, and special attire divisions. Senior Toni Taylor was named first runner-up, Lisa Anderson and Kim Graves tied for second runner-up, Dianne Ball received Miss Conge- niality, and Kara Jolliff received the talent award. Karen Jones, senior was crowned the 1983 Miss MHS. Juniors and seniors then turned their attention to the Senior Prom held April 9 in the Ballroom of the Excelsior. The theme Unforgettable Dreams became reality because of the magnificent granduer of the ballroom. Just one month later, seniors began forming lines for graduation practice. On the evening of May 19, cars began streaming toward Barton Coliseum to the school's graduation ceremony. Five hundred and three seniors were ushered by Grand Marshalls Karen Quinn and Brian Costa. Receiving the honor to ad- dress their senior class were Brett Da- vis, Mike Kyzer, Lora Laffin, and Kyle Butler. Every graduation has its emotional moments. This ceremony's moment came after Kyle Butler's speech enti- tled H2003 Reunion. Kyle received a standing ovation not only for the sub- ject matter of his speech but also be- cause he had earned the admiration and love of the entire school. The 1983 Miss MHS Pageant was won by senior Karen Jones. Formal attire does not keep these seniors from dancing 'knew wave at the 1983 Senior Prom. V4 1-Alb. Waiting to serve 1983 graduates are seniors Kim Odom and Jeane Crouch. 1983 graduates listen as fellow students give their speeches, ask The hustle and bustle is evident while lining up for the graduation ceremony. Displaying her award winning talents is senior Kara Jolliff. Talent entries included dance by senior Toni Taylor. Girls' State delegates Michelle Leggett, Kara Jolliff, Elisa Caplinger, Shelly Ferguson, Jen- nifer Linkous, Rhonda Smart, Karen Quinn, Kathy Gallagher, and Lynn Lyle. 3 WG-'ww ,, fi ,-w.'I'.!Y if -me Him: , f L A ig .M , Q- 1 rw. ,Q , 1 ,ilu :.i,5L1iyaQ'. - Boys' State delegates Kelly Pucek, Hob Wood, James Higgins, Brian Hill, Doug Vann, Brian Grant Phillips, Michael Thomas, Mark Milstead, Costa. Han Choi, and Jeff McClelland: S e r Students Explore Enrichment. hat is reality? Ask any one who attended the fourth annual Gover- norls School, and they would answer this question with a variety of answers. Kara Jolliff, Tracey Summar, Bobbi Walthers, and Hob Wood spent five weeks of their summer at Governor's School. Hendrix University in Conway became their world beginning June 12 through July 16. Governoris School is a five week resi- dential program for students who spe- cialize in certain areas of study. Profes- sors, doctors, and teachers from Arkan- sas and other states taught and directed students toward 20th century theories and ideas. The days were divided into three areas. Area I allowed students to work in their major interest area, Area II was a discussion time for esthetics, religion, ethics, and logic, Area III allowed stu- dents time for expressing feelings, writ- ing in journals, and for discussing cur- rent events. Other activities for students included lectures by Hilary Rodham Clinton, wife of Governor Clinton and also chairperson of the Committee on Excel- lence in Education and Tom McRae, President of the Winthrop Rockefeller Foundation. Films such as Fahrenheit 451, 2001 Space Odyssey, Lord of the A, ilfife, Spending an entertaining day at the state capitol are seniors Elisa Caplinger, Karen Quinn, Shelley Ferguson, and radio disc jockey Craig O'Neill. ' Students attending Governor's School are Kara Jolliff, Bobbi Walthers, Tracey Summar, and Hob Wood Flies, Psycho, Rashomin, and On the Beach were shown. Entertain- ment was also provided through dances, concerts by the Governor's School cho- ral music and orchestra students, a dra- ma production of Charley, a star gaz- ing field trip, and a trip to the local movie theatre to see Twilight Zone- The Movie. Best of all, Governoris School was a unique learning experience and a time to make friends. Tracey Summar com- mented, f'Governor's School helped me in so many ways. I cultivated many new interests and learned to listen with an open mind, I also learned to express myself in a better and more productive way. The University of Central Arkansas and Ouachita Baptist University were the hosts of the 1983 Boys' and Girls' State. Hundreds of students from all over the state attended this week long event. Among the distinguished guests who spoke were Senator David Pryor, Steve Clark, Hilary Rodham Clinton, and Governor Bill Clinton. Delegates to Boys' and Girls' State were also enter- tained by radio disc jockey Craig O'Neill at the State Capitol. Girls' and Boys' State were designed to educate seniors about their govern- ment and to encourage leadership in their community and school. Senior ,, I .... ., . + . J A , . . A , N' All Eg . Y Wx fl ' . Analytical Thinking And Workings Of The Government Han Choi said, Boys' State was a motivating experience. When speaking of the many people he met at Boys' State, Hob Wood commented, You get to meet the cream of the crop from all over the state. We will run into these people in the future and it will be to our advantage and theirs that we have been previously acquainted. 5 ar' 1 it X K :Qi 'H I -.X E 'h ' . E .. . aff. l we 3' ,fi '- nt. em. .Ly ' if , .. , . gggg . fp . iii 'S tllr X. . Yfilh ' .:,,. ,,,q..,' Mass Confusion aking up in the morning at after until most with six olclock was a traumatic event the familiar routine of sleeping twelve. What to wear became the important issue in conversations friends and family. It was the first day of school and the worst day of school. For the last time sophomores ex- pressed their fears to their fellow class- mates on their way to school in cars and buses. They were afraid of not being able to find their classes, scared of the teacher if they were tardy, and too ap- prehensive to ask anybody for direc- tions. Juniors were eager to learn who broke up with whom over the summer, who would make fun of their new hairdo, and who all bought what cars during the summer. Senior Billy Mathis and sophomore Stephanie Rutherford check their sched' ules on the first day of school. Long Lines And Lost Sophomores Signify First Day Of School. Seniors began the first day of their final year with conflicting emotions. The security, familiar faces, and routine of high school were dear to them. Yet college, jobs, and family life were draw- ing them gradually into a new world. Long lines of people waiting for their schedules and students checking their friends' schedules to see if they had any classes together were familiar sights on the first day. The heat schedule was used in order to make the first day more comfortable for students. The first day of school was a day of confusion for all. Students were franti- cally looking for their classes and at the same time looking for friends they had not seen for three months. But all the mispronouncing of students names by teachers and all the wrong schedules could not take away the feeling that this was the first day of the beginning of a great year. Waiting in line for schedules becomes tedious for sophomores who are eager to start the day. il? 31 l 4 M. On their way to their classes, juniors Tina Hinson and Lorene Henderson make sure they are going to the right classroom. 4 X Anticipating receiving their schedules, stu- dents wait in line in the school gym. Becky Honey, Poll! Hilliggga and Kenny Hood receive thelr schedules after waiting pa- tiently in line. 'Pffcllfw y fs USCZAUQ 3 QNWAUQ Give 1 ' e ' iF,!n'C'lfwl see wfllfifl iauQ9 f5 W QQ' ltd 6 bw ,J 5 if Qls be ewes ma- il l3?Jb l'!gU? fj0U'HF C fig' Qo5'1.'yu.? f-2 'Hwfi 196:54 of like no-ei me?x+ Oviifi lflffi ff U is t ,:1f,,: if cw N-Hwc glcbnib +o Muffy KCC? 'J loufjhq XjDuEi V 192-to Ssifitiiei M M15 First Day!17 ?5v 3, 1 Rf., , .-,1,w,1,,k.l r Again, 'Seniors Reign' j AlII10St Anything Goes,And It Certainly Did! Alarge sign displayed the words 'fSeniors Reignf' sections of people wore white, blue, and red shirts, and classes chanted their class yellsf, This was no ordinary assembly, this was Al- most Anything Goes. Chuck Dovish, the traveling Arkan- sas Reporter from Channel Eleven, served as emcee. After showing off his McClellan High School T-shirt and baseball cap, Mr. Dovish began the an- nual festivities. The first event was the tug-o-war. The juniors and sophomores were the first to tug it out, with the juniors final- ly winning the battle. The seniors and the faculty were the next to battle it out. Although the faculty had a slight advantage of many more members, the seniors still managed to come out ahead and defeat the faculty. Not content to be in the loser's bracket, the sopho- mores, with a little help from a few sen- iors and juniors, defeated the faculty. The juniors and seniors, tugged it out for first place, with the seniors coming out victorious. Event number two was the watermel- on eating contest. Kelley Geurin, facul- ty member, was the winner in this event, managing to eat the most water- melon in the shortest time. Senior Jeff Haslauer came in second place, Rodney Priest, sophomore, came The pyramid building contest ends again with all sophomore team members crashing to the ground. 'N-vm in third place, and the juniors, repre- sented by Chuck Lody, came in fourth place. Although this event was all in the name of fun and games, senior Jeff Haslauer received a bloody nose when during the contest a watermelon seed became lodged in his nose. Jeff, however, recovered and lead the seniors to a second place finish. The third event was the pyramid building. The faculty again came in first place. The juniors came in sec- ond, seniors came in third, and the sophomore were literally at the bot- tom in fourth place. The final event was a new event to this annual activity: the egg drop. This event had one person lying on his back with a cup in his mouth and one person on another person's shoulders. The person on top, cracked an egg on the other's head and tried to drop the egg in the cup held in the personis mouth. The sen- iors were the winners in this unusual event. The seniors who participated in this event were Thalia Miller, Da- vid Short, and Kelly Pucek. Juniors Scott Ketcham, Pat Mitchell, and Matt Ketcham came in second place. Coming in third place were sopho- mores Nicky Ruffin, Greg Moore, and Greg Lewis. The faculty team came in fourth place. When all the events were over and the points had been counted, the sen- iors were once again victorious. Sec- ond place was a tie between the ju- niors and the faculty. Third place was given to the sophomores. When all was said and done, the large sign shown at the beginning of the event was true, seniors do reign! 1 wma,-V W ffm My X :WA-Q zuggg. ww swvsw Qafkimsfffii 4mmE,Q?m,fw SK Wzzywzw wif' Www A525225 lsiiii? Qjfiigitisi 'ZSZHQSSTDF Q Msszzsswwzz W f ,1.,gfwS2s'3?BlSbQwg5SiEwill H5521 ,,g5m5f,2 255 gm-MESSiielggvgg'-wggwwM5s'x' M2442 ALSSHZZQSQ 225 vw 5 7 5:2 Waist-wW52w?:22:f ' mffwfmwaqi 59: Q E Q Q Wmszizsm 6 2255225 :sf 5522 EEK was , Qfmmb . U ,A WN Mm. W E -U M, w,MMgf,,gee, MWMWM i A W M. ,gQ.1fgw,,,,w,-.WMMHgegwweWt WMm,wQ,m:g,g X b.m.M.w,,w1 . ,MMg,..,., ,V , ,Mummy MW. ww. K k , W mem ,fygm Q F gmzzmimbf My ,amz .Wmwk zzgwwh NM, ,zggzfgggggmmmmms 2553 5332 MQW M 3532535 ggw M33 335 'MU A' Wm U UL bqiimvwawmm MW ws wh G 25:22:53: Mania M. , ,gab nv,w , 2555551552 A 21352523 :ESSSEQ Wfmgg, Swmxgmssszf 2' MSWf:sS:.szs:wMvM2:F'-22 BEM Mm M, . wwmm W, 4 Q Mm w17wm..,,,.1w,, www .Ham , W , ,, .Wm , ww ff f . 2 - , H ..,,.,fzwMfmqfUm:,,::s4ff-MLW. - W , .4 -7 M--vm.2fzzsifzzszawhwitfszzifwzffm,, . .,-fig.:..:fwwe ',VitinsAM555525231f?5::Es5:fea5eSQ55:???2Ee5:2a:s:f:::Q:f::Q:WFiffi'rag'-v.::f2:,:5:::iW2S22w A22 K. www' .2 2523. 5525 S 5 S5 ia ESE igg 2355 rr 1 X, : . P S' 53555 1 X 5 f fwi 3 9 .,ff 2 4 A J Xl ,, - f M Q, 2 Q, f 5 ., Q , ., EW ? 'M M41 ' f Z ,,4, yi ,swf Z2 W M if :WI 6 im I an xx 1 i if ' Li QR X N. W sw i f. Sid 5 was W x z::!5t::9'L :Z ' x E w 4 W .aw 1 , lrror, lrror n The Wall' Gazlng Into lrrors Is Cnly Cne Way Students Cause Congestlon In Halls. hey were seen in the bath- rooms. They were seen in the hall- ways. They were seen in their cars. They were even seen in the class- rooms. Who were these people? Yes, they were those dreaded primpers. They caused congestion in the bath- rooms. They caused congestion in the hallways. If there were traffic jams on Geyer Springs, they probably caused these too. And above all, they created many distractions and much confu- sion in the classroom. Primping seemed to be most populai with girls. Their methods of distractior varied from the mere retouching of lip- stick in Mrs. Beard's algebra class, to a total reapplication of makeup in the bathroom. While some girls only glanced at their mirrors occasionally, others gazed endlessly for hours as ii what was reflected in the mirror was more fascinating than what was going on in their class. These girls purchased purses with built in mirrors, or they merely adjusted their Image mirrors in their purse so that everytime they glanced down, they could admire them- selves. When students in Mrs. Jones' English class began primping, she po- A quick glance at her reflection in the of- fice to check her hair is junior Leslie Bearden. litely told them to put their things away and pay attention. The reason Mrs. Jones and many other teachers did this was because they were raised to believe that it was rude for ladies to apply makeup in public. Primping was also evident among boys. Although boys did not tote purses around with mirrors, combs, and brushes, this definitely did not stop them from primping. Carrying combs and brushes in the back pockets of their Lee's or Calvin's and relying on their girlfriends' mirrors while sitting in the front courtyard or in the front seat of their Camaro, boys primped almost as much as girls. When on that rare occa- sion, a mirror could not be found, boys cleverly gazed at their reflections in the windows of the office, library, or cafete- ria. What was the purpose for all of this hair combing, makeup applying, and constant gazing into the mirror? It ap- peared that all this fuss was done sim- ply to attract the eye of that gorgeous boy or beautiful girl they saw strolling down the halls or sitting in their boring social studies class. Although, primping was successful for many, others had to continue and hope that one day all their work would prove to be worth- while. A cascading v1ater'iaXX furnishes a captk- vating backdt op for sophomore Dada Mc Mee and Bang YNQXXS. The outside scenery of the Excdsior Ho- t.eK px ovides an umaded backgr ound fox Qxmkots Joey Clanton and 'Yrkcka YN axeen. ff gh g 'V ug ii 5:1 his ou can't judge a book by its cover. Nor can you judge a person by the clothes that he or she wears. Or, can you? A person's clothing usually tells others a little bit about their personal- ity and what they think of themselves. At this school, certain students could be found and identified just by the clothes that they wore and also how they wore them. Preppy styles were the most popular. Penny loafers, Izod and Polo oxfords, walking shorts, and ties were only a few of the trademarks of the Prep. Plaids in every color combination were worn by the braver Preps and under no condi- tion were socks to be worn except with walking shorts which were usually ac- companied with knee socks. Another popular and newer style was New Wave. This was a combination of and cf x use C350 ggi. W' 2 baclsgtl:iXX mae S 1' M ff- I 0 W th Y atYyCX4 T F 5455 EENM-1 .iw V,., i M, Being! I Tagxg . f , ei 1 l Q03 V sevloi T the 50's styles and modern styles. Blue- jean jackets, jazz oxford shoes or dance shoes, sleeveless t-shirts, abstract ear- rings for girls and a single pierced ear for the more adventurous guys were known as New Wave styles. Vogue and GQ magazines influ- enced their own style of clothing for a small group of students. Senior Scott Lewellen was a good example of the GQ fashions. Twead jackets with matching cardigan sweaters, Dior dress shirts with tie bars, and argyle socks were fa- miliar items in Scott's wardrobe. The fashions reflected the times and the attitude of the year. Rebellion, an- tipathy, involvement, pride and many other qualities could be associated with the styles. This gave evidence to the fact that yes, you can judge most people by the clothes that they wear. nw' ning 'tb me P-fkaaxxoowx K the 3145333356 for sem o baC . , The XOR? eleiiuav YXXXXWFQ' o glmplixen 'AOA .4 ' ' wie 53 vide Hegel Qfgts Qcoti Fashion!27 Back To The Grind For Most Students, Everyday Was A Typical Day. he alarm sounded as the voice of radio disc jockey Craig O'Neill blared in their ears. It was 6:15 am, the beginning of a typical school day. At about 6:30 a.m. most students rolled out of bed and stum- bled to the shower. Some used the refreshing vitalizing essence of Coast deodorant soap to help them awak- en. They were not, however, in a pep- py, happy mood like the man on the Coast commercial. Boys then shaved, brushed their teeth and left for school. Girls, usually taking more time to get ready than boys, rushed to finish applying their makeup or tried to catch a glimpse of the best looking news caster on early morning T.V., Greg Hurst. ' After rushing to school, students gathered in the front and back court- yards to talk, gossip, or finish home- work. In a last minute effort to hear the latest gossip or finish the last problem on their Algebra assign- ments, students rushed to class try- ing to beat the tardy bell. After roll was checked in first peri- od, students prepared themselves for another typical day of attending three morning classes, NAP, and for The cafeteria was not only a place to eat but also a place to see friends as shown by juniors Chris Yount and Sheri Melton. 28!'1 yp1cal -g',. ii iigggigig many three more classes in the after- noon. First and second period seemed to go by rather quickly for many students. Third period, however, was a killer. No matter what class students were in, whether it was an elective such as choir, or a required course, like English, they desperately awaited the 11:35 bell. While some teachers insisted upon torturing their students until 11:35, a few gracious teachers allowed students to leave a class a few minutes early. Students bounded down the hall only to run into Mr. Stueart. Realizing that they did not have a pass, they did a military about face and a double-time step to the cafeteria. Some students had visions of McDonaldland, while others longed for a soft pillow to sleep on. For many students NAP was not just a time to eat, but a time to catch up on sleep they had missed the weekend before. Avid soap opera fans rushed home to see what was going on with Nina and Cliff or Jenny and Greg. Although NAP was a time for rest, few students were prepared or ready to go to fourth period. As the clock neared 12:30, students, in the back of their minds thought, I better go back to school. More often than not, however, students shoved aside those thoughts and continued eating, sleeping, and watching All My Children. Then in a rushed effort students dashed to their fourth period class in an effort to avoid their fourth tardy. Many students were successful, yet there were still many pink tardy slips signed by Mrs. Hartwick everyday. Back in the swing and prepared for their fifth and sixth period classes, stu- dents with a sad yet happy feeling went to fifth period. They weren't too happy about more chemistry homework or an- otherpaper deadline, they were excited because it was now 1:30. Only one hour, and they would be free to leave school and spend their time as they wished. When the 2:30 bell rang many went home. But other students involved in extracurricular activities such as athlet- ics, band, and yearbook faced another grueling hour of hard work. After the 3:30 bell had rung, a deligent few deter- mined students remained for hours on end in order to perfect the offensive play, to play every note with impecca- bility, or to finally produce a lasting memory of the school year and its events. With books in hand, students found the energy to make it home and once again begin a typical evening filled with Shakespeare, algebra, chemistry, or his- tory. To most students, this was an al- most perfect end to a typical day. '52 :fl I f,f' x ' V 'vii mul-,Z 'Q sf 1 5 V W if kan M r 1 X W 2 a , 41' mf ,s N , v Y A W, me , W SNR . QMQSS sf ii We '-2'-:. ,.nf, Anxious to get home,junior Jay Summerlin leaves campus after sixth period. mn....s.W.. .J I Although most students have already left campus, some were faced with a ride on the A bus. A front courtyard planter provides a seat for senior Patrick Hill to do some last minute studying. I Typical Day1'29 + i S it 1 In AP English, Kathy Gallagher, senior, fol- lows the reading while the rest of the class watches the television production of Hamlet. .,....,.,-vm While many students do their homework, junior Mitch Mitchell takes the opportunity to nap during class. The Peppermint Patt Syndrome Falling Asleep In Class Was Embarrassing For Some, Amusing For Gthers ost students at some time during the class day became bored with what was going on in class and daydreamed about things much more interesting, wrote notes, cre- ated abstract art, or even fell asleep. The highlight of many students' day was when a person sitting next to them dozed off. Not only were they able to play some funny practical jokes, but sometimes the entire class devised pranks to play on the unsu- specting sleeper. Mrs. Morrison's third period Eng- lish class seemed to be particularly cruel to one student who made the terrible mistake of falling asleep. When the snoozing student did not awaken at the sound of the bell, the class of thirty quietly tip-toed out of the room and turned off the lights, leaving the sleeper to his dreams. When senior Mitch James finally 30fCiassroom Sleepers awoke, he stomped out of class more embarrassed than mad, as he asked, Was I really asleep that long? As his friends laughed hysterically, the sleep- er, now completely awake, quickly walked down the hall, trying to escape his embarrassment. Although events such as these may have caused embarrassment for some and amusement for others, they were all a means of not only disrupting class but also creating lasting memories. .,...- A rubber band and a piece of paper provide a means of avoiding work for junior Jamie Cole. Note passing provides a means of communi- cation for juniors Mark Morehead and An- nette Scoggins. Reading the local papers is very educa- I tional, but Junior Jamie Cole keeps Juniors Chuck Stewart and Brent Coffee in his Ameri- can History class from reading the daily' news. Although it may seem that Don Edwards is doing his homework, he is doodling to pass the time in American History. i , l J Classroom Sleepersf31 The UA Four was the sight where many students saw thei f t T H t k movies of 1984 including junior Monte Blue and sophomore im I Prices . 2 .iii eei i i Fav o r1t e s Movie An Offlcer and a Gentlemen Male soloist Michaei Jackson TV Show Male Actor T in Cruise QX MASH Female S0101St Stevle Nicks Pat Beletar k ylvester Stallo-ny 4 Song fi'ota1Ecl1pse of the Heart V , Actress ii'i , ,V,ViV,Li , Li Mercedsei ' Corvette' 1g,ihwst0re niunds i s iii Restaurant s i 'Red'iLnbste1f M Group i'Lox?ex'iJ0Y i i ' s iDef'Leppardi i s ioi iisu i R200 iSfati011s'ie2iilI???g1f'ni?95 I fiB6Qks ssni.si orff?E10W91fST,3I1s71f11BsiAti31f3f of i i i i 4 if of i i i I 32fSurve , i i ff! Michael Jackson's Thriller album catches the attention of senior Laura Brantigan. .ls g Team Topping the list of favorite cars is a Cor- vette, which senior Han Choi proudly dis- plays. Everyone's favorite jeans are Levis and the familiar blue denim and Levis tag could be seen on campus everyday of the week. 5. I e The Year Of The Lion A Survey Of Students Revealed Their Favorites 0f 1984. wenty years from now when graduates from this school unearth their high school yearbooks from the top shelf of their closet what will they be looking for? After wiping the many layers of dust from the cover, the book will be the first thing to be looked at. After perus- ing every picture carefully and reading every caption twice many memories will return of your high school life. But what about the year 1984? Would you remember that An Officer and a Gentlemen was a popular mov- ie at that time or that Richard Gere was one of the hottest film stars? Would you recognize Def Leppard as the newest and most popular rock group well known for their songs Photo- graph and Rock of Ages?', Would you recall that the rising prices of previous years stabilized and allowed a more self-indulgent lifestyle? Movie prices made a hefty cut into the budgets of students, unless they owned a movie card. Movie cards were pur- chased at school for S7.50g they al- lowed students to gain entrance at the movies for a childs price of 32.50. Lower gas prices were an incentive for students to travel the extra miles to attend an away football or basket- ball game. And finally, would you remember Total Eclipse of the Heart by Bon- nie Tyler as one of the most popular songs and that Wendy's was to Mc- Clellan students what the Beverly Hills Polo Club was to Californians? These and other favorites were what made the year 1984. Survey 84f 33 n is Helping Cthers Along TheWay Providing Helpful Services To The Community Also Provides Learning Experience For Students ven though school takes up a great amount of a student's time, some gave of their precious time to help oth- ers along the way. Senior Michelle Tucker and junior Lana Taylor spent their Tuesday and Thursday afternoons at the Baptist Medical Center. They were involved in a volunteer program called Medical Ex- plorers. This program was geared to- wards students who were interested in a future in the medical profession. This program allowed students to tour the various hospital facilities and present questions to hospital personnel. This unique experience also provided an opportunity for participants to ob- tain jobs in the Baptist Medical system after appropriate training. Another community service which '34fCommunity Services Moving more than 800 cans of food took the combined efforts of seniors Brian Costa and Keree Muradian and sophomore Paula Shepherd. Unpacking the schools contribution of canned food is senior Student Council member Kathy Gallagher. involved the entire school was the Can- paign, sponsored by the United Way. In November the Student Council was in- vited to a press conference at KATV Channel 7. They were being saluted for their hard work in the Canpaign. Every first period was asked to donate canned goods to the needy. McClellan came in first place with 800 cans of food. l ap United Way representatives address the press at their home office along with Mr. Bob Cross, principal. Being a Medical Explorer officer requires much time and effort on senior Michelle Tucker's part. X, Their weekly tour took senior Michelle Tucker and junior Lana Taylor to the mater- nity ward. Congratulations seems to be in order since the Student Council contributed the most canned foods with the help of all of the stu- dent body. Community Services!35 if W-8.59 v 3, S . X , - wrwffy--... -.. W N WPG. X., K ... 4. 9... N.. X:5Nl', :E: . 1-fi X HQ Tim ::ss'.Sf'.fif-wig. 11,. 3 Q., .Mk .. Z '- . . 11552.55 Q NYS Q. V. .S .x .. 3 Q K N X K Q 5 xx? N' Q X XS X X 5 X N 5 X Xl K X x R X QQ X F X X X X X S 5 Wg. . . kk ,S .,,:. .. . .K .qs E .. 5 ..,.wf .- .'-'V' . iw. K - f i Q N 'S Sa. 1 gf f 'R Mfnfl I I .V 31 ' Ls A' , 'Ah X Q fix H. if . sg 36fStudent Life 'wwf Sunday, Bloody Sports Shorts Sunday The football season ended wlth a bang when the Los Angeles Ralders came out on top wlth the largest polnt margln ln Superbowl h1sto ry Marcus Allen ran away w1th Most Valuable Player and two TDs The formatron of the Unrted States Football League CUSFLJ gave football crazed Amerlcans nearly year round games The Baltrmore Orloles took the World Serles Pen ant prevlously held by the Phlladelphla Ph1ll1es 1n seven game battle w1th the Ph1ll1es One of the most memorable lndxcents of the season was the game w1n nlng homer by George Brett It was so notable that Brett made a homerun because of the controversy surroundrng It The homer was at frrst dlsallowed because of the amoung of p1ne tar on the bat but was later remstated In Arkansas sports Lou Holtz res1gned as head coach and was replaced by Ken Hatfleld a former Razor back The Olymp1c Dream con tlnued after a tradltlonal four year lnterval The w1n ter games were held 1n Sara jevo Yugoslavla and the summer games were held 1n Los Angeles Cal1forn1a At 6 22 a m on October 23 CST 239 Amerlcan soldlers marlnes and sallors were k1lled by two tons of TNT At the Be1rut lnternatlon al Alrport a new Mercedes truck crashed through the gates and on a su1c1dal mls slon drove lnto the four story bulldmg used as barracks for the U S soldlers It took rescue partles three weeks to uncover the last of the b0d16S 239 Amerlcans and 58 French soldlers It IS belleved that a communlst backed terrorrst group was responslble for the bomblng Lady s Flrsts From Atlantlc C1ty to the outer reg1ons of space wom en broke through sexual and raclal barrrers that had long l1m1ted the1r horlzons Dr Sally Rlde was 1n the news as bemg the f1rst wom an 1n orb1t Vanessa W1l hams 20 became the flrst black MISS Amerlca t1tle holder ln the f1fty SIX years of the pageant s h1story These two women began and w1ll contmue to be lead ers 1n the movement towards equal opportunltles for those who 1n the past have not been allowed to reach the1r ultlmate potentral because of barrlers set up by SOCl6ty O07 Class1f1cat1on NOHf1Ct1OH When news of 007 was broadcast over rad1o and telev1s1on newscasts lrsten ers 1nstantly thought f James Bond But xt was not the latest news on Sean Con nery or Roger Moore It was the terrlble truth of the SOVI et bomb1ng of the 747 O07 Korean A1rl1ner On September 1 1983 a Korean A1rl1nes was bombed by a SOV18t a1r to a1r m1ss1le over the Sea of Japan In the followmg crash the 269 pas sengers and crew members were k1lled Sovlet off1c1al clalmed that the plane whlch had strayed 1HtO the1r a1r space was a spy plane U S Japanese and RUSSIHH navles searched for nlne weeks for the fllght 1n dlcator that rf found would explam why the plane had strayed 1nto Sovlet a1r space Before they were able to lo cate It the slgnal emanatlng from the box burned out Al though small search partles contlnued to look the1r at tempts were 1n valn for the box was never found By Gone Many vorces and faces that rang ln the New Year 83 would not be heard from 1n 84 Among them were Den HIS Wrlson i395 of the Beach Boys who drowned Karen Carpenter 1323 who dled of heart fallure after many years of battlmg agalnst an orexla nervosa JGSSICH Sav Blography age who appeared on the screens of m1ll1ons of TV sets across the natlon as an an chorwoman for NBC dled ln a freak car accldent 1n whrch she drowned Other deaths lncluded those of Paul Bear Bryant D3V1d NIVGH and Eubre Blake a famous Jazz mus1c1an HesA At the end of 1983 It was estimated that Mlchael Jack son age 25 was worth S510 mlllxon Hrs record breaklng album Thrlller hlt the charts 1n both Amer1ca and Europe as no other album before th1s t1me Thrlller scored SIX h1t slngles on both continents passmg both the Beatles and Elvls Presleys records Jacksons musrcal Vld60S also created a sensatlon of the1r own V1d80S such as Beat It B1ll1e Jean and Say Say Say were the most re Thrlller quested and sought after Vld eos The most talked about vldeo was Thrlller Spannlng fourteen mrnutes It was the longest vldeo of the tune and because of f1lm concluslon and also because lt had been shown to a theater audlence on the West Coast It was el1 glble to be nomlnated as a short f1lm for the Academy Awards The vrdeo costs Jackson S800 O00 but proved well worth lt by the reactlon of the publrc POl1tlCS A black a woman two Jews and a cr1pple became an rnfamous quote of the controverslal ex Secretary of lnterror James Watt These Ill used words referrmg to the coal leaslng commlsslon cost Mr Watt not only hrs noted reputatron 1n pol1t1cs but also forced h1S reslgna 83 84 t1on a few days later Watt was one of elght Cablnet members who re slgned 1n the thlfd year of offrce under the Repubhcan Presldent Ronald Reagan who rn h1s 84 budget pro posed the 3rd largest d6f1Clt 1n U S h1story ' ' y . . . a n n ' . n - , - ' 9 a , . 7 ' I a ' 0 - A , - 1 n n . , . , . . 3 , - ' . ' - . - , Q o . . , . ' 7 ' a n , , I ' - - , I ' zz aa - - ' a a ' 9 , 0 . l - - . . . , . I . , . 0 , - . 9 - , 7 . , - 7 1 . . . . 1 I i Q i ' Z , , . . sc - as ' - - I Q 1 - I Q n - - cn ' as - 0 o 0 I Q ' - 9 0 . , . . I O ' , . . - 1 a 1 . . . . . . ll , - 0 . . ., , . . . Q Q , , ' . . . l - r s - - - as ' ' 7 x ' . . . . . ,, . - I , 7 9 ' ' - ' 1 ' a ' 9 9 ' s ' 1 ' . , . . . Student L1fef37 5 P 5 E Z 5 1 5 5 3 2 2 5 5 1 4 E 2 E 2 E X 1 2 5 5 5 e 2 3 5 B 5 5 L 5 3 2 5 2 2 2 5 I z Q f 2 5 5 I 3 Q 1 5 Q 2 E 1 5 Z i Q 2 E , I 4 5 5 E Bruce Waldrop and Regina Dunlap type some announcements for Mrs. Powell. FIRE Willis, Front 2nd Row: Mr. Back Greer, S. Shipman, B. James Roads, D. Scoggins, 2nd Row. S. Wade, D. Short, C. V. Hancock, P. A w Bockmick, K. M.W1ll1ams, K gne L. G. Bynum Vicky Wyse and Greg Spann wait for a visitor for them to help. 'Only Responsible Students Need pply' This Is The Only Requirement For The Following Positions. The computer age has finally arrived - now students are just a number, and the computer knows where that num- ber is every period of the day, thanks to the twelve computer aides who assist Mrs. Martha Gresham and Mrs. Mattie Ruth Tipton. These aides must be totally trustwor- thy because of the potential for creating havoc in the computer system. They are responsible for entering all student in- formation data such as attendance and adding and dropping of students. Last period aides must transfer all information to permanent files, a re- sponsible and time consuming task. Some aides have come in at 7:00 a.m. or stayed late when necessary to handle computer information, said Mrs. These aides also keep state atten- dance books which determine state funding and which are subject to audit. Office aides and counselor aides must also be dependable because of their re- sponsibilities. Office aides answer the phones, take messages, and pick up at- tendance cards. Counselor aides must file schedule and deliver messages. Even though fire marshalls are not classified as aides, they do offer much assistance in maintaining safety stan- dards and fire drill exercises, which are required by state law. The law requires that students vacate the building in less than three minutes. At one fire drill we were able to vacate the building in less than ninety seconds! exclaimed Mr. Steve Geurin, sponsor. Gresham. LIBRARY AIDESZVFIOHE Row: B. Howell, Sig Hambrick, D. Weatherly, K,3f1'11O2!Xi!3011.,fjI-. TFBI74, T' Dyer, A, lfreemim, L, Lavender, Mrs. Moslay. 2nd Row: J. Waysorx, T. Reeves.?M. Mathis, Jlgifiolaiiski, T.iBOW!flHI'l, Al Balckl U?8Uq,N-'yfulielk T- Jalffei, MBA Magness. fBackHRow: J..EIiis,. T. Gordon, S.. QiiyefSgghazfgp..J..Harriw13tJ. Ba?teI',1,Q2'L9WiS',iD-VNHZQ, Grfrhomgs, Mfg, Hawkins. COUNSELOR AIDES: Front Row: A. Lowry, J . Wayson, T. Spar- row, Perez, J. Wasson. 2nd Row: P. Grabber, R. Dunlap, S. Tnggle, N. Hampton, J. Smith. 3rd Row: P. Melton','C. Hefton, M. Warner, U. Gfiffiii, V. Davis, T. Davis. Back Row: D. Brarmigan,7D. Cowart, M. MilStead,'T. Hartwick, Kgggyle, D. Speer, J. 'Erotter.,.G,..Dggus. 1 . Due to the lack of planning ahead, Michele Dupree gets rubed by a considerably shorter person, Dana Friend. The State Capital was the site of the traditional Clhrist- mas concert. HIGHLANDER CHOIR: Back Row: J. Mathews, B. Bisbee, EL.wHasl,auea53 R. Mallott. G. Phillips, P. Tollett, B. Monk, A. Cozart, T. Falls, T. Ross, M. Lindsey, K. Muradian, T. Long. Row 2: B. Sims, B. lVlasse?jMS. Talley, Burton, B. Petty, C. Stringer, K. Galagher, T. Miller, K. Quinn, S. Allen, Minick. Row 3: B. Slawson, K. Luce, S. White, K. Jolliff, M. Jackson, M. A. D. Griffin. ,V. Davis, K.'Stimps6n, L. Hunecker, M. Micheal. Front Row: B. 42KActivities V . Darrell, L. Burgess, K. Jones, D. Fleming, T. Taylor, A. Patten, S. Summers, K. Odom, S. Ward. HIGHLANDER CHCIR: Back Row: K. Breeding, E. Lewis, J. Rogers, S. Buck, C. Dunkum, B. Rose, M. Draper, G. Lamb. Row L21 J. Shell, D. Cowart, K. Shipman, C. Minick, D. French, S. Norton. Row 31 Monte Blue. K. Venable, M. Mitcheli, T. Cling, T. Hinscm. Front Row: S. Sansing, L. Williams, M. DuPree, R. Walker. D A D U U L 5 i a Members of the bass section of Highlander choir practice their part, I The Choir That Wouldn't Quit! Choir Produces Excellence In Performance Traditions are sometimes hard to build and easy to break, but our choir continues to build a traditionally out- standing program. Choir members could experience a special kind of pride when they wore their Highlander robes to another school because with that robe came the pride of years of superior ratings and awards. All year long High- lander continued with this tradition of ZJAQZ?tiFfH23?lRsws?:iiShQ3ly SaiisingaLanaglrluneclsefin21B1eSmDaYifw DOHPB i 232'reine1a,lMicheilefsurwn, Km Jimiff, Alisa Minickg'fKareii Quinn, Back s :,aR1.1WQQ2Ql'3Rfl?Phiii3PS, Todd apes, Jeff Haglauea, PaulQVTol1ei:t, Brett Rose, gggeviaiiQefegeanggsawnfiraiiey-grmarieaanigam.eofa-yy r eerh i excellence and pride through festivals and other exceptional programs. The Choir Department gave four con- certs all year beginning with the Fall concert and ending with the pring con- cert. At the Christmas concert the pre- vious directors were acknowledged and the new director was presented a bronze music stand and a Cocker Spaniel. After March all of the serious compe- AGIRLQS CHQRUQQ F!'QQtLR0W?,P3I'QkBl11'HBtt, Apdreyg33urton, T1na,0dom 'Sona 'Muradian 'Row Shefri Fletcherfiflhotikia Mihk,'R:6byn'2TI'aylb1i .Robin Mullens, Lisa White, Lisa Bruner, Dawn Fenton, Jennifer Rountree titions were over and preparations for the Sounds of Now had begun. And then on May 10 came the day all senior members of Highlander Choir dread, the time when they are forced to give up their much loved and much worn robe and robe a new member of High- lander. T 7' at G V Traci Johnson. f i 4i5iAct1v1t1esf'43 i 1 1 v x 4, , wif., 'Q 5 W , ff 4,,,,, 4 Lf X , ,. ' 'im' 'LI believe choir is changing every day with dif- ferent people and ideas working toward a goal. But the choir has always had quality and style. We will always be number one! Mischell DuPree Choir I have enjoyed this year with Mr. Murray and sure we all miss Mr. DeArmond, but it is a differ- ent experience. I'm glad I will be one of the High- lander members that will bein Mr. Murray's first graduating class. So far it's been great, and he is a good Christian person for us to learn from. Thalia Miller Members I feel that the choir department is fun and educational. It helps you get experience singing in front of people. The Sounds of Now is one of the greatest things about it. Scott Talley -3EQeeo'nd2.'yesif1 Scotia' mdhxbeiei Friifiit Ri1Si?57Rg, fgE1aymoii5,'G..1.152iote:1f3?. Dimbaiij Row -2: M.iShe1tonQ P. Mordecai: Bfflancsisterg RQII-Iaymong M, Siallbelf? J'Th0mPS014i D-f3QiiI2i1d?1'5 R- Plifdyiifal Phiffilwi Dsfwiiiiiiiilsi veunmavw arab. Jaeksmm. Herd-amass. G:aiga.Mfg.Mews..B- Tarbeflss .Bf 1?HeCaeQa1?f CPeftfasQ2e.S' P?2?2.Cf.Bf'1fhPf212sS Mfiff3.r2e122Ye04QaQf.ueiisez el3iicus.ff 77 'i .'s.i 7351 ' ffl ie-t A if CZTMUJSS31MQ M33U9S3i'R0Wl53f Kf3Wi1SUi'I?lDJlixfiifl-NG!!'Jigmaifiiigi - I ' P I K I iif. Skardag D. Millerg A1 Choig K. Kirkpatrick. f ' ' 7 Speak Uut X UI like McClellan's choir program. Most schools don't have big choir programs, and they don't know what they are missing. It's where the fun and talent really is. Tim Kling I 1 I I ,A 'E 3 ..ff N fx I 1 E., ii . W I uln the light of having a now director, the year has undoubtedly been an experience we will nev- er forget, In the process of the change, some of the basic traditions have been altered slightly to ac- commodate the changing opinions and desires of new choir members. Times change, and the op- K portunity this year to have a voice in planning the E year is a great benefit to the choir department. Stephan Buck 'tlt was time for a change. If we hadnlt, it wouldn't have been as much of a challenge to us - as it has been. Everyone took it for granted that we were good when DeArmond was here, now we are proving ourselves again with Mr. Murrayf, Kathy Gallagher I Boy's Chorus: Front Row: K. Stalmakerg C. Miller, R. Anglgggnng C. Stewartg L. Gordong S. Wither. Row 2: D. Hudsong B. Shoptawg J. Walkerg A. John- Sf0l'1 . All-Region Choir: Front Row: D. Frenchg S. Sansingg V. Davis: K, Stimpsong C. Davis Row 2: L. Burgessg D. Flemingg G. Crossland: K. Quinng K. Greggg T, Taylorg T. Rossg A. Minickg J. Schellg S. Talleyg Row 3g VK. Jolliffg B. Masseyg M. Burtong K. Breedingg B. Monkg S. Buckg B. Roseg M. Draperg K. Shipmang' S. Galloway. i Members of the soprano section of Highlander choir rehearse for an upcoming concert. ' V vi e-5 f if A .,,v ,. p lV i '47 , N.. Mr. Murry takes the attendence in his third period class. Members of the Girl's Chorus perform at the Fall Concert. i WA' vw 7-up 'Q 'We 'WW me 46fActivities N Practicing for an upcoming concert is Alan Co- zart. Taking attendance in Highlander choir is Denise Fleming. Bill Monk listens hard to hear the bass part on a new piece of music. Another School Holida I Choir Trips Interfere With School What was the next closest thing to a school holiday? More than likely a day when the choir was on a trip. Since choir included some 300 students, its not surprising that when they were gone their presence was missed. Choir was excused from school a total of 10 days all year, which was more than any other club on campus. Days that the choir was gone were often confused and different, and stu- dents could be heard around campus saying that its going to be one of those days. Teachers were known to rear- range test schedules in their classes which sometimes was more than half the class. But all of the inconveniences and sac- rifices were worth it when Highlander would come home with the superior rat- ings for which McClellan was tradition- ally known. Their excellence was rea- son enough to be proud. And as long as there were days when 2051 of the school was gone, there will be the same tradi- tion of excellence. Act1v1t1esf47 Sixth period is now rehearsal time for the band as junior Kevin Breeding practices a solo. Saluting the crowd is senior Brady Massey and the other band members at War Memorial Stadi- um. 2 1 S 'iq 48lEXzihd Band Officers: Front Row: B. Massey: L. Boling M. Houseg B. Simms. Row All-Region Band: Front Row: B. Masseyg B. Simmsg M. Beggsg K. 22 U4 Martin? B- POWGUS Mfr 1308553 R' Smilftl K- Ratliff- ' V ' Walthersg Row 2: ,Mr Bonneyg K. Breedingg lK. Ratliffg G. 'Phi11ipsgi,G ' Williams. C0mDetiti0I1 begins early in the year for the band as they perform at War Memorial Stadium, featuring soloist senior Grant Phillips. nder The Direction 0f iBrady Blassey Massey Pursues Musical Career Few high school student choose a ca- reer in music. They find the field to be too competitive, but, senior Brady Mas- sey chose to pursue his love of music by planning a career in music. He began at an early age with the piano lessons that all parents urge their kids to take. But for him practice wasn't a bore because he enjoyed making music. Brady was elected Drum Major both his junior and senior year and elected outstanding Drum Major at a band con- test at Joplin, Missouri. At the same camp he commanded more than 700 people at the closing ceremony. He was also director of the Lion Pride basket- ball band his junior year and was direc- tor of the Lion Pride auxiliary at band camp. He was also a student director in choir as well as in band. This meant he was able to direct the band or choir whenever the regular director wasn't there. He occasionally directed a con- cert. Wherever Brady went, the people around him could tell that he loved mu- sic. He would constantly be thumping out the rhythms to some song that only he could hear. With all the new pat- terns and trends in music, one can be sure that somewhere on the scene will be Brady Massey. Where Brady is, there will always be good music. Bandf49 2 I M gl 9 'a an Tim to perform at NAP d . an Daniel Baker. Just Fiddling Around. Giving The Orchestra Its Due. heir repertoire consisted of early Bach to present day composers. They had studied privately or in classes since the fifth or sixth grade. Even though few people even knew they existed, perseverance, determination, hard work, and an ex- cellent instructor brought rewards for the eight members of the orchestra. It is always hard work when we first get a new piece of music. But once we get it worked out and play it at a con- cert, we get a real feeling of achieve- ment, said senior Linda Twidwell. Although some members feel they are not given the support enjoyed by other school activities- I would like to see someone other than my family at concerts, said senior Bobbi Walthers- they still appreciate personal accom- plishments. It is amazing how beauti- ful we can make a few pages of cold black notes on a staff sound, said sen- ior Daniel Baker. He continued, I must admit that classical music is not the most popular form of music with many people, and sometimes it can be boring to just sit and listen to it. But to play this music and know that it's you play- ing-that's the greatest high I can think of! These members give much credit for their accomplishments and personal enjoyment of their music to Mr. Joe Vick, orchestra instructor for the last three of the five years since orchestra's formation. Mr. Vick is a great guy. I have learned more from him in the past three years than in all my other years of trainingf' said Linda Twidwell. He is a true professional. He expects a lot from us because he wants us to be the best we can be, said Bobbi Walthers. Bobbi continued to comment that Mr. Vick as well as the orchestra members were instrumental in making themselves better known. Since we have traditionally support- ed an excellent msic program, orchestra members believe that they too will soon be recognized as an integral part of this program. They will be recognized as adding to our tradition of excellence. 50!Orchestra N2 To be sure they are playing in perfect harmony senior Bobbi Walthers and junior LaTresa Jack- son pay close attention to their music. ALL-REGION ORCHESTRA: Bobbi Walthers and Tim McDonald. ORCHESTRA: Front Row: Bobbi Walthers, Kim Bowmang Row 2: Dana Oliveg Linda Twidwellg Daniel Bakerp Row Il: Mr. Joe Vickg La Tresa Jacksong Tim McDonald. Orchestra-M51 .i W' us gnu Performing for the judges at a competition is Dawn Akridge. , fini, game. L 4534 'Gif Beth Owens and Joy Shanley rehearse after school for an upcoming Working Overtime Performance Compensates For Overtime When most all of the other teach- ers and students are gone home and the janitors were beginning to make the rounds, there was a group of girls who were still at school working hard on routines and rehearsing to tape recordings of the band. They were the majorettes and the flagline. Through their hard work they ad- ded color and life to the band's per- formances at games and competi- tions. I enjoy hearing the band play. But let's face it. It's those girls with the flags and batons that make those shows great! said junior Mark More- head. Being on the flagline or being a majorette required a lot of responsi- bility and commitment from each of its members. It meant having to miss all the activities that their friends could enjoy, practcing until they could drop, and having their picture taken by the yearbook photographer when they looked their absolute worst. But compensation came for these sacrifices when they heard the Lion fans in the crowd yell at the end of their performance. 52!Choir Christine Smart and Karen Ratliff find enjoy- ment in performing for the crowd, Wa' if f? 2 iz 3 K Q 2 ' . . ,,... A , ,,.. I - 1' I fi, ,:,,,5,',, wmisf, --vu ak, ,wwf ,r zfzfzzref I Am i , ,,,5,,,, ,, ,q,,l ,,,:,,.,z ,,., .,.zL We 'M'3wz,7gsJ','f V ',,.-:wzrriwrfliifl .511 ' ,. 'V , 'f H 'V ,, '4 :-1 , 1 FLAGLINE: Back Row: Beth Owens, Vicky Wens, Sandra Tiggle, Mischell MAJQRETTES: Jennifer Raney, Christine Smart, Karin Ratcliff, Rhonda Dupree, Sheila Sisson, Lisa Kerr, Front row: Deidra Martin, Becky Slawson, Smart, Terri Johnson, Dawn Akridge, Rhonda Purdy. Carolyn Martin, Joy Shanley, Julie Matthews. Choirf53 N Waiting for the Homecoming parade to begin are members of the cheerleading squad. Front Row: Trisha Warren, Bobbie Brooks, Stephanie Baker, Missa Magness. Row 2: Kim Dennis, Sherri Fletcher, Deanna Parker, Christy Grable, Tina Odom. Back Row: Debbie Atkins, Stacy Thompson, Dana Miller, Darren McAfee, Robyn Taylor. sau? wr 's,8T LJ 'fa .foie 54fCheerleaders Sophomore Deanna Parker rallies the crowd at a football game against Parkview. Trish Warren and Mrs. Fielder look over a catalogue of uniforms to choose one for the fol- lowing year. Fair Weather Fan Cheerleaders Inforce School Spirit. Many football teams often exper- ienced the devotion of fair weather fans, but there was a group of students who attended the game rain, shine, sleet or snow to cheer the team to victo- ry or defeat. This group was the cheer- leaders. Sharp red and white uniforms, red, blue, and white pom-poms and red ten- nis shoes added a polished image to months of hard work and dedication. During the summer, the fourteen girls dragged themselves out of bed at 6:00 a.m. to begin a grueling work out. These practices preceded the cheerlead- ing camp at Ole Miss on July 17-21. There the members of the squad learned new football and basketball cheers and out did the other cheerlead- ing squads by taking 14 superior rib- bons with their technique and image. At other contests such as the one held August 20 at the Southwest City Mall and the state competition October 1 at McCain Mall, the squad won numerous awards and took first place in state competition. Distinction, perfection, and pop are the main emphasis for the group. These characteristics and the hard work that developed them made the cheerleaders the consistent fans of the football and basketball teams. But what did the in- dividual get from cheerleading? Bobbie Brooks a junior on the squad states, Cheerleading is a challenge. It helps me to take on obstacles that are not normally there. It also gives me an experience because when you are a cheerleader you meet different types of people. Most of all cheerleading is exciting. You get involved with the teamg you laugh in victory and you cry in defeat. It's an experience I won't soon forget. Dedication to cheerleading and the school they represented helped the Lion cheerleading squad to uphold the image and reputation for spirit and ex- cellence that remained a constant tradi- tion. Cheerleaders!55 Lionette drummers, juniors Jay Summerland and Mike Hubbard and senior Chris Pipkins help the drill team keep the beat during a summer practice. at the Parkview game. Members of the Lionettes have fun before the Homecoming parade. Drill team sponsor, Mrs. Belinda Mosley watches the Lion-ettes perform A Lesson In Learning Lionettes Learn Dedication And Pride Being a member of the drill team at McClellan was much more than the average person could realize. To a mem- ber of the Lionettes it was a lesson in learning. It was making new friends, becom- ing closer to old ones, learning how to work with all different kinds of people, performing to the best of your ability, and supporting your school in all activi- ties, as stated by April Verver. It was also much more than this. It was dedi- cation and getting up at 5:30 in the morning during the summer and stay- ing after school in the fall. April Verver summed up in a few words what drill team meant to her, Well, I guess it's just that special feel- ing that I get when I'm standing out on the field or court in my uniform with my parents and friends watching me and they introduce the 'Arkansas Drill Team of Distinctionf That moment is usually when I realize all the hard work is really worth it. 56fL1onettes 32 li K at ' 94 1 ' S if o 3 Lionette members perform at a competition held at South West City Mall. Front Row: Laurie Williams, DeRhonda East, Shiela Harrison, Shelly Booth, Jennifer Linkous, Toni Taylor, Diane Reagan, Missy Martin, Rhonda Kindy, Kael McAdory, Tracey Bryant. Row 2: Stacey Suitor, Missy McCall, Stephanie Killian, Bridgette Johnson, Carla Davis, Shannon Morgan, Misty Carroll, Melanie Breeding, Terri Bed, Shelley Miller. Row 3: Leigh Smith, Sha- keena Taylor, Carol Roods, Carol Eslick, Beth Lancaster, Beth Atkinson, Barbara Hart, Kim Davis, LaDonna Sefick, Betty Dilliard, April Verver. Row 4: Wendy Childers, Cindy Mote, Lorene Henderson, Kerrie Folsom, Christene Newell, Kim Barnard, Jennifer Walker, Shiela Bland, Michelle Coleman, Tammy Moody, Sandy Wade, Terri Long. Back Row: Amy Roper, Cheryl Fisher, Nichole Peel, Paige Halford, Christy Ben- nett, Wendy Mayes, Melinda Edwards, Sandy McDermont, Jeanna Crouch, Jill McMahan, Shelley Ferguson. LionetteSf57 K Working on their copy are Mark -Iackson. Debbie Darrocott, and Marilyn Shelton, I Yearbook advisor. Mrs. Morrison, checks copy that Jamie Johnson has turned in for the Ad section, Editors Tracey Summar, Trisha Frost, and Elisa Caplinger talk to the only sophomore member on the staff, Brenna Johnston. DW H W awww K, ,,,, M ,agus-1-w l 1 58fActivities But We Finally Got It Done! Please Read A Few 0f Our Experiences In Trying To Get It done. What would you do if . . . it was two days before deadline and six rolls of film turned green. . . . you had a date at 7:30 and you,re still working on the yearbook at 7:15. . . . you had written your copy fifteen times and the adviser says, Try again! all the mug shots arrived on time, but none of the names were leg- ible. you had an English paper, a chemistry test, a debate case, a choir festival and a yearbook deadline all on the same day. . . . you had mono and still had ten pages of ads to sell. . . . you forgot to tell your parents you're staying late at school and they send out an A.P.B. on you. Sometimes we weren't sure what we did, but we finally got it done. Some- times it took tears, hurt feelings, harsh words, late hours, and countless cries of, I want to quit! But we finally got it done in five deadlines beginning in Oc- tober and ending at the first of Febru- ary - five months and a few weeks to capture a year of school activities. But we finally got it done so we can start again on the twentieth volume of the award winning The Lion. Looking at old annuals for some new ideas are Shelley Henson, Shawn Melanie Chandler, Kathy Venable, and Lisa Burgess look for negatives Thompson, and Donna Davis. to print for the Activities section. Activ1t1esf59 ,MMVI Looking over the next weeks agenda are staff members Mrs. Roberts, Tracey Summar, and Ronnie Standridge. Melanie Chandler and Kim Lanier finish typ- ing up the copy for the next deadline. QL fl3,e Paper staff members, Debbie Darracott, Liota Odom, and Sean Durham, call a business to see about Mike House and Joey Brannigan look at old buying an ad in the next edition of the Lion-Up, 60fLion-Up copies of the Lion-Up to get some ideas. ...Quad Working hard on writing some copy for the next edition of the Lion-Up is Bobbie Brooks. Sean Galloway and Mike Nichols interview Reginald Dillard for the sports column. A Tradition Of Excellence Striving To Express The Voice Of The Students Is One Aspect Of The Lion-Up. Everyone thinks a newspaper is full of just facts and information, not the McClellan Lion-Up ! The newspaper has been striving to keep the voice of the students as the most important aspect in their writing. The most popular column that has been used for this purpose is Sound Off? This column presents such controver- sial questions as Are you in favor of merit pay? Another big attraction is the column gives special recognition to elected offi- cers and information about the school clubs. It also kept everyone up to date on what was happening around school. Not only did they focus on school events, they also provided us with col- umns on what was happening outside of school. Articles such as the movie re- views, the Arkansas State Fair, and edi- torials done on current issues did this. These techniques used by the paper staff were obtained at the journalism camp held at Ouachita Baptist Univer- sity, attending several journalism con- ventions, and from the experienced sen- ior members on the staff. They have a constant award winning paper every year. This style of idealistic journalism is what keeps the Lion-Up a tradition of excellence. Lion Upf61 SYSSSQE' Wm SW Q 4 Q 'img 1 .zzizii :War 322552: :sms 155355: :ggi QQ. gwgfii ff sr: Qiziiz ,yjsiir U W 6234 me S Emi? R ma D Li 53523532 zszszgz 5 'Sim Q 533522535 'ZSSH ' Q 955523 3 E 2 2 2 2 z 5 2 2 E 2 ? Z 5 v 3 1 S Q 2 9 f 1 ii 2 5 Q s Q ef sf E 2 Q 6 Senior Senators: B. Costag K. Gallagherg K. Muradiang J. Linkous. Junior Senators: K. Lanierg C. Eslickg J, Stantong S. Bland. Sophomore Senators: P. Shephardg N, Nelson Competitors anxiously await the beginning of Family Feud. Student Council Officers: Mr. Mike Anderson, sponsorg K. Quinng , , , , , S- Wiesenfelsg MS- Joyce Persunsw Sponsor: ROW 2. T. Hill: Sb Bucky Scorelfeepers tor Alniost Anything Goes are Senators Jay btanton,3un1or presidentg B. Powellg l.. Lile, vice-president. and Bruin Powell' Semin' 64fOrganizations Representatives, Senators 8z Officers Democratic System Proves Successful For Student Government. raditionally the Student Council has been one of the busiest organiza- campus. The first week of school they greeted the students with Welcome to McClellan signs, spon- sored Almost Anything Goes, and also organized the talent show, and they offered the student body a chance to have their picture made with Santa Claus. Beginning a tradition, the Student Council also held McClellanis first annual tions on Family Feud, based on the popular game show. The oth- er clubs organized teams and competed against each other. The contest went on for two weeks, and finally the choir came out victorious. The Student Council also challenged other Pulaski County Schools to collect cans of food for the needy. Members also attended the Southern Association Student Council Convention where they held the office of vice president. Awaiting the question during Family Feud are junior Laurie Williams and senior Joe Hinson. Organizationsf65 A Home And Abroad Involvement Takes Top Priority For Students hey cleaned the Stagecoach House, held Teacher Ap- preciation Week, sponsored a blood drive and filled food baskets for the needy. It was all a part of community pride and service characteristics exemplified by Key Club. Key Club was asked to clean up the Stagecoach House because it was to be renovated and sold. The money received was placed in the club's account to use for other projects. For Teacher Appreciation Week, Key Club members gave the teachers apples, presented them with certifi- cates of appreciation, and took the teachers to lunch. The traditionally success- ful Blood Drive was held in November. The Red Cross appreciates any blood that is 66!Organizations given, because it is more blood than they had before, says senior Mark Milstead. The Key Club also held stadium clean-ups in order to keep the campus clean. Each year the Key Club enlists the help of other clubs and organizations to join together to provide food for the less fortunate at Christmas. Renewing the tradition of student involvement, the Youth and Government sponsored the Le Provoca- teur. The purpose of this paper was to serve as a medium to students who felt that they have something pertinent to say about current events that we are faced with everyday. Every viewpoint was wel- come except for matters dealing with the school. Youth and Government members listen intently to a guest speaker at their annual picnic. Participating in Key Club's annual blood drive, is senior Roma Williams. Le Provacateur Staff: T. Redg B. Pyleg Mr. Ed Bullington, spon- sorg S. Lewellang C. Fisherg M. Masong R. Marsh. Youth and Government: Front Row: T. Redg M. Candlerg T. Moodyg M. Leggettg T. Warreng Row 2: S. Wadeg S. Screetong R. Marshg C. Fisherg B. Pyleg W. Childersg S. Lewellang Row 3: M. Bonneyg J. Gibsong O. Garciag K. Breedingg J. Higginsg M. Kennedyg T. Summarg Mr. Ed Bullington, sponsor. Key Club: M. Milsteadg presidentg J. Johnsong Vice-pres.g M. James, secretaryg K. Lanier, treasurerg Row 2: S. Morgang H. Minickg L. Brunerg R. Smartg M. Leggettg Row 3: T. Sangesg D. Taylorg H. Choig C. Smartg B. Hillg G. Mooreg S. Furgesong Row 4: N. Nelsong M. Edwardsg B. Carrollg C. Causeyg B. Costag L. Lileg K. Muradiang Mr. Karl Steinkraus, sponsorg Row 5: M. Mezesg T. Johnsong S. Durham' J. Haslauerg H. Woodg O. Garciag G. Hardgraveg T. Boydston 1 Organizationsf67 National Honor Society: Front Row: Mrs. B. Billingsley, sponsorg D. Vanng R. Smart, T. Millerg P. Cullinsg L. Lileg Mrs. J. Morrisong Row 2: D. Sinnettg D. Davisg H. Minickg S. Sissong S. Suitorg S. Killiang T. Warreng Row 3: G. Allen, B. Hartg C. Fisherg L. Boling T. Sangesg J. Summerling S. Tuggleg S. l-lensong D. Darracottg D. Bagleyg M. Mugu- lumag Row 4: H. Choig K. Thompsong R. Maisli, K. Quinng K. Gal- lagherg B. Costag J, McManigalg T. Frostg J. McClellang S. Ketchamg H. Chapmang R. Standridgeg Row 6: G. Lambg K. Jolliffg L. Burtong B. Ketchamg S. Bucky P. Mitchellg M. Milsteadg J. Stantong O. Garciag R. Johnson. New Beginning: Front Row: K. Kirkpatrickg B. Tarbellg M. Yountg B. Johnsong Row 2: T. Dunlgarg B. Atkinsong S. Meltong B. Pettyg Row 3: S. Fullerg W. Heatherlyg M. Redg M. Landrumg D. McGuire. FCA: Front Row: Ms. S. Ganter, sponsorg K. Muradiang T. Johnsong S. Esterg S. Fergusong Ms. M. Cothern, sponsorg Row 2: T. Bryantg S. Suitorg B. Hartg A. Ververg T. Smithg M. Marting G. Guessg R. Hay- mong Row 3: W. Childersg B. Guntersg J. McMahan, D. Lesterg G. McFaddeng J. Montgomeryg R. Youngg C. Moteg M. Colemang T. Moodyg Row 4: G. Vadeng R. Williamsg D. Hicksg K. Baldmang A. Roperg M. Edwardsg C. Shellsg A. Harrisg R. Johnsong H. Choig C. Stewartg G. Mooreg Row 5: F. McMilliang J. Smartg P. Hallfordg S. Oliveg W. Millsg G. Corleyg A. Cozart, D. Collinsg M. Ackinsg John McMilliang Jerry Trotterg Kim Craig. Organizationsf68 i VVV. . , F., pw, nw.,- fz of . ..ff .4 MW uarding against Coach Terry, is seniorMDwain Collins fwfr. 5 nr 1 Taking a break from playing at the NHS Pep Breakfast, is the McClellan High School Band. Academics And Christian Idea s These Are An Important Part Of NHS Sz FCA cademic excellence and leadership- the two characteristics the NHS members have. Sophomores and juniors must have a 3.5 grade point average to be eli- gible and seniors must have a 3.4 grade point average. NHS sponsored the Homecoming Pep Breakfast, with Dave Woodman, sportscaster for Channel 4. The National Honor Society also spon- sored an induction ceremony and the traditional awards assembly. Exemplifying Christian ideals through athletics- that's what FCA is all about. To raise money for national dues the FCA sponsored an FCA vs. Old-Timers basket- ball game. A spring fun- draiser raised money to send someone to the annual FCA Summer Conference. A New Beginning was organized for the purpose of Christian fellowship and studying the Bible. They sponsored Bible Week. Meetings were held everyday at noon for a week. A New Beginning met every Friday during NAP. Organizationsf69 The Future Is Theirs Business Clubs Prepare Students For Their Future Careers BLA Day, a trip to Bilouxi, a Christmas party, and supporting the March of Dimes kept the FBLA busy all year long. Cooperative Business Edu- cation QCOEJ and Business Office Education QBOEJ were not only active in their own organizations but spent two class periods a day studying their area of office education and participating in FBLA activities. Thirteen members and one advisor from McClel- lan's FBLA went to Bilouxi, Mississippi to the Southern Regional Leadership Confer- ence. DECA members attended their morning classes and then spent the remainder of the day working in the com- munity. Helping a COE student with the classwork is one of the FBLA sponsors, Ms. Brenda Wilson. Working on an activity at the Southern Regional Leadership Conference is senior Dianne Reagan. 70!Organizations QS? Anxiously awaiting the presentation of their guest speaker, FBLA mem- bers participate in their monthly FBLA Day. FBLA Officers: Front Row: Ms. B. Wilson, sponsor: T. Bryantg A. Greer: J. Hinsong B. Petty: Row 2: P. Wilson: L. Hampton: T. Frazierg S. Durham: L. Philips: R. Haymon. BOE: Front Row: Mrs. S. Cummings, sponsor: D. Thomas: K. Agnew: T. Ward. L. Lavender: Row 2: D. Broadway: L. Miller: B. Disese: R. Brink: P. Graham: Row 3: B. Tarbellg S. Thompson: L. Beardeng C. Huggins. DECA Officers: Top to Bottom: Ms. Beverly Pleasants, sponsor: M. Wright: T. Ismael: K. Favreg L. Jackson. COE: Front Row: C. 1-'erezg P. Whitey K. Jones: Stringfellowg 'l. Bryant: Row 2: A. Whitlowg M. Wadellg V. Collie: T. Salmon: C. Dennisg J. Wassong T. Turner: K. Cearlyg R. Boyceg R. Kelly: Row 3: K. Baileyg M. Jacks: S. Beardeng C. Bilsg S. White: S. Longboatg K. Morgan: D. Fleming: M. Hatcher: Mrs. M. Beckworth, sponsor: Row 4: L. Hampton: L. Redman: C. Shells: T. Boystong W. Martin: S. Elrodg D. Johnson: T. Taylor. Organizationsf71 Q I 4,4 Art Club: Front Row: Mr. W. McClanahan, sponsorg J. Johnsong S. Fullerg K. Jonesg C. Dixong K. Stevensg Mr. T. Sorrows, sponsor. French Club: Front Row: D. Eastg L. Mullisg Row 2: M. Ketchamg B. Wellsg S. Lewellang Row 3: Ms. K. Hampton, sponsorg J. Gibsong S. Ketchamg Row 4: W. Heatherlyg P. Shephard. x ., as K . . 5 . S E E K i . Q 4 : : e s - Los Amigos: Front Row: V. Moshig C. Perezg A. Verver. K. Hallumg Row 2: S. Meltong D. Marting D. Alvarezg D. Barryg L. Odomg T. Dysong Row 3: Mrs. L. Barry, sponsorg N. Nelsong C. Smartg J. San- chezg K. Smithg B. Hill. Practicing for tournaments, is McClellan's first traveling troupe Speech and Drama Club: Front Row: Mr. G. Morrison, sponsorg K. Jolliffg S. Summerg M. Milsteadg Mrs. B. Billingsley, sponsorg Row 2: S. Fletcherg H. Bennettg S. Wardg W. Tolerg T. Minky D. Eastg D. Darracottg A. Pattong K. Odomg T. Odomg S. O'Fallong B. Slawsong P. Hilliardg C. Maddoxg K. Ma'cAdoryg Row 3: J. McMahang D. Williamsg K. Baldwing T. Hugginsg S. Hensong R. Standridgeg D. Chartrandg D. Weatherlyg W.D. l-lallg C. Grableg A. Minickg L. Boling R. Minkg S. Rutherfordg Row 4g S. Mullinsg J. Hicksg R. Marshg C. Fisherg S. Durhamg R. Dunlapg C. Albrittong D. Van NUYZ J. Gibsong S. Crumpg M. Jacksong K. Gallagherg J. Brannong T. Hinsong J. Clantong K. Taylorg Row 5: M. Redg P. lsabellg K. Greggg M. Bonneyg W. l-leatherlyg P. Toletg J. Haslauerg P. Mitchellg B. Kethchamg J. Higginsg P. Mordecaig S. Ketchamg S. Mayg L. Twidwellg M. Cushingg D. Mauldin. 72fOrganizations The Finer Things In Life Students Enjoy The Finer Things In Life Through Foreign Languages, Art, And Speech And Drama. C 6 irst place sweep- stakes trophy goes to Mc- Clellan High Schoolf' As these words rang throughout the Hall High auditorium, the Speech and Drama Club knew they were making a co- meback. lt had been at least four years since a Speech and Drama Club had heard these words. With nine superior, eight excellent certificates, and a first place trophy from Hall High, McClellan enthu- siastically went to the annu- al Central High Speech Fes- tival and once again won sweepstakes. As membership more than doubled and a new co-spon- sor, Mr. Greg Morrison, joined forces with co-spon- sor, Mrs. Beverly Billimgs- ley, there was no stopping the Speech and Drama Club. Junior Ronnie Standridge said, Last year I went to the first few meetings, but the interest generated was not enough to hold my interest. This year I'm enthralled, and I'm ready to go!', The Art Club has stayed busy this year selling Christ- mas paper and ornaments. They are planning to attend Arkansas Young Artist Asso- ciation, this spring, to com- pete in different art categor- ies. The French Clubis main focus is the study of French culture. The highlight of this study was a trip to Jacques and Suzanne's. They also sponsored a computer dating service as a money raising project. Los Amigos, which means, the friends in Spanish, was organized to promote the un- derstanding and apprecia- tion of all languages and cul- tures with emphasis, of course, on the Spanish speaking world. The year was highlight by a Christmas party where they went Christmas caroling in Span- ish. February fourth, they at- tended the Foreign Language Festival at Sylvan Hills High School. The main competi- tion for Los Amigos will be the annual foreign language festivals at UALR and Fay- etteville, when they will test their fluency of the language. Organizationsf73 Stereotyped? Typical Housewife Stereotype Changes With The Times. hen someone mentions a home- maker you tend to think of a woman who stays home, cleans house, and takes care of children. This is not always true. Occupational Home Eco- nomics is a Cooperative Work!Study program where students learn while on the job training. These jobs are in the five major areas of Home Economics. OHE stu- dents are members of the HERO iHome Economics Related Occupationsl Orga- nization. HERO students have volunteered to work with Special Olympics, vis- ited in nursing homes talking 74!Organizations to patients, and donated food for the needy. FHAXHERO together entered a car in the Homecoming parade. HERO has attended Federation, District, and State meetings in Blevins, Ferindale, North Little Rock and Little Rock. To show appreciation to their employers they will honor them with an Employ- er-Employee Appreciation Banquet at Murray's Dinner Theatre. The students have worked hard selling dough- nuts and hot choclate in the mornings also stationary products and sausage and cheese to pay for the banquet and other activities. . .X if Hp X r, QPLJQJUCJ li- HERO: Front Row D. George: C. Dickinson: S. Webb: D. Mozisek: Row 2: S. Todd: D. Atkins: J. Wise: S. Darnell: A. lsom: M. Zimmerebner: B. Howell: Row 3: T. Willet: T. Norman: K. Bohn: B. Rhodes: R. Standridge: P. Bruce: K. Swaims: P. Cochran: Row 4: M. Keith: K. Walthers: S. Cleveland: K. Sparks: Mrs. Carolyn Friedl, sponsor: T. Ewing: L. Johnson: M. Kelley. FHA: Front Row: T. Hill: S. Ester: A. King: M. Muguluma: A. Hill: Row 2: R. Haymon: V. Mvoshi: S. Todd: D. Atkins: J. Wise: P. Cochran: A. lsom: M. Zimmerebner: B. Howell: Row 3: T. Willet, T. Norman: K. Bohn: B. Rhodes: R. Standridge: P. Bruce: K. Swaims: S. Darnell: D. Lester: S. Hamburg: G. Allen: Row Bailey.: C. Dickinson: C. Stringer: J. Robbins: R. Rayham: J. Looper: A. Greer: C. Bennett: D. Williams: R. Johnson: Mrs. Jane Stout, sponsor: Row 5: Mark Akins: M. Keith: K. Walthers: D. George, S. Cleveland: J. Winfrey: K. Sparks: Mrs. Carolyn Freidl, sponsor: T. Ewing: D. Mozisek: L. John- son: P. Isabell: M. Kelly: T. Wheeler: S. sponsor. Discussing plans for a future FHA activity are seniors Katrina Sparks, Anita King, Sherri Cleveland and junior Tena Hill. Getting ready to start their next Home Economics project are seniors George Binham, Dwain Collins and junior Ezell Breedlove. HERO Officersa y: D. George: C. Dickinson: S. Pilkington: S. Webb: Mozisek. Organ1zat1onsf75 Environmental Awareness Club: Front Row: K. Stackhouse: T. Sparrow: L. Williams: Row 2: K. Wilson: L. Sefcick: C. Martin: R. Schrader: Row 3: J. Robbins: D. Gentles: J. Wolfe: K. Hayes: Row 4: Mr. Kelly Guerin, sponsor: D. Mozisek: J. Higgins: M. Ingram. Machine Shop: Front Row: R. Besancon: A. Nesbitt: R. Castillo: J. Williams: B. Nash: J. Cole: T. Wright: D. Pruden: S. Spear: H. Ca- I'Il6l'01'l. mf ' 1 l'r m v ' 5 :..f I, 3255 . J N A.. Z ,G rlrl M W 1,. . M ...K A ff: . , 'f' 1, 'fffif 'L .. uiifiiilix V at . sae? l . -325,5 , . :f. 5W ' W . 1:2 W A Qt w 7 if if f54fM'QZf471iX,1ff7'?W55 :Q ff 43, 4 A f fs QA 5? f if H9 . way: 4 1 - f- ' mf f v - iq . ... .' Ly il W . 41' V 4' ,W B 4 ., I9 M . . .. no 1 ,J . f 2 Q t A s 1 A Z .. VICA Drafting: Front Row: J. Johnson: M. Blue: D. Summar: A. Nordman: Row 2: drum: C. Croney. D. Wilkerson: B. Hartwick: P. J. McClure: S. Lan- tffm 1 W nm, J 2 if' seaffrev his arts project ICT: Front Row: nf K. Phillips: J. Herndon: M. Crockett: J. Livingston: Row 2: D. Powell: W. King: T. Smith: R. Nash: and B. James. Graphic Arts and Printing: Front Row: Mr. M. Williams, sponsor N. Wright: R. Williams: B. Alwelt: C. Evans: T. Currenton: L. How- ard: Mr. T. Presley, sponsor: Row 2: G. Brown: S. Walton: R. Phelan B. Duff: J. Cambell: P, Parker: B. Mathis: M. Akridge. 76fOrganizations 5995 Overseeing the printing of the school newspaper are seniors Billy Mathis and Brian Alewelt. Putting the final touches on a floorplan is junior Wesley Garret. Practical Experience Club VICA And Environmental Awareness Give Students A First Hand Look n order to collect stream samples and observe the wildlife, the Environ- mental Awareness Club planned trips to Petit Jean Mountain and Blanchard Springs. The Environmental Awareness Club was formed to promote an awareness and total understanding of the environment. Its emphasis is on conservation rather than preservation. Each year the Environmental Awareness Club participates in the an- nual Key Club food drive, and holds a Christmas buf- fet. The Environmental Awareness Club taught the student body awareness of problems like acid rain, dis- ease and the world food crisis and presented possible solu- tions. Mr. Kelly Guerin, one of the sponsors, said, You never know, one of these kids may be the one to solve these problems, Another one of the practi- cal experience organizations are the VICA clubs. Voca- tional education plays an im- portant role in a well round- ed education. VICA clubs provide vocational students an opportunity to belong to an organization which is ac- tive in both the school and job related activities. McClellan's VICA includesg ICT, Machine Shop, Graphic Arts and Drafting. VICA promoted drafting competi- tions, drew floor plans for of- fice buildings and houses and printed student handbooks. Organizationsf77 Special Club For Special People Fundraisers Help To Further Educate McClellan fterthoughts is a re- source club open to all students inter- ested in the re- source program. The mem- bers are above average intel- ligence who are physically handicapped. After thoughts was organized to help its members to get more in- volved in school. The After- thoughts also sponsored fund raisers in order to buy a 78!Organizations Students special type of tape recorder. They also held the annual end of the year banquet to honor the teachers and also had an entry in the Home- coming parade. The Octagon Club is spon- sored by the McClellan Opti- mist Club. The Octagon joins with the Optimist Club in a Halloween haunted house and the traditional Christ- mas tree sales. lvl! ... ' W..-:N 5 ----- V --U V- - ---- . ---- cr- ,-- - -- - .- brickg C. Stottsg Row 2: K. Walthersg T. Bowmang L. Nearng J. Con- nersg Row 3: J. Ellisg K. Smithg B. Nelsong J. Simmonsg Row 4: D. Powellg D. Hicksg M. Ingramg J. Winfreyg D. Hudsong D. Coilg M. Lewis. Ei f . iss Octagon members anxiously await the start of the monthly Octagon meeting. Dressed as clowns, After thoughts members participate in the annual Homecoming parade. Octagon Club: Row 1: Sheila O'F'allong J. Perezg C. Jeffreyg T. Floydg T. Browng T. Westbrookg A. Waddellg Row 2: T. Betheag J. Connersg L. Nearng B. Caryg B. Nelsong Ms. Judy Conners, sponsorg K. Luceg Row 3: K. Smithg M. Lewisg B. Jenkinsg J. Simmonsg M. Ingram. - Organizationsf79 QWSSEZSZVKSZSRQX' f Q Wmf3S5?f:v::,: mwswezsiffsxfsiiz: fe zsaeszzizmfim 2? 4 www svizeswwgm Mzzmgwaszszaag N,,x.A-wsfmgggfmgwuggs ..1,W,g.g,m3.k,g5mNQ,,Q,8,i,mMA N gggggfgggggggg www v.ggw,,qwggg5 f1MWW,M,W55w W mW,m,,W,,wq W Sgwg Q ,, Sfizmgyfwmfa X 'Y ffegggfiizfz Z?fE:::::ffF1f4v mf,-mES?2 X wiiiigzifgvzgfjiff WWH5'fmw5H Ui?i23Qm55gwf55H 'fzfwfmggsssfifiiiik New wgmxwwf Hzgqffzfuffgffgqfw2g:a'yg?f?ySE522i?sg::Szvfsfffl:f?fi?5y??gg ' tiiimfgzvfsfg 4 ggffggs gfffmzig' ,iiijii ' xfiligjdgggfsil mwiwfgg gggg3zsg.g35gv...gff ,W:,,,?5.?Zw:3g3, gggylrq iz 533.54 -. ,,,,,.:?g2Z:2fiz:L5g-5 ,,,'f,:j5,z5 'fggiqmf 1' fg K Wig: ' Wzwqgrw 'UQZQYQQQ A mmlahiqkw' Wham. .1 MLN: ' 3 ', L iiifigz il A M Q ., M mms- .Mm MQNW D.vMw-- H N A Q J , X 3 ,mg f fi 3 M 42 ,ggwg Imaam ,wp Q P: ,, X :sm mi. awww. mm , Q 255310. ,H f X Xa,m,rf vfmfsw-W Uzmig Wwmggfgyw 'WVZQW 1 wp H ,s WM, so . , ,V ,mm . 'hmmm . Lfwww w N Um, N , ,, A .M . ,, , , -- ,w N , .MW wgiixmm L.w.,,,wxp,-mxmwn , W--N Wwhwmwk f''-'HwwwwmsswbfwwwfmmsztkYmfmvwmm., , M1mMm,mw4WM , kg , Mwvvwwwawfwmm 'mm mwQwW,.,v,, ,k,yH:gg,,, ,,w,,,,,, gg Q ww, , Q fgmw' 51 ,,,,, NW g Mw.MW,m,2,m ,gggggwmNgggwmmf g,:ggvwmM,,,Z.,,..., imml-.,wWfgwm WWW gwzm-Www U m,..,5ggg5eGmammewmww mmm W W mwm.:Q..,....,.n1, W .mm,,..,. ,U mm wgasm mm wiigwggiiiiiii 55ggggge5gwwM,m54,, Mm.,,mmmwifsmmbzwwwmniiiiwxvvwwHQWWEM:zs1:.5wwff.-ZWWfmm2555355wmmwszifzi:f:2fE??:e1f?5s:ewm'amiLf-if-iiiwmmmmww Hs3.M5u.wMfm ...i m:ag,:mwQQmw . . , , MM X sw ., . Vi.: wwgiwefh mssszszww H2Ti?ff?5?SSeiiZ:1: X 5:2361 '5 if 5 4 '25 771 5535335555335 M' wwe. IZSTZX A5 3 v 525 9 Hmmm H N553 9 5125 v W1 W' QE. W aw D 5555 wfyogiiw img 4535355 Siiwggvifggw M H 1225552 ipfixisiiggigwi 3333 Mum' ?fsgmz5f.:::iz1 z Uzztiel :Q 347 f J iff zzfzszzzw, mg, , my i353SZZS3?3Z3EhZ2:Lf:,. Wggye WXSZSZESSEQESCZZQSZU gmgig ssfmgggimyilm ,, - 252355333 155553538322 5 B v xg B is 'V f if 235: .Q In mm mszzggsxseggsz ww .NS zazfiscsfirisaiif M ffsisissffzii aff f5s,L,,,gi,,, ZSTBSQEWSZSZT 2 siiifzhizfggi g5?E?5S3Z:i2?i5f Q: D ,W :ieisgigggggggggf Wiassgsgzsssz , Siimziag mizziwiiizza sgfzzzzblf zssfsifsggggggzz 'EZBSEE 135533 W iiyiiiiaiizirigiasffzas 13325553 gggggggssxagzeigs:ae:.::E::sf::HEgg 1 25555355Egigggggfszifszssaffsgzzgi 3gggg5g5k,,,,pQ,,,,,y5, Q f. E2 :.:.a: ,... : A f ze 5 ,,, 5? ' gf eggs E W , Q-Z5 gig f? g:g ,5E-5f'EEf,:f- if 3 3 2 K 'zz:s:,f,,222g5zz1z2' 51, , 5 f ,.,. Q 22 ,QS 9 z sf gim f1'i5RtfgE5 3'iZE ggfgg ggSg32:zz:S::1:5::aEE?E Eggazsgggzxsezse-:si rg sa ef -1 Qgemsfafss :E gsm: :Sb 5? . .. mmmsgrs.. .H .-..,..,., ,.... : .... Q E 452, ,... v .. ap. M, ,M W E X images-,W izsiizsszfsxfiz :i:.z:::fsm:::m Wwmw A.,. zzlissiaeskfsgs' ' - QT? F - SEEN Qiwggimstizfgfzw sinfzzzs nzmu ifiigf 'iam' X55 ,vs fi 222 '55 Ql'5?1Q'3iZnL if 22 E LZ , Las: 'Z gggmimwm Mgggefggg x:w:::es::::m:::,, zwzisszmsaezzz,-w1m2IQ22r2W giigswigazsgsazsggzsizsegiig gigiggggzqzazzzegsw ggi igpiiz 2222322255 ,W Esiizgggxszzzazzsvfw W 5525535 Egggggggxilggiigiilf mwsswfzii 45353915 523255 riggsszgzzifziziiiiiig ggg giigsiiiiiiiiiiiiii m ziiizgiiiigggfiigggs gee:sage-5g:a:a:::5:-as-1 gggffsf:m E,,g.? J.. .:...:.a :a .,:::..:. w,.g 352335 55529335 A swszsxmisszazzzsazsaigmgi dew, ,,.,.M M, X wMbm3 1KwwpiVSuZEiimwfxlf Swimiasxssczzsazrzwzzigs-iff? 3552255355552 gm Ng vga ww Q. shaman ESZESEIQS gf 2 Z5 95,552 gr , JL. S? Q, W giisgggswfzww as xiii Qs 2335253 bgfgsm Hggisiiiiiifiiiiilmw ? NW ozvxmmw. wil F5595 2 Q 3 5 sesiiiiigiiiiiwfffss maxi: fsifsiissssfsxissziiw ifafligiimisfisss sz: 3555575 . kiqiiwlwwnwwz 7 -V UNH 3522252253552 :QSESEEW W , v,Uq www 'ii'-'Hifi xziszssiiiiszzs E2? Ziif'3i Q' 525233329 gage gage? P533 K ?Si2i:sssi:z,:::,::z:?Q1iSES Wag: WZSSVSESS me 22225553532 ,figs-.pm Zfxfmfa D 1 2231555521 6 5222552314 5.325553 zffzssziiiswm, , 22 Z? S5552 2 Zm5MW,g,.,- ?miMymg,,,5.,, S25 52325222 wg' ayywawaxma ?Q2i3?25i2??2ii? ik waimm-fszuwv U X U :::::i2::::a?E::Q: .Q 11.325 M.,U.J-1 Y mi: uafsmzzm zxgwszimszsss5??Efgi?Ei2i2, M i7ZZ1Z'Sg .gg 5 11322233 ff 5, ww, M -f 4 1 Q ,y f I diy f W 1 ,al ,gf ,, P .1- 45 9 V ,, 47 A mi? .fggmw QM 2 , aa: .zwgssszszrsrzm 4 swim, zziiaiimiliiiiza, ,Ls SQEZZQW wzzzzzzsezzmssazg 'xlfiimf ' MESS? EEESE ' F Concentratmg on h1s artwork ID Mr. im: i A .V . . mr ,W McCl.1naha13s, art class IS semor Edche Horn. QS. M-du ,, ,Q A 4 .fy i ,gfgrzzzfzfsfemg -, Q 1 m, ffiwiii A v gg, W Nzzzmizz Hziiwzzvibf 8 4 X Q, X ,NW .QU. 3 K -, mfgmwze 9 'Wm M, was .ins 2 vi by Z5 , X 25225 22:55 aff 552551 5:5552 2222: 2522 :Eg ..... ME 52 5 2 X 55, 'z E Q HES? iga E5 u Mi 55: W sg, 3 1 E?:I :Q A gi? RES? msg, X, img 2 SES SEE? E2 5 2 fEl.i':i':f2 gk :wg 5535 135122 3552 55:25 335215 1 fzzsi' 553:52 .v wwf zz z: 8 51, 3 5 w if' 555523 wiki? Qggzqk 555322 15 Q 5 2 5 V2 5 sg 5 5: 2 SE 2 29 23 Q z E TQ fs 2 Q 4 2 gi ET 5 9 F5 2 5 2 A 5 :Z 5 ei if 5 if .1 Q 3 94 3 4: 2 5 5 T2 z af 5 Si Z 5 3 ,Q 5 5 vi xx ,I sf -2 ,, 1: 3 ii 82fArt Communicating With Art Students Express Through Art What They Cannot Express In Words India ink, clay, and a potteris wheel are all tools of the artist, tools that communicate emotions, the imagination, and sometimes a state- ment about life. Art has changed from carving pictures in cave walls for com- municational purposes to drawing pic- tures on canvas to express feelings that can not be expressed with words. Students had the opportunity to communicate through art in five differ- ent levels. Art I, a prerequisite for any of the advanced courses, emphasized the basics of drawing through the me- dia of crayons, pencils, paint, markers, and pens with India ink. Students learned how to use the color wheel and laint, canvas, brushes, pencil, 7 the measures of darks, mediums, lights, shades, and textures. Intermediate courses dealt with drawing and painting ads out of news- papers, magazines, and telephone books. Some commercial art students had to create, design, and paint a book cover. Intermediate courses were of- fered for those who wanted to expand their talent in art while advanced courses were offered to refine artistic talents. Art is the creativity of someone's thoughts or ideas expressed by drawing and writingf, replied Heidi Minick, senior art student. Survey results showed that the majority of art stu- dents preferred to work with the color blue. It is a bright color and can be mixed to form many different values, shades, and colors, said senior art stu- dent, Kim Jones. Students also commented on what they felt was the meaning of art. Art is your feelings or thoughts shown through painting, drawing, and sculp- ture, sophomore art student, Natalie Benson said. Art students' opinions were mixed on whether or not students should be required to take an art class. Some of the students felt that not all students can appreciate the arts and would not try as hard, while the other half felt that it would benefit them later in life. i X, --...N-Ne.. vii inn........ With intense concentration, senior Kim Jones Preparing a Pfipiefg 11180116 lion which Will uses acrylic paints to Create 3 Still life- later be painted is senior Joseph Winfrey. Instructions and suggestions from Mr. Trav- is Sorrows are necessary for senior Lee Ann Red to successfully complete a pen and ink drawing. T-he lrook cover, designed by Ky Stevens, ju- nior, is completed with the addition of a title drawn with pen and ink. ,,i .f,,'r Il ,WW WW iw fa , 71.vMm w ff SW iixigif Artf83 Although calculators can not normally be used, Grant Phillips, senior, takes advantage of being able to use them in AP Calculus. Tackling derivitives takes seniors Bill Ket- cham and Marla Beggsi full attention in AP Cal- culus. ,V , A 1 f' 2,4 ,QVVV it ,,L ' , Communicating With umbers Quadratic Formulas + Derivatives + Binomials I Confusion nometric identity and a qua- hat is a conjugate surd, trigo- 84fMath dratic formula? ls it a new for- eign language? It is to most students. Students began to realize that the merit standards for the college scholar- ship tests have been set so high that it will benefit them to continue with the advanced math courses. Algebra ll is a lot of hard work. It will help me to get a higher score on the PSAT, ACT, SAT, and other tests for college scholar- ships, said junior, Tena Hill. Many students have also tackled the wide variety of math courses even though they have already met the graduation requirements. Some took math because it was easy and fun, while others took it to further their knowl- edge for their future career. Students wanting to pursue a career in law would need to take three years of math in high school including two years of algebra and one year of geometry. For a job in philosophy, students would need to take two years of math in high school. Today's technological developments of society involve more mathematics in nearly all jobs. Some students were interested in tak- ing AP math courses, such as calculus, so that if they make a high score on the college credit test they will not have to take as many math hours in college. Calculus will give me college credit ifl pass the test and I can save money on college hours, said senior, Trisha Frost. WJ? ww? The quadratic formula, a puzzling concept, brings a scowl to senior, Brian Powell's face. After receiving their daily assignment, AP Cal- culus students attempt to finish their homework before the bell. imwwww Math! 85 Communicating With Codes Are Computers Taking Over The Business World? raditional codes for communi- cating in business have been through the means of typing, using a pencil for shorthand, and keep- ing record books. However, students have begun to understand that comput- ers are taking the place of yesterdayis shorthand by hand to shorthand by computer. Business courses, such as COE SL BOE, used computers for word process- ing. Computers were also used in the accounting classes to teach the comput- erized data processing concepts as ap- sr plied to accounting. An electronic cal- culator, a ten-key adding machine, a spirit and stencil duplicator, and a mi- cro computer were just a few of the many different machines and comput- ers used in business machines. JET students learned that entrepre- neurship is people that take a risk to go into business and learned how to simu- late business offices. BOE students learned how to run a business in the class while COE stu- dents went out half a day to work in the business world. 'Q SSXBUSIDGSS ,.,pilP ' Business courses make up part of the day for senior Joyce Wasson. A big part of shorthand is writing letters as demonstrated by seniors William Fellows and Michelle Burton. i Students were offered a wide variety of business courses which were designed to provide meaningful and relevant skills for students who were interested in a business career. These business courses were also emphasizing the new technology of the computer and elec- tronic world. I believe that computers will make all of these skills easier and more accurate. These new skills will save time and moneyf' said senior Yvonne Rushing. 2, S vm - S 'li sp 2 ' Using the many signs and symbols of short- hand are Barbara Tarbell,junior and Shelley Fer- guson, senior. . . . L' A in . 'f Typing II requires much concentration as shown by sophomores Teresa Bock and Alana Carey. D W' , ' 3 1 6 , 2 J 5 Z gf, ' will ,iff ' ' M 5 f . 2 al , V, 4 71 5 1 7 'M' ' 'P ' ,HH V ezzfsaz ws.: ...a.f.. L. 1- 112 HV -f -l mm Businessf87 Communicating With Society How Much Do You Really Know About Your Society? 0 you think you could pass this test about your society and current events? 1. Who is Ronald Reagan? 2. Where is the capital of the United States located? 3. Name six candidates running for President in 1984. 4. Who was James Watt? 5. Who shot down the Korean air- plane 007? 6. What senator was killed on the Ko- rean jet? 88!Social Studies 7. Where is Grenada? 8. What happened in Lebanon? 9. Who was Jessica Savage? 10. What is the definition of intelli- gence? If you could not answer five or more of these test questions, maybe you should consider taking one of the many classes offered about your society and current events. Even though American history is a required subject, most stu- dents neglected to take an advantage of the many courses that offer them a bet- Sociology homework takes much of sopho- more Rebecca Stebbin's time. ter understanding of their society and current events. The social studies curriculum offered such diverse courses as sociology, inter- national relations, psychology, world history, American government, and American history. With Arkansas, determination to up- grade the educational system, students may be required to take more social studies in the future. Q51 A leaky roof proves to be comical in Mr. Guer- in's psychology class. Turning to the appropriate pages in their American History book is Mrs. Jenkins' fourth period class. Reading novels such as The Prince by Ma- chiavelli is a part of the International Relations class for seniors Chris Pemperton and Jeana Crouch. X 3 V , Hg, ir Exif 'TS . 3961 Social Stud1esf89 Giving orders to Cinderfella, senior Mark Jack- son, is Wilbur, sophomore Joe Griffin. Giving the daily good-bye kiss to Tammy Preppy Dwarf Brown is Snow White, played by senior Angie Patton. f - 4 2 522 'L we :wav five nw , 9 l , 5: www 90fSpeech And Drama Awaking to seven new dwarves is Snow White. Communicating Through Competition Competition Between Students Can Result In First Place Trophies students and teachers this year was continuing to build up the speech, debate, and drama pro- grams. The fact that the enrollment doubled this year proved that students were taking advantage of the different ne of the challenges facing programs offered. Competing was an important part of these programs. Go- ing to tournaments and competing against other school teams provided an incentive that was needed to build these programs: Competition between students on the local level can only al- low these students to better themselves so that they can successfully compete at tournaments. Once students reach this greater level of competition, they be- come dissatisfied with anything less than first place, said Mr. Greg Morri- son, speech and drama. Proposing in a traditional manner is Dr. Kil- dare, alias senior Carl Albritt n to Snow White, portrayed by senior ngie atton. Slow dancing to Play Another Slow Dance are seniors Sherri Ward and Mark Jackson. Speech And Dramaf91 Proper beating and mixing are essential skills practiced by seniors Sherri Cleveland and Catrif I cia Sparks, as George Bynum observes their tech- niques. 1 l Tasting is not required but sometimes a nec- essary part of being a successful cookg at least senior Patrick Hill thinks so. W. r 9 'V ,, W Z 9 -4. ' A f A 1 r iir if , . ' 'l i Vl' X an Observing one of the many machines in the Vo Tech building are senior Bobby Jenkins and ju nior Brent Coffee. 92fPratical Experience Communicating With The Students Practical Prepare For The Future raditional accademic curricu- lums have been expanded through the years to include practical courses for students who do not plan to go to college or who desire to take courses that will enhance their personal lives. Any typical day in the H wing may be anything but ordinary. The corridors may be filled with the smell of pizza, the whirl of sewing machines, or the strands of Here Comes the Bride. 'f z,. Students not only participated in these traditional activities but also were in- troduced to the importance of consum- er education and the benefits of good nutrition. Vocational and industrial courses of- fered mechanical and architectual drawing. We designed houses with wa- ter and electrical systems, said Daryl Mozisek. Building trades had the realis- tic experience of building a house with students from J. A. Fair. Our printing department offered students the exper- ience of actually running a business as they printed on school newspaper and material for many local businesses. ln- dustrial Cooperative Training allowed students to work and earn credits at the same time. Distributive Education offered stu- dents practical work experience and knowledge of business operations. Copy is correctly positioned on a camera copy board by seniors Richie Phelan and Page Parker in preparation for an exposure. Placing film on the horizontal camera vacuum back prior to making the exposure is senior Tom- my Bethea. 74' JN Communicating With The Elements Students Become Involved With Everything From Bugs To Boron. 3 hat classes do you associate g with the science depart- ++ ' ment? If you only remember your biology class and the activities of suffering from poison ivy while trudg- ing through the woods looking for flow- ers and under the rocks for bugs, you are depriving yourself of the many dif- ferent courses offered. Chemistry was offered as an ad- vanced placement course for those wanting to take the test to earn college credit. Both chemistry and physics were a lecture type class like a college course. Labs were used in the physics class to test formulas and test how much students learned in the lectures. Testing chemical reactions and reliabi- lities of elements were just a few of the chemistry labs. 94fSc1ence Biology and zoology were courses de- signed to classify the many different types of animals and learn their com- plex organs by a means of disecting and by studying microscopic organisms. I want to become a veterinarian so disect- ing animals for observation and learn- ing their different parts will benefit me for my future as a vet, said Junior Chad Martin. 2 M Preparing for an upcoming lab is sophomore Marcia Meyers. Students, such as sophomore Rodney Allan, receive a general study of biology in a life science COUFSC. Hurrying to finish a lab assignment before the bell rings are juniors Chris Minick and Donna Whitenberg. Many times assignments in zoology require defining many different terms as juniors Chad Martin and Tim Kling have discovered. an W PKL J! A 1 AJ' We f si .4 .Mmm Testing equilibrium points in one of the many physics labs are seniors William Fellows and Mandara Savage. Sciencef95 e Preparing for an upcoming speech is senior Scott Talley. Translating from English to Spanish occupies sophomore Renauldo Garcia. r f s 1 : ' -1 L. gs ,. f 96!Languages Intepreting poetry is just a small part of Niesje Nelson's tenth grade English grade. lions is junior April Verver. vonne Berry. Communicating With Words It All Began With Words Word QEng.l, Mot QFLD, Palabra fSp.J Listening attentively to the teachers instruc- Lecturing to her classes is one of the many duties of Spanish and English teacher Mrs. La- 4 1 4 4 It may be only Words but classes and ended as late as 3 30 p m colleges Therefore students have begun ords - it all begins with words. ed as early as 7:30 a.m. in earlybird eign language to be able to enter certain most students find it IS not Although foreign languages are not to realize the importance of being b1l1n- that easy to understand whether it is required and most students shun them, gual. their own language or foreign. It devel- colleges are beginning to require stu- ops into more than just words. It start- d9I'1tS to take at 1821S'E Ofle year Of 21 fOr- Languagesf97 fr -'S+ E 2 I ' :,V -,,. W mm 'S .:.1: 1 H3 U- Wg M M ET Q :' f 4-vw V - -HW .,....... H Wm ' WW N - Ka fav I WWW ' ' Mmw N. ' ,,.... Biggs? fx? s 5 A s A z' ' WNNMWW 5 M W --N' W LmEwEs2 wfg Q3g,3, MSM MW imvmm Karate Not Just A Form Of Self Defense arate is a Japanese system of self-de- fense without a weapon. When most people hear the word karate, they think of self-defense. This is not the case with senior David Short. David, who is a black belt in karate, said, Unlike most people I got into kara- te for the exercise and not as much for self-defense. David also practices Mar- tial Arts, which is the art of using weapons suited for war or a warrior. 4'I've nev- er in six years had to use karate, stated David. Aerobicise! Aerobics Leads In New Forms Of Keeping Fit. One-two-three-four, Kick to the left, Kick to the right. The fitness craze that swept the United States in the eighties brought with it a need to have a nauti- bodyf' This exercise craze brought runners, joggers, bicyclers, and weight lefters to the streets and gyms of America. One of the newer and more popular forms of exercise was aerobics. Aerobics not only helped the exerciser lose weight, but also helped keep them in shape. The exercises stimulate the heart and in- crease the oxygen flow. Aerobics proved to be a very inexpensive form of exercising with the many shows on television and ca- ble networks. Senior Regina Moore commented that aerobics was less time consumming and replaced sport activi- ties. 5 E A high jump is only one of senior, David Short's many karate techniques. A karate studio provides a place for senior David Short to practice one of his favorite sports. , is sr is SP X iii ir... A an 1: 1 , Aiming Mitchell if t, 5 f for the target is junior Pat . gk Hunting From Necessity To Weekend Entertainment he gun is cocked, load- ed and ready to shoot. The hunter tracked his target through silent grass lands and overflowing brooks. It was growing darkg he was beginning to become hungry. As his prey stopped, he raised his rifle to his shoulder and took aim, pre- paring to bring home a good meal for his family. Times have changed and so has hunting. In the days of the American pioneer and the American Indian, hunt- ing was a necessity not a sport. Male members of a family set out early every morning in hopes of shooting a deer, rabiits, or squirrels to ' Lai , M 'W 1 feed to their families. However. today for most, hunting is a sport, some- thing which is merely for entertainment. But, if a deer or other animal is killed most will later eat it. A hunter who is not so fortunate will not, howev- er, starve to death, as did the early Americans. A quick trip to the grocery store or McDonalds will soon satisfy hunger and feed the family. Weapons have also changed. The guns and bows and arrows used by todays hunters are much more complex than those used by early Americans. Hunters were able to shoot at their prey several times without reloading their rifles, unlike the sin- gle shelled Musselloaders of the past. Bows and ar- rows have also advanced. They have gone from a mere curved piece of wood and string and wooden ar- rows, to intricate weapons with an incredible amount of power. Along with the changes in weapons, there has also been a change in hunting restrictions. Hunters are now required to have a hunting license, unlike the pioneers. Hunting has changed drastically over the years. With these changes, many high school students have renewed a growing inter- est in the sport of hunting. Q in an Play Ball. If Your Team Never Wins lt's Still The Social Event 0f The Summer f your team is good, itls a sport, but even if your team never wins a game, it is still a major social event of the summer. For many girls, softball was more than a sport, it was a means of not only meeting many new friends, but softball was also an outlet for built up anxi- eties. Junior Haley Chapman said that when she plays softball, she 'trealses a lot of anxiety by hitting the ball. Among the most popular teams were The Breakers from Little Daks and War- den Volkswagon from Geyer Springs. Teams sometimes began practicing as early as April. Regular season play lasted from May through Ausut, and many teams en- tered pre-season and post season tournaments. Among the most played in tourna- ments were Geyer Springs tournaments, Burns Park tournaments and the district and state tournaments. K A rrf, rr f Yr.k?s3:s Tx-26 , ,MXN-X., .. as .. . ,ws X ' X 5-'ima Softball plays a major role in ju- nior Paula Melton's summer. 102fA Sporting Tradition What A Way To Relax! Weight Lifting Is No More Male Domain an you imagine how embarrassing it would be for a boy to know a girl was able to lift more weight than he could? lf not, just ask any boy who has ever lifted weights with Cammy Perez. Cammy, who has been lift- ing weights for three and a half years, never had any in- tention of becoming a weight lifter. Cammy's boyfriend was lifting weights one day when she decided to try lift- ing, just for fun. To her sur- prise and the shock of her boyfriend and the other boys in the weight room, on her first try Cammy was able to lift more pounds than half of the astonished boys. Weight lifting was more fun, than a sport for Cammy. When asked why she lifted weights, Cammy said that it kept her in good physical shape. She also said, It re- laxes me. I feel better after weight lifting. Cammy believes that weight lifting is not mascu- line as some people think it is. Weight lifting is a person- al preference. While some girls chose to play softball or basketball, Cammy chose to lift weights. All Weather Sport You Can Find Her There Every very Saturday morn- ing, whether it's sunshining or snowing, she can be found at the Professor Bowl. She is Sandra Tuggle and she has been bowling for nine years. Sandra is a member of the bowling team called the Traveling League. Sandra placed 4th place in the city tournament which was no surprise since her highest game was 234. The highest Saturday possible game is 300. May teenagers strayed from bowling because they thought it was strictly an adult sport. Others thought of bowling as being much more complicated than it really was. However, the old method of writing down scores on a score sheet, no longer is common and the scoring is all computeriezed. Although recently more teenagers are beginning to bowl, Sandra doesn't think bowling will become as pop- ular as soccer, a once uncom- mon sport, because bowling is routine and not quite as exciting as some other sports. Routine or not, Sandra loves to bowl and because of this has become very talented in the sport. Looking for her next strike, is junior Sandra Tuggle. p ,'A Sporting Traditionflfllli if A Tramplmg Charger s Mlke McCarther IS Ju A Sporting Tradition This Football Season Was A Year Of Ups And Downs t wasn't the most important game of the year, nor did it determine the conference championship. But the game against Little Rock Hall was the last game of the season, and hopefully would determine the tone of next year's sea- son. The game was the second conference game of the year to end in overtime. On a eight-yard run by senior quarterback Reginald Dil- lard, Junior tailback Shawn Olive scored on the first play of overtime. Then the Lions defense stopped the Warriors on four downs. The Lions came from be- hind to defeat the Warriors. The second game to end in overtime was the tradi- tional rivalry with the Mills High Comets. Late in the overtime period, the Comets managed to get off a field goal which won the game 14-17 for Mills. We loss the game because of costly penalities and mis- takes, said head coach Ted Yotter. Junior Shawn Olive's first half exploits and a stubborn defense led the Lions to an easy 34-0 non- conference triumph over the North Little Rock Ole Main Wildcats. Every play of the game was a big play. said coach Yotter. In the Homecoming game, the Lions rendered their second loss to the Jacksonville Red Devils in a withering 33-18 loss. The Democrat's accessment of the game was that McClel- lan looked nothing like it had the two previous weeks. On a second effort the Lions managed to slip by the Northeast Chargers with a 14-13 victory. After losing a yard on first down, senior quarterback Regi- nald Dillard found junior halfback Shawn Olive open a few yards down field. Ol- ive caught the pass and dodged several Charger de- fenders for a 26-yard touch- down. Perhaps the greatest challenge of the season was the game against number one ranked Little Rock Parkview. The Lions were the only team that kept the AAAA- Central Conference Champs under 30 points. For The Record Scoreboard 4-4-2 Q-I2 MHS Conway 13 16 l Northeast 13 14 Sylan Hills 17 7 Ole Main 0 34 Jacksonville 33 18 ' Catholic 23 0 I Parkview 21 6 Pine Bluff 27 0 5 o is so Mills 17 14 Hall 14 21 5 A ss- tiiiiiacf -nl 735351.tif-,k?msfH3Rif5'ii.i-as sf? il-'fi-i1'E's'kii xt - Back-up quarterback Brent Rose Running with the ball against the v junior, pitches out the ball as he is tack- Conway Wampus Cats is senior led by junior Buzzy Sawyer. Roma Williams. A Sporting Traditionf105 W. is g wg E Qs? iii , bs . is mx 4 , km A--' X Q PM we H. Ar Y X NK , X X1 x .4 'R ,Nr Q Q Qs Q Q xi Q .-T , 1- ' -' ' ' A Sporting Tradition '- Traditionally Intense Battle he halls were emp- ty. The shadows lengthened, and night crept over the campus. The tedious vigil had begun. Students were camped out, determined to guard the school from the at- tacks of their arch rival- Mills. For fourteen years, the ri- valry between our school and Mills grew into an intense struggle on the football field and an intense battle on the school grounds. This game and the Home- coming game are the only games where students come up to us and say, 'Man, I hope you win this game, ' said senior punter Brian Powell, It,s hard to hear the signals because the crowd is so loud at this game,', he con- tinued. Each year, the rivalry seems to become more vi- cious or intense, depending on the point of view. The rivalry has gone from fun to QR? S... l. Trying to top the rivaling schools spirit, Lion fans shout their team on during the Mills and McClel- lan game. After a McClellan fumble, both Comet and Lion players scramble to recover the ball. dirty, said senior linebacker Mitch James. It Cthis factj makes the game tougher, more physicalf' he contin- ued. Part of the student body's participation in this rivalry was to get them better than they did us, according to senior David Short. Part of the fun is doing it without getting caught, he said. Doing it this year con- sisted of dumping cow ma- nure mixed with styrofoam beads on the front grounds at Mills. Mills attempted to drop green and gold popcorn from a plane during our pep rally, but Allendale received most of this. Even though the rivalry was intense, most students of these two schools allowed the rivalry to end at the end of the Friday night game. Our church fGeyer Springs Baptist Churchj invites both teams for fellowship and piz- za after this game, said sen- ior linebacker Tommy John- son. Getting his point across to the varsi- ty football players is head coach Ted Yotter. i.,flf'5 A Sporting Trad1t1onf1O'7 I Sporting Tradi ion Life After November or 12 weeks you can see them sweating, running, stretching, hitting, watching films, and living on salt tab- lets. But what happens after all this agony has ended? What happens after November? November is the end of football sea- son, but some it's the beginning. After football season is very important be- Running for short yardage over Ole Main's defense is senior Roma Williams. H f ms i2 - 'af yr.. NM e r ? . di .gas ise. 2 108fA Sporting Tradition Y 2 cause you are getting prepared for the upcoming season said head coach Ted Yotter. After football season the players find that they have a variety of activities to keep them physically fit: playing bas- ketball, or going into off-season track. The junior and sophomore players can participate in off-season football. Sen- iors that don't participate in track or basketball do their own thing. Sever- al seniors placed themselves on a weight program, in order to prepare for college football. Others went hunting or did the things they didn't have time for during the season. ,.i-- si A .JW Mm? ff Senior Tommy Johnson helps Weight lifting takes much con fellow senior Patrick Hill in the centration and effort on senior Pat- weight room. rick Hill's part. '-,gp--in in ll., T -1 rl iA H 1 Coaching Staff: kneeling: Martha Cothreng Back row, Ted Yotter, Da- vid Booth, Keith Browning, Tom McKinney, Charles Terry, Bob Bowman, Sonny Bull. Q. Y ,,.,,.,, , ,, , g V , . ' ' ,, A ,, , 1 ' Y g Y, ,l,,, tczizfz Z V r ,, V 'f'il' -i E4 Vvz. V,.,, 'Y Cm- ,,,,. ,. gl. W ul I N A y V .rll Ilvl I ' . it L 1 -, IAAA V ,,i' V , W V 7 -KA V KA' . ,, ull- Senior Football Players: Front Row, Dickey Staggs, Harley Welch, Paul Sebastian, Roma Williams, Reginald Dillard, Row 2: Rodney Johnson, Tommy Johnson, Han Choi, Brett Carroll, Alan Nesbitt, Joe Hinson, Row 3: Patrick Hill, Richard Styers, Doug Spear, An- toine Gordon, Jerry Trotter, Brent Dickson, Back row: Manager Brian Hill, Dwain Collins, Eddie Matlock, Kelly Pucek, Mark Akins, Mitch James, Manager Justin McClelland. A Sporting Traditionf109 Sporting Tradition Traditionally Competitive t was the bottom of the sixth. The Lions were down 5-0 to the Jackson- ville Red Devils. The Lions had two outs and a strike against them. This was the first game of the season and also the first loss of the sea- son. The Lions went on to lose three of the first five games but did not give up. They struggled back to win the next five games. This year was a rebuilding For The Record Score Board OPP SCORE MHS Jacksonville 0 4 Fair 7 3 Mills 11 3 Bryant 6 4 Sylvan Hills 5 8 North Pulaski 5 0 Cabot 4 1 Hot Springs '3 1 Sheridan l 4 Cabot 6 9 North Pulaski 2 12 Sylvan Hills 0 4 Bryant 4 2 .Jacksonville 8 1 Mills 6 ll0fA Sporting Tradition year for the Lions. The team surprised themselves and ev- ery one else. They won con- ference championship, the Arkansas Tech Tournament, and came in second in the district tournament. The McClellan baseball team is a traditionally very good clubf' said Coach Keith Browning. The winning tra- dition of the Lion baseball team will be carried on to next years team. .Q ,L 4 . A,,: fy, ,T , .,,,.f.,:ff:, , , -K IAA' 'iii' 'l,, .'. 1 .4 afz i' ,sw my 4 ny . j aaa. v 4 ai i gf. yiy we ae 1 3. W W Q ily W vf f, 5 ara iw-5 ' j I J W J A 3 -' , ni a ,Y 9 M I 1 1 W5 ' ii' S , i V,-l.g53,- i .53 W fr f - , ' ': - 'ir' A-4 . M ii i ' . , 2. ,I , V mf. .V QQ 2- .- Eli ig 4 :ii 5 ,Z ' Q--M .M 'Z .MM W A 'W ' .4 V jf iv ,Z f 3' q as fr ia if Q s HA 'I M A .fb md' Zigi boa 4 Nw. QQ, Q ,,,, an B an ia 5 Q W i 2' f Q- . 7 if V Jygk A , ,M U 2 Www to , V was it A .ir .e val ,, ' ' a ' ,. . - W , . . aww, J W . .1 .. ,M . , Bottom: Brian Hill, Monte Blue, Terry Sandage, Justin McClelland, Dennis Smith, Eddie Horn, Andy Nordman, Gary McFadden, Chris Yount Row 2: C. Browning, Keith Thompson, Keith Hinson, Jeff McClelland, Greg Lamb, David Head, Chad Martin, Dennis Griffin, C. Bull Row 3: Scott Moore, Greg Murtha, Brent Rose, Todd Oliver, Jimmy Barnard, Chris Campbell, and John McMillan In anticipation of the upcoming challenge, the baseball team awaits in the dugout. Intently watching his star play- ers is Coach Keith Browning. A Sporting Traditionflll , X Juniors Chad Martin, Tim Kling, and Monte Blue take advantage of the nice weather to play intramural football. Paul Hannon, senior, tries to find a team member to pass the ball to in an intramural game. 112fA Sporting Tradition In wmv' mi l L. ' 'WW i f i, -' Spbilfing Tradition lthough soccer and intramurals are not school affilliated sports, most stu- dents at McClellan consider them as important as foot- ball, basketball, and track. Intramural games were held every day at NAP. Names like Little Rock Laykers, DECA, Cowboys, Skywalkers, and Shankers were commonly heard dur- ing NAP. The games were supervised by coach David Booth every day. Intramural sports consist- ed of basketball, flag foot- ball, and softball. The play- ers were very sportsman like Although They Were Not Affilliated By The School, Soccer And Intramurals Were Popular. this yearg that made ever thing run smoother, said coach Booth. The soccer team in its fifth year at McClellan is growing rapidly. The team which is affilliated with the Central Arkansas Soccer Association CCASAJ, consisted of 16 members. Soccer has been around for years but has just started its widespread growth in Ameri- can. The funds just aren't there said Coach Karl Steinkraus when asked the question, why is soccer not a school affilliated sport. - - 4.1.-as . 14 S. Using the technique of hitting the soccer ball with their heads are opposing team members. Trying to gain control of the ball Attempting to gain control of after a point has been made, players the SOCCET ball are two Opposing run downfield. team members. A Sporting Traditionfl13 Senior Roger Webb receives sup- port from team members. Blocking a shot made by a NLR Northeast player is senior Alan Cozart. a '- 'QW' an . -' ..1 ' b. A Sporting Tradition Second Half Effort Proves Successful ith two three year starters returning and a starting line of five seniors, the keys to the AAAA Con- ference Championship were experience and leadership. The five starting seniors were three year starters Alan Cozart, Reginald Dillard, Paul Lauderdale, Roger Webb, and Michael Thomas. Seniors should be the back bone of every high school team, said Coach Tom McKinney. Coach McKin- 114fA Sporting Tradition ney went on to say lf a team has seniors sitting on the bench, then something's wrong. With the experience that these five seniors had, the Lions held an advantage over the other teams in the conference. Although the starters were important, they were supported by the other team members. The Lion basketball team had its ups and downs in pre- conference play, but the con- tcontinued on page 1173 Front row: Manager Greg Corley, Reginald Dillard, Michael Thomas, Paul Lauder, Gary McElroy, Man- ager Carl Phillips. Back row: Coach Tom McKinney, Jay Hampson, Ty- las Jones, Roger Webb, Alan Coa- zart, Mark McClain, Don Branigan Shawn Olive, Coach Charles Terry E 5' 2, 52 K MW n!f ww f Www? Igewffq 1 f , S .. , f 2 u m X U , f A 1 ', Z ff 145: ,.f,f V.,, I L, ,, ' V, , , M we f 'ir W , F i ,, we A 52 ,,s,,, an Z' QQ aff fr, f mnunillinlni e rf E ii 'GM was V 1 Dribbling down court to score another two points against the Syl- van Hills Bears is senior Reginald Dillard Front row: Reginald Hill, Lloyd McElroy, Reginald McClendon, Jon Smart, Greg Moore, Jeff Smith, Greg Lemons. Back row. Keith Bynum, Brent Shoptaw, Herman Williams, Harold Southall, Rolando Garcia, Neil Douglas, Archie Lester, Kevin Williams 116fA Sporting Tradition C - in Dv X.,-,QC A Sporting Tradition cKinney Compares Team To Faithful fcontinued from page 1141 ference games would deter- mine if the Lions would live up to their expectations. Ac- cording to Coach Tom McKinney, The team is like an old car. It runs good sometimes, then it stops, and no one knows when it's going to start up again. The Lions are usually ranked in the top ten during pre-conference play. The rat- ings are based on 'the end of Old Car last years conference stand- ings. Though the rankings are usually accurate, accord- ing to Coach Tom McKin- ney, the pre-season rankings are not something to set your books by for it is not how a team is ranked during pre-season but how that team is ranked after the sea- son. The AAAA conference is made up of tough competi- tors. The conference cham- For The Record Scoreboard 0 Opp L R Central N L R Ole Main Malvern L R Central Sylvans Hills Jacksonville Texarkana N L R Olemain Sylvan Hills Mills L R Hall L R Parkview Pine Bluff L R Catholic Mills L R Hall L R Parkview Pine Bluff L R Catholic Score MHS 59 54 66 68 49 52 53 57 05 60 30 57 60 50 57 52 56 54 53 53 70 58 64 63 54 51 58 51 60 76 58 56 50 48 88 77 53 40 pionship would not be an easy accomplishment for any team. Even if the Lions didn't win the conference cham- pionship title, it would be a year of learning. Coach Tom McKinney stated that the most important thing he wanted his players to learn was to be consistant and to adapt to how the game pro- gresses. Adding two points to the Lions scoring drive on a slamb-dunk is senior Roger Webb aww., 1 12 l td rrr 1 if if r 'Wfflam fu m,4.f.rz,,f, Prompting his players to get physical is Coach Tom McKinney. A Sporting Trad1t1on!l17 f 4 A Spor iii' Attempting a vital freethrow is Alan Cozart. yi ,ga Ai K L ie c - The agony of defeat is shown on coach Tom McKinney's face. Adding two more points to the Lion's score is senior Alan Cozart. ASporting-Traditidif - - Cozart Puts The E In Effort t began in second grade when he started play- ing basketball in the Geyer Springs league, from there it went to playing for the Ma- belvale Red Raiders and on to playing high school ball for the Crimson Lions. Alan Cozart has been playing bas- ketball since he was seven years old and fortunately he hasn't lost interest. Alan has not only played school basketball, he was a member of the junior olym- pic team which traveled to Russia. Russia was a real experience for me. said Alan. He also said that trav- eling to Russia made me re- alize how priviledged I am to be an American. Alan has been offered. scholarships to five colleges: Memphis State, Texas, Ar- kansas, Louiville, and Lou- isiana Tech. He has already toured two of the schools and will make a decision as to which college he will attend sometime in April. Although Alan has re- is, 5 ,,. ig 'f Q .....,........M.. 1 522 we -2 -we .... . imgllrir. xgsxr- N,. .,5,L ceived more publicity than most other players, and has been referred to as the lead- er of the team, Alan said It is all a team effort. No one person can play the game alone? Team work is defi- nitely one of the most impor- tant aspects of the game. Publicity plays an impor- tant part in high school bas- ketball, but the major influ- ence is the crowd. The crowd is 9972 of the game. commented Alan. Whether the year was a winning season or a losing season, one thing was for sure, the players ware more than teammates, they were friends. When asked about the cooperation among the players Alan replied, Even if we can't remember a Win- ning season, we can remem- ber the closeness of the play- ers. Crimson Lions Coaches: Charles Terry, Tom McKinny Snagging the rebound over Syl- van Hills is senior Mike Thomas A Sporting Trad1t1onfl2l A Sporting Tradition Anxiously awaiting for the rebound is junior Haley Chapman. As teammates cheer on fellow Lady Lions, Coach Cothren returns an out of bounds ball. l20fA Sporting Tradition First Ladies - Then Athletes against them a young inexperi- enced team was determined to make the season a year to learn and hopefully win. Youth is a time for problems and the girls of the Lady Lions experienced many. Re- turning with only a few sen- iors in 1983, the Lady Lions returned with only one sen- ior for the 84 season. The six juniors on the team had little I ith the odds experience but were long on nerves every minute of the game. This young team would eventually become exper- ienced and make that transi- tion from unseasoned youths to Veterans of the court, With the coming of a new season and the possibility of following in the footsteps of the 1979-80 Lady Lion State Champion, the girls looked towards a promising future. 'devel C, 112 ll- E ,af ts a 4' ' i is .. Kg uf...- X L w E A ll . . .K A Lfwmwa ' -- l t A of ww - is 0 Q .-iw : :s vi. nttt x 4 ff 'S-2. t Kmkk- :mA ':':-- : :'. tl' taaa . . .,..-.f.-... .. -- lf . - Q9 si A..A.. . 1' - ' :- ,...,,,,,.. 1. K -.......... .LQiflwwg-..,,.5l31: k , ,fx -,kk g 5- -,Wl ..... .fm - A -mmw.w:- .W ff-QSTW A 'H' ....f-ii. .wf LL,. . M ff 'L 2 5-J' M4547 ,145 V, . Starting the game with a jump hall is Rosalynn Young. After shooting the ball, junior Haley Chapman watches for another two points. '14 A Sporting Traditi0nf121 First Ladies - Then thletes, Cont. n the road towards a ranking in the polls, the Lady Lions opened the sea- son with a 70-56 win over Central. Continuing with a winning attitude, they de- feated White Hall with a nine point margin. The small school of Cutter Morning Star was the first team to de- feat the Lady Lions in season play. u Again the Ladies prevailed over Hot Springs and Cen- tral. In the next three games, the Lady Lions toiled against Sylvan Hills, Jacksonville, and Mount. St. Mary's and came up behind in all three battles. In the second meet- ing against Jacksonville, the Lions secured a win against their opponent. The second meeting with Hot Springs proved fruitful as the Crim- son, White, and Blue again reaped a victory. The next two meetings proved to be an uphill battle for the Lady's with two losses against Guy Perkins and Conway. In a second heart breaking loss to Sylvan Hills, the girls took the game all the way to triple overtime. Although the Lady Lions remained unranked through January, Coach Martha Cothren hoped for a surprise finish at the end of the year. She remarked, I would rather have a surprise team. Coach Cothren also stated that being a ranked team ad- ded unnecessary pressure on the girls and that she pre- ferred being ranked at the end of the season. Coach Cothren, who taught the girls to be ladies-then ath- letes,' hoped to continue the excellence of sporting tradi- tion of girls athletics. 122!A Sporting Tradition Dodging a Sylvan Hills' Bear is junior Paula Melton Scoreboard .QQ Central White Hall Cutter M Star Hot Springs Central Sylvan Hills Mt St Mary Jacksonville Hot Springs Guy Perkins Conway Sylvan Hills Ha Parkview Pine Bluff Mt. St, Mary Mills Score MHS 68 For The Record O ., ... 56 70 ' 40 49 . 35 29 ' 54 55 47 60 ' 71 46 Jacksonville 36 33 . . 50 44 ' 40 48 ' 47 54 ' 67 55 44 39 ' 51 50 ll 27 58 38 56 49 55 72 50 56 . 'Una-Q, 'mii A ,, V Qzfr VV ' , .i A a. Freethrows can makeithe difference be- tween a win and a lose as jignior Annette Scog- gins goes forma-n extra pdlnt. 'wsu-W V I 1- in -s an ,Q 8.1 ' .1.,, o .e:Q I? S Going for aifvxt-ra ploin jisljunior Annette Scoggins. Q as iiiw- ? , Seated: D. Sinnett, R. Self, R. Beard, V. Durham, K. Reaves, Row 2: G. Guess, P. Melton, J. Montegomery, A. Scoggins, C. Cantwell, -I. Holt, T. Smith, L. Gray, R. Young, D. Gibson, Row 3: Coach Bowman, A. Harris, L. Crowder, H. Chapman, S. Ester, S. Neely, K. Craig, C. Shells, Coach Cothren A Sporting Traditionf123 S pectator sports are a big part of the American way of life. Sports enthusiasts sit glued to TV sets on Saturday and Sunday afternoons and again on Monday nights to see yet another battle be- tween two forces-those two forces being either football, basketball or baseball teams. These three sports have considerable spectator ap- peal to audiences. The con- stant action, the struggle for victory, and for some the rampant violence were the drawing power for many fans. Of course, there are many sports enthusiasts who pre- fer a quieter, less frictional challenge such as golf, track, n ung Heroes or tennis. These sports do not receive as much press coverage or TV airing time. Nevertheless, they are sports with their own share of spec- tators and their own enthusi- astic participants. Golf, sometimes known as a rich man's game, held a great appeal for senior Chris Porter. Chris has a number of praiseworthy achieve- ments in his golf career: Medalist in AAAAA Arkan- sas State Tournament, 1st runner-up in Southwest Re- gional Tournament, top 40 in Optimist Jr. World Cham- pionship in San Diego, CA, Arkansas Jr. Tournament Overall Champion, and 1st runner-up in Arkansas State f- 4, tt' lm f Pole vaulting is one of senior Ricky Be- Patiently waiting on the sidelines sancon s favorite-events in track. for her chance to play tennis is sopho- more Deanna Chartrand. High School Over--all cham- pionship. With the support and participation of the eight members of the golf team, he led them in a winning record for the year. A favorite sport for many students was track. The physical exertion of running laps around the infinite as- phalt circle was, to many, the ultimate in sporting compe- tition. Many days were spent perfecting passing the baton, pole vaulting, long jumping, and hurdling. But the wind- ed lungs and sweating brows gave no not only the knowl- edge of being in top physical form but also the feeling of pride at the end of numerous victorious track meets. Tennis was a favorite for senior Jay Sanchehez. At first I thought that after one trip out to the courts I would be great, but that was easier said than done. I tried to serve like John McEnroe, but it didn't work! Practising two hours a day, the tennis team prepared for their many tournament matches in March, April, and May. Their rank in the district increased every time they won a match, usually five out of eight games. Tennis takes a great deal of practise and effort. Although it is a hard sport to play, I like it because it relaxes me, reflected Jay. s 2 l H- WW, , ,W is Ni f tx M ' ,, ff ' s 2, , if pt I at V 'f , K I Z 54 wwf '5 Karat' M H, Adwwfg YQ A , K WA I 4 . I VL T, ,T , V ,,H,,5iu,,'1r' A ' url ar: A V My I ' R ' it f , rf4'fgfff . ' 2 ' ,M an-niiffw 4 ff t , tr 16 T f 'L ' , . 'W rf Front rowg Donna French, Christine Smart. -lay Sanchez. Haivan Tran. Scott Allen. and Coach Robert Bowman. Back rowg Neal Douglas, Danny Cowart, Jay Baxter, Robert Shipman, Colin Brannon, Chris Ballard. and Dihn Tran. Front rowg Jeff Hicks, Mike Walsh. Jay Kidd, Brian Doolittle, Back rowg Tony Johnson, Dennis Mosizek, Gary Vaden, and Michael Roetzel. Practising his golf swing in preparation for an upcoming match is senior Chris Porter. Am Bottom rowg Harley Welsh, Kelly Ellington, Chris Cash. Charles Gunnels, Carl McBride, Marty Stauher, Rodney Johnson, Terry Lee, Reginald Dillard, Keith Carter, and coaches Ted Yotter and David Booth. Middle rowg Keree Muradian, Frank Porter, David Hud- son, Antoine Gordon, Maurice Brister, Kelvin Giles, Freddy McMillan, Todd Gardner, Roma Williamsg Back rowg Michael Thomas, Darwin Thompson, Mark Akins, Eddie Mat- lock, Neal Douglas, James Rodgers, Philip Strickland, and Brett Ellis. A Sporting Traditionf125 A Spor-Ting Tradition Girls Can Be Competitors Too xcited, poised, alert, and ready to win, the Lady Lions volleyball team eager- ly started off the new season. As a young team with one re- turning senior but many en- thusiastic juniors and sopho- mores, the girls battled through a hard season and ended with a 5-8 record. Although being a young team was a major problem throughout the season, they endured another problem that might have undermined the spirit of the team if they had not supported each oth- er. This was the fact that they had little or no support shown from the student body. The only faces in the stands they could regularly count on were parents. Many girls who were mem- bers of the volleyball team were also members of the track team. Coach Charles Terry began working with his runners as soon as bas- ketball season had ended. Although most of the events were individual ones, the girls worked together to create a reputation and re- cord that they and the whole school could be proud of. at a-,ang rf ,....V 3,.,,v, I Wnfwe ww,,wW,..t ,,,, . 2, MMR mf T. Q fi' ,, A 1'76fA Sporting Tradition In their starting position sopho- more Kim Bowman and senior ,Ik anna Abbott wait for the signal to begin. N . , Setting up to serve a powerful point against the opponent is Rosa- lyn Young. A '-.Q -SJ Junior Michelle Rainey doesn't hesitate in her powerful serve to the opponent. 'ls , r C Q , W: . 3 ..,...s -, um,-W.. Y we L Q -f ' -:ss..mws:- ,- .gas- qy X ,. X, vig? Q, ... , ggi? Watching their fellow team members volley, Sharon Roddy and Chiquitha Shells are ready to give assistance when needed. it Catching their breath and drinking much needed refreshments are senior Annette Scoggins and junior Christi Cantwell. Practicing passing the baton are sophomores Rhonda Haymon and Desheral Boone. A Sporting Traditionf127 3 5 i e if 1 as E Z 3 1, 5 43 r 5 Breaking Away The End Of A Way Of Life Passes Quickly he strands of 'fPomp and Circumstancen faded away, red caps covered the floor, crumpled programs littered Barton Coliseum, and the fi- nal break was completed. Seniors had cleared out lockers, turned in books, and paid for overdue 4 'NW 'wf N-W. r , ,M UA 4 .K A ,. Gathering in the courtyard after lunch are seniors Jeff Haslauer, Tom Burke, Mark Jackson, Diane Slack, and Han Choi. library books. It was their last official school day. Breaking away was a relief as well as a reluctant experience, a gradual experience. On the opening of school, I realized that this was rny last first day of school, said Rhonda Smart. As each month offered a variety of activities, the school days passed quickly. I think this was the fastest school year f 5 f - X L Stir ever, said Casey Whitt. The final Homecoming Parade, game, and dance, the final game with Mills, the final basketball game, and the final Sounds of Now were small breaks that lead seniors to the final breaking away from a life they had known for twelve years. M r 'vN-ww Senior Class Officers: Jamie Johnson, Treasurer, Kelly Pucek, President, Shelly Ferguson, Secre- tary, Michelle James, Vice-President. t The Top Cf The List Top 10 Percent Receive More Than Just A Gold Tassle I eing in the top ten percent of their A graduating class is quite an honor for students. Very few students can say that of their class. Graduating in the top ten percent gave an edge to those who were going on to college. Those students who were fortunate enough to look back and proudly say that they were in the top fourty- five students in the graduating class of 1984. Not shown are Donna Davis and Susan Scree- ton. they left high school at the top be in the top ten percent can eenc rrrr r f 5 ,.,, I N , is :f-I Irr .::. U 1 , .- .4 E 1'3'7fT p 10 Percent A W I ? 7 :,' 'C 1 V ff 6 Y . , f: Z f': f W 134fT0p 10 Percent Plent Cf The Right Stuff Students Are Rewarded For Their Excellence we 'fit satisfied with just getting their 20 credits to grau- excelled academically as well as in extracurricular activities. These students who excelled received scholarships and awards for their achievements. Among the seniors who received scholarships was Lynn Lile. She received two scholarships for her academic and leadership abilities. Lynn was a Century III state finalist and won the McClellan DAR CDaughters of American Revolutionl scholarship. Barry Glover was rewarded for his musical talents with an Arkansas State University musical scholarship. For ff '91 Z ' hile manylstudents were . ff J.. date, some leadership, Karen Quinn received a scholarship to attend Quachita Baptist University. Mark Milstead will attend Ole Miss. on an Air Force ROTC schol- arship. Many awards other than scholarships were given to students. Becky Slawson placed second in prose reading at the state tournament at Harding Universi- ty and also received second place in sto- ry telling at a Parkview tournament. Mark Milstead and James Higgins placed first in debate at Parkview High school. Another debater, Bill Ketcham, was the only National Merit Semi-Fi- nalist from McClellan High school. Receiving information about her Century III scholarship is Lynn Lile. Proudly displaying his lst place Debate tro- phy is James Higgins. Awards! 135 Boy George, The Police, and Duran Duran are a few of the decorations that brighten up senior Mike Housels locker. Dressing- Up The-Drab - Locker decorating was a way for many students to make a home sweet home at school. s it madness? Is it a fad or a fashion? Is it a new home style? You could call it locker art or dressing up the drab. Today's seniors are trying to make that last year of high school as exciting as it can be. And what better place to start than the most used part of the school, the lockers. The seniors re- vealed their creativity in dressing those drab lockers. There were posters, mir- rors, carpets, pictures, calendars, stick- ers, and even wallpaper to make it seem 1'36fLockers like a home away from home. lt makes it look more like home and helps me get through the dayf' said senior Todd Ross. Senior Lynn Lile was determined to give her locker personality by using blue and white Checkerboard paper that covered the inside walls. She hung a clown on a string from the top of the locker door. The door of her locker was covered with snapshots of the good times shels had at McClellan. Another locker, that of senior Kathy Gallagher, was also brightly decorated with reds and white polka dot paper. On the walls were pictures with inspira- tional quotes to help me get through each day. For a personal touch she had added her initial to the floor and a writ- ing pad to the door. ' Even though other students had also attempted to dress the drab, somehow seniors gave a new definition to this action. Deanna Abbott: VICA 2,33 Bas- T5fl'5'l'l'?f?C7571 Mark Akins Mike Akridge: VICA 4g Band 2,3,43 All Region Band 3,4 arl Albritton: Speech and Dra- ma .u 5 rt ub 2 Brian Alewelt Scott Allen: Choir 2,3,4g Tennis 3g Band 2,3,4-Quartermaster 3 All Region Choir 3,4g Mafia 4 Darrell Als Robin Ar ' FTA 2-President 25 A 2,3-Secretary 3g VICA 3,4-President 83 ICT I 45 Science Club 2-Vice President 2 Debbie Atkins: FHA 3,45 Ol-IE 5,4g HERO 3,4 L Laura Bagwell ell Baile : FBLA 2,3,4g COE 41 ymnastics 25 BOE 3 a B ' : FHA 3,43 HERO 3,4-presg choir 2 Daniel Baker: Football 23 Or- chestra 2,3,4-pres.: All Region Or' chestra 3 ' at ' Art Club 2: VICA 4-Sem Choir 2,3,4. Ricky Baughman: DECA 3,4 Shelly Bearden: FBLA 2,3,4g Student Council 3-Rep.g Key Club 3g Choir 2,35 DECA 4 Clay Beasley: Basketball 2,3,4g DECA 2 Ric c : VICA 4g Foot- all 2,31 Track 2,331 Cindy Bills: FBLA 45 DECA 39 COE 44Pres. Brett Bisbee: FBLA 23 Choir 2,3,4-Highlander 3,4'V. Pres. 4 Lockersfl37 X if if 'fa PLJAOVL .... ffl:-f X585 LCEPXLQQJ Raymond Blo Karen Boh ' FHA 43 HERO 4 Lisa Bolin: NHS 4g Speech and Drama Club 4g Art Club 23 Band 2,3,4-Librarian 3, Capt. 4g All Re- gion Band 3. Sylvia Bowlly Renee Boyce: FBLA 2,3,4g COE 4 Teresa Boydston: NHS 2,3,43 FBLA 2,3,43 Key Club 43 COE 4- Sec.3 BOE award 3 Derrick Bradford Laura Brantigan: FBLA 3,43 Choir 23 Drama Presentation 2 Kim Brown: FBLA 33 Cheer- leaders 2,33 ICT 4 Patty Bruce: FHA 3,4 HERO 3,4 e: NHS 2,3,43 Psy- chology award 3 Tracy Bryant: FBLA 2,3,4-Re- porter 2, Pres. 43 Student Council 2,3-Rep.3 FCA 43 COE 4 Ann ullard: VICA 4 Choir 2,33 Octagon Club 4 Lisa Burgess: Los Amigos 2, Choir 2,3,4,-Highlander 3,43 Year- book 3,43 Who's Who Among American High School Students 3 Torn Burke: Industrial 1 Arts Club 23 VICA 2,3 Michelle Burton: NHS 3,43 FBLA 4g Choir 2,3,4Q All Region Choir 33 Jazz Choir 3,4 George Bynum: Environmental Awareness 3g Football 23 Track 4 Kathy Campbell: FBLA 2,43 Key Club 23 Track 23 COE 4 Elisa Caplinger: Yearbook Staff 3,4-Editor 43 Speech I Award 103 UCA Honors Program 43 Whols Who Among American High School Students 3 Billy Care : VICA 43 DECA 35 Octagon lub 2,4 4 f t, 4 W' A I iifi uf . tm ,, , ., 4 1 I- 1'l8fSenior Halloween Halloween Madness Things That Go Bump In The Night umpkin stealing, late night parties, attacking young trick-or-treat- ers with water balloons, all are a part of a senior's Halloween. The terrization of sub-divisions have become an essential part of the Hallow- een Night activities. Not everyone got a free night off on the creepiest night of the year, but those who did, knew how to make the best of it. Some dressed up in scary costumes, not for the treating but for trickery and frights. Throwing water balloons was just good clean funf' said Carl Albrit- ton. Other seniors went a different route to play some Halloween trickery on un- suspecting victims. Halloween was a time of taking candy away from ba- bies, said senior Jay Sanchez. The seniors proved that on Hallow- een night the little kid in everyone sur- faces once again. Senior Carl Albritton shows his Halloween spirit by throwing water balloons. Senior Becky Slawson and junior Stacey Crump talk about each others Halloween attire. Brett Carroll: Key Club 3,4g Es- ?6Fi7T'F'J6TEE'l'T 2,3,4g Model UNQ Baseball 2,4 Angie Carter: FBLA 2,3,4g FHA 2g Track 2,33 COE 4g Volleyball 3 Brad Cagmrg VICA 3,4 Cynthia Cartwright: FBLA 3,4g Environmental Awareness 3g Speech and Drama Club 43 Home- coming Court 3 Senior Halloweenfl39 Ronnie Caster: Basketball 3,43 FCA 2 Randy Castillo Anne Mike Cathey: Football 12,35 FCA 23, MADD 3 ' Clay Causey: NHS 4, Key Club 3,41 Model UN 3 Kerrie Cearley: NHS 2,33 COE 4 Kelley Chandler Lonnie Chapman Han Choi: NHS 2,3,4, Key Club ' 3,43 Boys' State 3g Football 43 FCA I 4 Jeff Clay: Football 3 I Sherry Cleveland: FHA 3,4Q OHE 3,4Q HERO 3,4 Donnae Clifft: Lionettes 2,4- R 4 I an e K Q6 TONCV f BJ? 0 ' PK ochran: Art Club 2g ECA 3,4 Vickie Collie: FBLA 2,3,43 COE , 4 I Dwain Collins: Football 2,3,4g FCA 3,4 June Collins: FBLA 43 Student Council 2,3,43 Speech and Drama Club 2,3,4g Homecoming Court 43 Band 2,334 I Jennifer Conner: Paper Staff 33 I Octagon Club 23,4-Sec. 2, V. Pres. 4g Afterthoughts 2,3,43 Photogra- I ' phy Award 3 Brian Costa: NHS 2,3,4g Student Council 4-Seng Key Club 3,43 Boys' State 3, Soccer Club 2,3,4 Danny Cox: Art Club 33 Choir 2,33 DECA 4 Alan Cozart: Choir 2,3,43 Foot- I ball 2,33 Basketball 2,3,43 sopho- more of the year award 23 All State I All Conference-Basketball 2,33 All ' American 3 , , '37 Qu 140fPressure 1 Kim Craig: Student Council 2g Choir 2,3,4g Basketball 3,43 FCA 4 Laura Crawford: FBLA 4g Dra- ma Club 4 Mark Crockett Chris Croney: VICA 2,3,4g Band 2,3g Chess Club 2g MADD 3,4 nder Pressure - Seniors discover their final year is plagued with tension and worry. ension, pressure, pain. No, this is not a television commerical but a description of the senior year for many students. The pressures of making good grades, deciding where to go to college, and how to afford it on top of all the extra activities of seniors caused many students to be upset, depressed, and confused. The senior year was always thought to be a blow-off year. However, many students found it a big let-down. 'fYou have to live up to expectations. That can be very difficult when you take A.P. classes and other classes that require much time, said senior Doug Vann. You want the best education you can get. Your education is like a foundation. This foundation helps you to see whether you will be a successf' agreed Han Choi, senior. Another cause of pressure for seniors is 'fNot knowing what you are going to be, or what you are going to do with your life. comments Terri Steele, sen- ior. In order to eliminate pressures, some seniors took easy classes to keep their grade point high. Yet, some students accepted the challenge of advanced placement courses, foreign languages, and advanced level courses. Even though seniors had to continue- ly deal with pressures, many realized that this was probably the easiest year of several more years. Attentively listening in his third period de- bate class is senior Mark Milstead. Pressuref141 Gail Cossland: FBLA 2,3,4g Choir 23,4 Jeana Crouch: FBLA 4g Student Council 4-Repg Lionettes 2,3,4g Youth in Goverment 4 Cindy Crowder: FBLA 3,43 Choir 2g Youth in Government, 4 Philip Cullins: NHS 3,4-Trea- surer 43 Environmental Awareness 2,3g Key Club 2g World History Award 2 Gia Dacus: FTA 4, Choir 2,3,4 Deanna Daley James Davis: DECA 2,35 Chris- tian Council 2-Chaplain Mary Davis: Paper staff 33 DECA 4 VY, 14 7fAmerican Dream - f vm- A.v, gf...-...a....,..l..i. C Qvclv 1.0015 'Dale wsmeek Valesa Davis: FBLA 35 Environ- mental Awareness 3g Key Club 35 Choir 2,3,4g Jazz Ensamble 3,4 Felicia Delaware: FBLA 3: Track 3 ' Cindy Dennis: FBLA 2,3,4g COE 4, ckerson: FTA 23 FHA 2,3,4-V. Pres. 23 UHE 3,43 ,A AIA HERO 3,4-V. Pres. 33 Exec. Officer :: . 4 ,luv KC . .,L Q -O Q Terry Dickerson: Track 2 Brent Dickson: Student Council 2,3-Repg Key Club 2,35 Football 2,3,4g FCA 3,45 Lion salesmang DECA 4 Reginald Dillard: Football 2,3,4-Lettermang Basketball 2,3,4- Lettermang Track 2,3,4-Letter- mang FCA 3,4 Brenda Dorrell: NHS 2,3,4g Choir 2,3,4g Yearbook Staff 3-Jr. Class Editorg French Club 3-Sec- I .fTreas. ' Living The American Dream The American dream for many seniors seemed beyond grasp, but they still kept dreaming. 1 3 is it a hope or a nightmare? Is it a reality or just an illusion? What- ever it may be, it still has only one name and that is the American Dream. But, what exactly is the American Dream? There is no clear definition of this dream, only the goals and expectations of the people. Everybody has a different view of the American,Dream and our seniors are no exception. The ideal American Dream for me would be to have peace in the world, says Letitia Hampton. Every blue-blooded, Coca-Cola drinking, flag-waving, American boy dreams of being filthy rich, driving a car with a long Grant Phillips. Italian name,', says AQQQTQISZZ3. Ei s X i Lee Ann Red's dream is to capture Brad Taylor, the quarterback fo the Ar- kansas Razorbacks and to marry him. lt did not matter what the dream was just as long as you believe in it. Part of senior Beth Owen's American Dream was living in a big house. American Dreamfl43 Renting a tuxedo from Sir Roberts Formal Shop is a major expense for senior Jeff McClel- land. Preparing for graduation by ordering invita- tions is senior Bobby Jenkins. 1' S Shaw Drummond: Key Club 45 VICA 4g Arch. Drafting I Award 3g NHS 45 Whois Who 4 Brian Duff: FBLA 3,4g VICA 3,4- Reporter 4g Football 2 Rhonda Dunlap: FBLA 2,3g Speech and Drama Club 43 Art Club 2,3,4g Yearbook Staff 4 Dr-:De Dunn: Art Club 2g Home- coming Court 23 Lionettes 2,3- Rank leader 3 Todd Durham be Greg Ellis: Golf 2,3,4g Drafting 2,3-Sgt. At Arms Sherri Elrodz FBLA 2,3,4g COE 4-Parliarnentarian Carol Evans: VICA 3,41 Tesha Ewing: FBLA 3g HERO 4 : VICA 4g Choir 2,3,4: Footbail 2,35 Track 2 Katrina Favre: NHS 2,3,43 Choir 23 DECA 4 William Fellows: Football 2 has--an K fox. I l44fSenior Expenses The Cost 0 Class Dealing with the unbelievable costs of their senior year, seniors dug deep into their pockets. veryone thinks being a sen- ior is about the greatest thing that could happen to a person, until they see the bill. From test taking to graduation seniors must periodically pay for the coveted status of being a senior. Preparing to go to college can be al- most as expensive as really going to col- lege. Many tests are taken each year by students such as ACT and SAT, hoping to be lucky enough to receive an accep- tance by a particular college. These tests may cost from five to twelve dol- lars, with no guarantee of getting their moneyis worth. The prom poses more of a financial problem for the guys. Not only having to worry about a tux that costs any- where from S50 to 3150, but also gas, dinner, and a corsage for their favorite girl who probably spends about S130 on a dress. Graduation is perhaps the most ex- pensive aspect of being a senior. The total cost to participate in this momen- tous event can be as high as 33600. Sen- iors start paying for graduation their junior year by purchasing a class ring. Over the summer they buy senior pic- tures to send to all of their friends and relatives. Throughout the school year they purchase invitations and their cap and gown. Being a senior is an expensive exper- ience. No wonder seniors throw their caps in celebration of a temporary rest for their bank account. lv ? ,'V . K I f.rif rrtt - . i 'r-. ' . 4 A g - 4 W , 4 ' , r... ' A J .. , ,.., ------ xf.. if i . A Shelley Ferguson: Key Club 4g Girls, State 33 Lionettes 2,3,4g Class Officers 4-Sec., FCA 4-Trea- ,,,,.Q,,!LEi-9118-Ii. surer J a M FBLA 3,45 COE 4, Business Law Award 35 Electric Calculator 4 Denyse Fleming: FTA 25 FBLA 2,3,4g Choir 2,3,4-Sec. 45 All Region Choir 3: COE 4 Ronnie Ford: FBLA 2,3,4g Base- ball 2,3,4 , Keith Foster: Art Club 2, VICA 2,3-Sec. Mike Foster Tripp Frazier: FBLA 3,4-Histo rian 4g House of Rep. 3 Richard Fritz Trisha Frost: NHS 2,3,4g Year- book Staff 3,4-Editor 4g Model UN 33 French Club 2,33 LePro1-ocateur I 4-Contributing writer ' F ' NHS 2g Student Council 2,3-Repq Football 3g Bas- ketball 2 Kathy Gallagher: NHS 2,3,4g Student Council 2,3,4-Sen. 2,4 Re- porter 3 V. Pres. SASC 4g Choir 2,3,4g Scotia 23 Highlander 3,45 Girls' State 35 Class Officer-Trew surer 2 Olivia Garcia: NHS 2,3,4g FBLA 2,3,4g Key Club 43 Youth in Govt. 4 Senior Expensesf145 Mike Garner: VICA 3-Pres.g Gina Garvin: DECA 3,4 Samantha Gatliff: Los Amigos 23 FBLA 4g Band 2 ' Dwayne George: . FBLA 3,43 FHA 3,4,ZQ,HEg HERO 4-V.Pres. . an MWPSI ff' V as rx 2 W lg LW' T if 54 X523-fs G' rxfi is 5 fills' X Barry Glover: All State Band 43 Band 2,3,4-treasurer 2, V.Pres. 31 Class Officer 23 All Region Band 2,3,4g Outstanding Boy at North- east Louisiana Band Camp Award 3 Antoine Gordon: FBLA 4g Foot- ball 2,3,4,g Track 2,3,4g FCA 4g Stu- dent Council 4-House of Rep. Phillip Grabber Antonette Greer: FBLA 2,4-V. Pres. 43 FHA 45 Student Council 3g Lionettes 2,3 Dennis Griffin: Choir 2,3,4g Football 2,33 Baseball 3,4 James Griffin Penny Grim. Lewis Grounds: Baseball 4 Chris Porter knows now that he is a senior by the breaking of his dinner plate. 146fbeniors l Letita Hampton: FBLA 2,322,4- Corresponding Sec. 4g Shorthand I Award 35 Media Club 25 Fire mar- shal 2,3 Paul Hannon: Mafia 4 John Hardernan: VICA 3,4g Sco- tia 43 Youth in Government 33 Chess Club 4 Gre d rave: Key Club 2,3,4g Football anager 23 FCA 25 Yearbook Staff 4 R .5Lo2,etL'z. James Harrison: FBLA 34 Sci- ence Club 2 Sheila Harrison: Lionettes 3,4- Rank Leader 43 Best Rank 45 Hon- or Society Award-2 Bobby Harwell: FBLA 3,4g Me- dia Club 3,4g ICT I 4 Jeff Haslauer: Student Council rama Club 43 Key Club 45 All Region Choir 33 Mafia 4 COE 4-Parlimentarian 4g BOE 3 Regina Hayman V ' V Mike Benny- FBLA 45 DECA-4' Jamie Herndon: VICA 3,4-Sec. 3,45 Media Club 2 Marianne Hatcher: FBLA 2,3,4g You Know You're A Senior emember the first day of school? The day you begged your mother not to make you get on the bus. The day your little brother followed you to the bus stop and ate your friendls lunch. The day that you came home with a name tag, bus number, permission slip, and 2 notes to your parents all pinned on your sweater. The day you came home and cried to your parents that you never wanted to go back to school. This trauma of leaving the security of home brought some to tears as they des- perately clung to their mother's arms or tightly held on to their ever present teddy-bear. The braver students proud- ly took their first big step onto the bus with their brand new schoolbox and Wh n... Snoopy lunchbox in hand and coura- geously waved good-bye to their par- ents. Again, some students cried, yet oth- ers joyfully waved good-bye to these halls. These seniors were asked how they felt about their last year of school and were asked to complete the follow- ing sentence: You know you're a senior when . , . . These were the many var- ied responses of this year's graduating class: You know you're a senior when . . . your dad breaks your plate at the din- ner table on the day of graduation. - Chris Porter the Army says Be all that you can be.', - David Short you've got all the answers but none of them workf' - Hob Wood your mother buys you suitcases in- stead of new clothes. - John Otto you don't ever want to go to school or do anything that has to do with school work. - Karen Quinn you ask for a electric typewriter for Christmas. - Trisha Frost you start thinking about all the really good times you've had while in school and when you start to get really emo- tional everytime you think about leav- ing all your friends and going separate ways. - Elisa Caplinger U.S. News and World Report is a means of keeping up with current world affairs for Olivia Garcia. MW '-ni Randy Herring: Student Coun- cil 4g Environmental Awareness 3,43 Basketball 2 Gene Hicks: Key Club 23 Choir 2,3,4g Yearbook 3-Photography Greg Hicks: FBLA 3,4g Media Club 35 Anti-Preps 3 James Higgins: Environmental Awareness 49 Speech and Drama Club 3,43 Boys' State 3g Youth in Government 43 Debate 1 Award 3g American history Award 3 u . l33lanCHill: Los Amigos 2,3,4-His- torian 45 Key Club 2,3,4g Football 3,4g Baseball 2,3,4 Patrick Hill: Key Club 2,33 Homecoming Escort 2,33 Football 2,3,4g Class Officer 3-Pres. Polly Hilliard: Student Council 2,33 Speech and Drama Club 4g Art Club 2,35 Traveling Troup 4g House of Rep. 4 Dwayne Hillman Joe Hinson Kenny Hood Eddie Horn: Art Club 3,45 Base- ball 3,4 Mike House: Band 2,3,4-Band captain 43 Paperstaff 4 l48fS9Ill0l'S rom the six olclock news, to the newspaper accounts, to the radio bulletins, the world became aware for a few months of the turmoils of the nuclear age. Seniors realized that the world prob- lems of today would affect them greatly since they were the future leaders of the country and the ones who would be forced to face the consequences of such events. The downing by the Soviets of the 007 Korean jetliner, the American invasion of Grenada, and the bombing HCIBHI' AQBI ot Time For Worry But Time For Solutions in Beirut, Lebonan which resulted in the death of more than two hundred American Marines made the first few months of the school year unsettling for many concerned students, In my opin- ion, Russia had no right to shoot down and kill all of those people, said Lisa Bolin. The possibility of a nuclear war was also something that many students thought about often. The television movie The Day After,-which depicted the result of a nuclear holocaust, was broadcast on November 20. The re- sponses to this movie were varied. While a few students said that the film did not affect them, a majority of stu- dents felt differently. The threat of nuclear war is facing all of us, young and old alike, to face the problems we have and to look for solu- tions, said Lynn Lile. She continued to comment on a positive note: We shouldn't waste our time worrying about it. We must seek solutions. Ii Bernadette Houston: FBLA 3,-4g Track 2,3,4g DECA 45 Volley- ball 2,3,4 Barbara Howell ' Lisa Howard: FBLA 2g FHA?- Photographerg CUE 4 Q Lana I-Iuneeker: Choir 2,33- Pres. 2, Highlander, treasurer 45 All Region Choir 3, French Club 2,3-Pres. 33 Jazz Choir 3,43 Who's l Who 3 Lisa Hupp: FBLA 4, Art Club 2,3-Sec. 33 Key Club 3,4g Choir 2,33 House of Rep. 3 Tamm - FBLA 2g FHA 25 Student Council 4-House, -of Hepa Choir 2,35 DECA 4-Sec. ' ' .Michele slacks.: FBLA 2,3,4g COEA 4g Lionsalesman 2 Michelle James: FTA 3g Stu- dent Council 3,4g Key Club 3,4- Sec. 41 Class Gfficer 4-V. Pres. I Lanett Jack : FHA 3-Trea- ' surerg r lub QQDECA 4-Report er r Lauren Jackson: Speech and Drama Club 3qgKey Club 3g Cheer- leaders 2,3-Sec.!Tres. 33 Youth in Government 3g ICT 4-Reporter Lesle ckson: Choir 2 ark Jackson: Speech and Dra- ma Club 43 Choir 3,4-Highlander 3,4, Scotia 2, Jazz Choir 45 Year- book staff 45 All Region Choir 3: Mafia 4 Sen1orsfl49 Mitch James: Choir 2,3,4g FCA 2,43 Letterman Club 2,3,4 Brigette Johnson: FBLA 2,4g Student Council 2,43 Homecoming Court 2,31 Lionettes 2,3,4-Rank leader 3,43 Youth in Government 4 Jamie Johnson: Art Club 2,3,4- V. Pres. 3, Pres, 43 Key Club 3,4-V, Pres. 43 Yearbook staff 3,43 Class Officer 3,4-Treasurer 3,43 AYAA 2,4 Lynetta Johnson: FBLA 2,33 FHA 4g VICA 3g HERO-OHE 4 Rodney Johnson: FHA 2,3,4g Football 2,3,4g Basketball 2,33 Track 2,3,43 FCA 2,3,4 Tommy Johnson: Key Club 2,33 Football 2,3,4Q FCA 2,3,43 Letter- man Club 3,4 Dana Johnston: FBLA 3,43 DECA 4 Lisa Johnston: FBLA 3,4g FHA oir 2,3,4-V, Pres. 33 COE 4 Kara Jolliff: NHS 2,3343 Speech and Drama Club 2,3,4-Reporter 3, Pres. 4, Drama Award 33 Girls' State 33 All Region Choir 2,3,4g Governorls School 3 Hal Jones: DECA 3,4 Kim Jones: FBLA 3,43 COE 4 Kim Jones: FBLA 23 Student Council 2,4-House of Rep.3 Art Club 2,3,4-Sec. 43 Choir 2,3,43 Lionettes 3 LaJuana Kelley: FBLA 2,43 COE 4 Bill Ketcham: NHS 3,43 Speech and Drama Club 3,41 Key Club 4 Track 23 National Merit Finalist 4 Stephanie Killian: NHS 3,43 Key Club 33 Lionettes 2,3,4-Rank Leader 4 Jennifer Killingsworth: FBLA 43 Lionettes 3 Anita King: FBLA 4g FHA 3,4- Sec. 33 Track 23 COE 43 BOE 4 Wally King: FBLA 2 Todd Kuhn: VICA 3,4 Beth Lancaster: Choir 2,3,4g Lionettes 3,4-Rankleader 4 l Stanley Landrum: Rodeo 3 Danny Lane: VICA 4-Treasurer 45 Octagon Club 2,35 Media Club 2 Andrea Lanham: Los Amigos 23 NHS 2g FBLA 4g FHA 2-Historian 25 Key Club 3,4 Paul Lauderdale: Student Council 2g Football 2g Basketball 2,3,4g Track 2g FCA 2,3g Baseball 2 Eighteen Is Not So Hot Seniors Realized That Turning Eighteen Was Not All That They Thought It Would Be. can't wait until I turn six- teen, I can drive-finallyf' I wish I could turn seventeen. Then I will finally be able to get into RH rated movies without lying about my age. IfI were only eighteen, then I could- well, I would be able to .... Well, it doesn't matter what I can do. I just want to be eighteenf, For many students, eighteen seemed to be a magical age. It was at age eigh- teen that students were considered adults. However, students realized that this was not such a magical day after all. Turning eighteen was more than blowing out eighteen candles on a birthday cakeg it meant that students would be faced with many more respon- sibilities. Students who were not previously employed began searching seriously for employment. Many filled out applica- tions at fast food restaurants such as Wendy's and McDonald,s, while others chose to apply at clothing stores such as Unique Fashions, Dillards, and Brooks. Some eighteen year olds filled out college applications to schools which varied from UALR to Baylor to Har- vard. At eighteen, young men were faced with the requirement of registering for the draft. Some not only registered but enlisted in one of the armed services. TEQQENSTA CZ! CII .li Voting privileges were given to eigh- teen year olds after they registered to vote. Many looked forward to getting more involved in their government, re- alizing that they were the future leaders of the country. While these eighteen year olds took advantage of the ability to vote, others thought it was too much of a hassle and chose not to vote. Although there were many good times experienced by eighteen year olds, with all of these added responsi- bilities many eighteen year olds such as Mitch James could honestly say, Be- ing eighteen is no different than being any other age, except now we are old enough to go to war. Sgt. Tharp, Private David Short, Sgt. Gul- ledge and Sgt. March pose in front of the Army Recruiting Station. Seniorsflfil . . Dancing Music Videos Inspire A New Found Dancing Craze larity of MTV and mu- sic Videos, dancing had reached new heights. Dancing had not only influenced students, but it had in- fluenced musicians as well. Many popu- lar musical groups and performers be- gan to not only play music and sing, but they also began to dance, dance, dance! Two major motion pictures which in- spired the dancing craze were John Travolta's Staying Alive and new- comer Jennifer Beall's hit Flash- ith the increasing popu- Chris Cash shows his skill in break Dancing. 152!ben1ors i dance, which brought about the popu- lar break dancing craze. Donna Summer's video She Works Hard for the Money and Billy Joel's Uptown Girln were very popular and displayed a variety of people dancing as they portrayed people who ranged from auto mechanics to housewives to nurses. But, perhaps, the most popular of all the video dancers was Micheal Jackson. The performers in Micheal J ackson's videos Billie Jean and Beat It', dis- played incredible dancing abilities. The most popular of his videos, Thriller , which was actually classified as a short film, demonstrated the most original and best choreographed dancing of all the others. Micheal Jackson's smooth moves and seemingly effortless dancing inspired many students to really take dancing seriously. As Lee Ann Red said, My dream is to one day dance as well as Micheal Jackson. Michelle Leggett: Key Club 3.4: Girls' State 33 Lionettes 3: Class Officer fl-Sec.: NHS -1 James Lesher Scott Lewelle'n: Youth in Gov- ernment 3,4-V. Chairperson 3.4: Model UN 3.4g TAG 3,45 Le Provo- cateur 4-Chief Editor: UCAS Honor Program 4 Debra Lewis: FHA 3-Parlirnen- tariang Student Council 3-House of Rep., Christian Council 4-Chaplin Lynn Lile: NHS 2,3,-4-Reporter 4: Student Council 2,3,-4-V. Pres. 4. Representative 2,3g Key Club 4: Girls' State 3-Senator, Lionettes 2,3-Rank leader 3 Michelle Lindsey: Choir 23.-1: All Region Choir 3 Jennifer Linkous: Student Council 4-Sr, Senator: Key Club 3, Girls' State 41 Homecoming Court 3,4-Football 3,43 Basketball Il: Lionettes 2,3,4-Rank leader 33 2nd Lieut. 4. Joey Livingston: VICA 3,4g Mc- Clellan High School Rodeo Ass. 2,3 Victor Lockert Terry Long Shellie Longboat: FBLA 2,3,4: COE 4: Rodeo Club 2 Kelly Luce: Choir 2,3,4g Octagon Club 4 Scott Magby: DECA 3,4 Richard Malott: All State Choir 3, Choir 23,45 All Region Chgyir 3 Demetria Manning Brady Massey: Los Amigos 21 Choir 2,3345 Band 2,3,4-Drum Ma- jor 3,43 All Region Choir 23 All Re- gion Band 3 Billy Mathis: VICA 41 Graphic Arts Club 4 ' Omit Mati Eddie Matlock Julie Matthews: FBLA 2, Flag- line 4: Choir 2.3.4, Handbell Choir 'J Seniorsf1o3 After Hour Literature Romance Novels Catch The Reading Eyes Of Seniors wrinkled and torn book for a couple of days now, and finally you're to the climax. You can hear the swift pounding of your heart as you bite your nailless fingers. Since mother is not calling you to do some forgotten chore, you continue to read for hours. All the heartbreak and anguish finally comes to an end as you turn to the last page. Suddenly, your eyes are filled with tears of happiness ou've been reading that and your mouth slowly begins to smile. You have just finished reading a Har- lequin romance novel or some other passionate romance novel. Romance novels give young people the opportunity to escape into another world or see what life can be like. With romance novels, visits to other parts of the world which may never be possible are within reach. They take you to far away places and let you imagine that you are in that persons placef' said sen- ior Juanita Wayson. Senior Letitia Hampton reads romance novels because they always have a happy ending and in real there are rarely any happy end- ings. So, you might as well have the satisfaction of imagining a happy end- ing. Romance novels have made their mark with today's young people as did hula-hoops and Mrs. Beasley dolls with the young people of yesteryear. Stephanie Mauidin: FBLA 25 DECA 4 Wendell Mauldin: FBLA 45 Choir 25 COE 4 Janine McAvaney: FHA 25 VICA 3,4 Mark McClain: cClelland: NHS 2,3545 Boys' State 35 not all 3,4-Man- agen Baseball 2,3,4 Justin McClelland: Key Club 2,33 Football 3,45 Youth in Govern- ment 45 Model UN 3,45 Baseball 3 Cassandra McCoy: FBLA 25 WCA 3,4-Treasurer 11,Pres. 45 Space Tournament Winner 25 Me- dia Club 2 Mike McCranie: VICA 3,4 Seila McCullough: FBLA 23,45 COE 4-Rep.5 Volleyball 3 Jamie McManigal: NHS 3,45 Band 25 Majorettes 2 Michelle Michael: NHS 35 FBLA 45 Choir 45 All Region Choir 25 French Club 2 Ricky Milburn: DECA 3,4 Qi l'm4fSen1ors Sherrxe Summers loses herself in a fantasy world of romance novels. Shelley Miller: FBLA 4g Lion- ettes 2,3,4-Rankleader 7 ' V Thalia Miller: NHS 3,4vSec,g Choir 2,3,4-Highlander Mark Milstead: NHS 2,3,4g Speech and Drama Club 3,4-Trea- surer 4g Key Club ,2,3,4-Pres. 4g Boys' State 3: English 11 Award 2 Alisa Minick: Speech and Drama Club 4g Homecoming Court 2,45 Choir 2,3,4g All Region Choir 33 Jazz Ensemble 3,4 V, Heidi Minick: NHS 2,3,4g Key Club 4: Band 29 All Region Band 2 Doug Mize: VICA 3,4-V. Pres.g Bill Monk Lisa Montgomery Tammy Moody: NHS 4g Key Club 3g Lionettes 2,3,4-Squad leader 4g Who's Who 4 Vickie Mooney: FBLA 2g FHA 2 Jame ' FBLA 3,45 Stu- ent Council 4-Repg Art 23 Alpha Beta Numa 4-Treasurer Scot Moore: FBLA 2,43 Football 2,33 FCA 3g Baseball 3,45 MADD 3 Senlorsfl55 Kevin Morgan: FBLA 4g Choir 2,31 Band 2,3g COE 4 N Jogwlllqglxnisz FHA 2, DECA 3,4 mvalantina Yoshi Daryl Mozisek: VICA 3,4-Trea- surer 45 Track 23, Class Officer 3,4-V. Pres. 3 Keree Muradian: Student Council 4-Seng Key Club 2,3,4- Rep.g Choir 23,4-Hilanderg Foot- ball '.Z,3,4g FCA 2,3,4-Pres. 4 Danny Nelms: VICA 3,4- Pres. 4, V. Pres. 3 AllenHNe,sbitt: VICA 3,45 Foot- ball 2,3,4 Juan Newburn: Environmental Awareness 35 Track 4g DECA 3 Andy Nordman: Choir 2,33 Base- ball 3,4g Lettermaxfs Club 3 : FHA 3,43 OHE- HERO 3,4 Robert Norton: Choir 2,3,4g DECA 3,4 Chris Odell: Afterthoughts 2,3 Kim Odom: Speech and Drama Club 23,43 Art Club 35 Key Club 43 Choir 23,4 Cathy Ogle: FBLA 2,3,4g Choir 2: COE 4 Dana Olive: FBLA 2, Band 2,33 DECA 41 Orchestra 2,3,4g Chris- tian Council 2,3,4-Pres. 4 John Otto Beth Owens: Flagline 43 Band 23,4-Librarian Jig Handbells 4 Ricky Owens Page Parker: VICA 3,4-Treasure er, Golf 3,45 Graphic Arts Club 3,4- 'Treasurer 'WM- is be 152' lv6!3en1ors Q Musica Persuasion We Take Our Music Very Seriously into a typical teenagers room one of the first things to catch your eye are the posters plastered on the wall displaying the resident's personal favorites such as Duran Duran, Journey, Rush, Ozzy Os- borne, or the Police. The second item would probably be the expensive stereo system. Because of these items you can safely come to the conclusion that this person takes his music very seriously. So seriously in fact, that he shows his personal preferences in music by the clothes he chooses to wear. The groups I listen to sometimes in- fluence the clothes I wear. If I see an f you have ever walked idea for an outfit I'll try to match it as close as I can, remarked senior Kara Joliff. Def Leppard, the Stray Cats, Billy Idol, and David Bowie were some of the more influential groups in clothing styles. They were all part of the British invasion that began in the 1960's with the Beatles and the Rolling Stones. Guys and girls both wore t-shirts with the British flag on it. Leather pants and accessories, usually purchased at Arma- dillo's Hands, became popular partly due to the antics of Billy Idol. David Bowie influenced the wearing of short, fitted suit jackets for guys. If I could find clothes like Boy W George, I would wear them, said Mike House, senior. Another style of clothing influenced by musical groups was the return of the 50's styles. Girls drug their fathers old suit jackets out of the closet and wore them over leotards or mini skirts after watching the Kinks on Mtv. Blue jean jackets, usually sleeveless, were worn by the Stray Cats who were also part of the 50's movement. Rock stars became the heroes in kids lives. They tried to relate to them in any and every way. The easiest way be- ing to wear clothes as similar as possible to their favorite rock star. New Wave influences Beth Lancas- ters clothing style. Seniorsfl57 George Parraultz DECA 3,4 Angela Patton: Speech and Dra- ma Club 45 Art Club 35 Choir 2,3,4C Chris Pemberton: FBLA 25 Football 2,3,45 Yearbook staff 35 Lettermen's Club 3,4 Lori Pennington: FHA 25 Key Club 3 Camella Perez: Los Amigos 23,4-V. Pres. 3,45 FBLA 3,45 COE 4-Treasurerg BOE 3-Historian Jaci Perez: Becca Petty: FBLA 2,3,4-Sec. 45 Choir 2,3,4Al-Iilander 3,4 Richie Phelan: VICA 8,4-Sec. 45 Choir 25 Baseball 2,4 Grant Phillips: NHS 2,3,45 Boys' State 35 All State Band 35 English Ill Award 35 Chemistry Award 3 Ken Phillips: VICA 3,45 Band 2 Lesha Phillips: FTA 45 FBLA 2,3,4-Parlimentarian 4 Ray Phillips: FBLA 35 FHA 2,3,45 Football 2,35 Basketball 2,35 Office Aide 2,3 Flirting is an every day occurrence at McClellan as shown by Brett Carroll and Sherri Ward. 0 I A Mike Pierce: Tennis 2,35 Mafia 4-Treasurerg Lettermarfs Club 2,3,4g FCA Richard Pigott ShgnnagLPilkintoB: FHA 2,31 OHE 2,3 Chris Pipkins: Jazz Choir 4- Drummerg Band 2,3,43 Lionette Drummer 2,3,4 Ricky Poole: Art Club 2g VICA 3,4 Chris Porter: Track 23 Golf 2,3,4 Frank Porter: VICA 33 Track 2,3,4-Letterman 2,3,4 Thomas Porter: FBLA 2, VICA 3,4AV. Pres. 4 Brian Powell: Student Council 23,4-Treasurer 43 Football 2,3,4- Letterman 3,4g FCA 2,3-V. Pres. 35 Letterman's Club 3,49 Fire Mar- shall 4 Jeff Pratte: Student Council 4- Rep, VICA 41 Choir 41 Football 23 Track 2 David Prudder Kelly Pucek: Homecoming Es- cort 23 Football 2,3,4g Track 2,3g Class Officer 4-President Body Language The Flirting Game rom across the crowded room, she sees him- the perfect guy. Suddenly, her heart begins to pound. He has spotted her, and they have achieved the most important factor in the flirting garne- eye contact. As he beginseto walk to- wards her, she panics. Oh my gosh, he's coming this way! What should I do?,' After a very rehearsed conversa- tion and an exchange of phone num- bers, he saunters away. She takes a deep breath and with a dreamy look in her eyes, she says, Oh, I think I'm in love! Flirting is more than a wink, a smile, or a shy stareg it also involved careful dressing and a cleverly rehearsed con- versation. Brian Costa said, An intrugal part of the pursuit of the girl and getting her to go out with me, is flirting. Flirting is good if you like the per- son who is flirting with you. It is terri- ble if you don't like the person who is flirting with you and you only want to be their friend. , said Beth Lancaster. For many seniors flirting seemed to be a way of life. Jeff Haslauer said, I flirt with a lot of girls. When asked why, he simply replied, Because it's fun! 15 The Finishing Touch Accessories Accent Even The Simplest Outfits flair to the most ancient outfit in your closet. They can transform an okay outfit into the Ucutest thing. They can also add the finishing touch to your newest, most up beat, out-of-this-world outfit. It is the oldest and newest fad in fashion acces- sories. Buttons in the form of a person's fa- vorite rock group, star, or actor could be seen on the majority of jacket lapels, purses, sweaters, or even shoes. Duran Duran, Styx, Def Leppard, Tom Sel- hey can add an updated leck, Elvira, and Rush were seen more than others. At a glance it was possible to see who was a person's favorite singer or actor and also what kind of music they preferred. Bandanas were also worn in a variety of ways and places as accessories. Around the waist as a belt with jeans, around the neck as a rope necklace, or wrapped around wrists, ankles, thighs, or foreheads were the popular places to wear them. I like to wear bandanas because John Taylor of Duran Duran wears them, senior LeeAnn Red stat- ed. Ties, usually associated with males, were seen just as often around the necks of many females. Leather ties, polka dotted ties, and silk ties were some of the more conservative styles. Earrings were not considered as justjewelry any- more. They were purchased with care to accompany an outfit. These striped, polka dotted, sparkling, loud earrings could be seen around campus and some considered the bearers of these earrings to have abstract earrings. Paul Purkiss: FBLA 21 Band 2,33 DECA 4 Catharine Purtle: Key Club 3,4 Steve Quick: Industrial Arts Club 2g DECA 2,3 Karen Quinn: NHS 2,3,-43 Stu- dent Council 4-Recording Sec.g Homecoming Court 43 Choir 2,3,4- 2nd V. Pres.g All Region Choir 3,4 ' Raine ' FBLA 2g FHA 2,3,4g Student ouncil 4-Reps HERO 3,4-Sec. 3,4, State Pres. 3 Diane Reagan: FBLA 4g Key Club 4, Lionettes 2,3,4-lst Lieu- tenant 4 Lee Ann Redman: FBLA 3,4, FHA 2g COE 4 Bobby Rhodes Terry Richardson: VICA 4 Wendell Richardson Roger Riley: Art Club 3,43 lndus- trial Arts Club 33 Octagon Club 43 TAG 4 . Billy Roachell: DECA 3,4 160fSeniors .SMS 1 X X af . K fe E f F. s S EXE i Showing off his collection of buttons is senior Mark Williams. xwgclub ' 51,75 ' ,Ulf Laura:?lioberts:'FBLA 3,45 FTA 43 Speech and Drama Club 33 Art Tamilfii Robeitsz Choi? 2,3-' Highlander 33 DECA 3,4 Carol Roads: FHA 3g Speech and Drama Club 33 Lionettes 4g,French , Club 2g Stude11tfCounci1 3,4-Rep. Todd Ross: Speech and Drama Club 4g Key Club 4g Choir '2,3,4-V. Pres. 215 All RegionChoir,3,4g Jazz Ensemble 4 i Yvonne Rushing: FBLA 33 Counselor Aide 2,33 Vocational Drafting 2-Treasurer 1, Rene ' .VICA 3,4-Trea-' surer 3, V. Pres. 4: Choir '3 Tammy Sakall: FBLA 2,39 Ro- deo Club 23 BOE 3 H f Tammy Salmo' ' FBLA 4g Key' u g ass fficer 2-Sec.gCOE4 K' '5 lSg,rQc,E. K'Lsx52j 2 lly fQ.A.5l'W Sen1ors!161 Jay Sanchez: Los migos 3,4g FBLA 23 Tennis 3,4 Tina Sanges: NHS 2,3,4g FBLA 43 Key Club 3,4g Choir 2,39 Youth in Government 4 Jason Sarlo Mandara Savage: FBLA 45 En- vironmental Awareness 3,4g Boys' State 3g Football 3 Tammy Sayles Tammy Schultz: NHS 3,43 FBLA 3,4g Choir 2g Kwainas Club Award 2g TAG 4 Su ' NHS 2,3,4g BLA 33 COE 3g Youth in Govern- ment 3,43 Close-Up 3 Rhonda Self: FBLA 2,3,4g Choir 2,3g Basketball 3,4-Manager Scott Sewell: VICA 3,4-Pres. 4g C oir 2,3 Robert Shipman: Tennis 3,4g Band 2,3g Lionettes 2-Drumrnerg All Region Band 3 David Short: FBLA 45 Track 25 Band 2,3-Quartermaster Rebecca Sims: Choir 2,3,4g Band 2,3,4-Sec. 3,43 All Region Choir 35 All Region B and 3 Blake Sipes: Choir 2g Football 2,33 FCA 2,3 Dianne Slack Becky Slawsonz Speech and Drama Club 43 Flagline 2,3,4-Capt. 45 Choir 2,3,4g Band 2,3,4g Drama 2,4 Rhonda Smart: NHS 2,3,4-V. Pres. 4g Girls' State 39 Band 2,3,4- Jr, Rep. 3g Majorettes 2,3,4-Capt. 45 Spanish HI Award 25 English III Award 3 Tom Smith: VICA 3,4-V. Pres. 4 triti S arks: FHA 2,3,4g Homecoming ourt 3-Basketballg Track 2,3,4g OHE 2,33 Office Aide 4 Doug Speer: Football 2,3g Track 2 Dicky Staggs: Football 4g FCA 3 1652! 1984 1 LQ? I ls It Fact OrlFictidn n January 1, 1984 in every medium of the media the question was asked, Is big brother watching you? With the be- ginning of the new year came a renewed interest in the novel 1984 written by George Orwell. Because of this renewed interest, many have misinterepreted the novel as a portrait of what America is becoming, when in reality it is a warning against the dangers of social- ism. Although many had never read the book, they understood it's meaning be- cause of it's significance to our society. The novel is set in London in the year 1984. Everyone is controlled by Big Brother. Throughout every city are enormous posters of the dicatator's face with the caption Big Brother is watch- ing youf' English is being replaced by a language called Newspeak. The lan- guage is designed to make it impossible to express or even think any idea not sanctioned by Big Brother? The novel seems to be a complete contrast to America of 1984. In the novel everyone is required to not only obey Big Broth- er , but they also love him. In America, however, there seems to be no limit to the amount of opposition against the government and the President. When asked if he thought the 1984 of 0rwell's book in any way relates to the 1984 of today, Doug Vann said he thought it did to a certain extent. He also said, It is more possible for it to occur in another country such as Rus- siag however, it may already be happen- ing in America. It is a very slow pro- cess. Basketball '12 3' Track? 2 34 DECA 4 Greg Staten Los Amigos 4' French Club 2 Terri Steele Speech and Drama Club 4-Sec. Karen Stimpson. Environmen- tal Awareness Club 3 4' Choir 2 3 4' Band 2 chi-astisixeifgger FHA4 choir book Staff, -3 Youth in Govern- ment 3 2 . Stephenie Strmgfellow FBLA 2 4' FHA 2' Track 2 3' Cheer- leaders 2 3' COE 4 Richard Styers. Football 2 3 4 Tracy Summar: Yearbook Staff 3 4-Editor 4' Paper Staff 3 4-Edi- tor 4' Governor s School 3' TAG- UCA Honors Program 4- Whos Who fp V . . 2 Y 6 5 1 7 I s Y H H I 7 sz Q 0 I , , ' ', 9 2,3,4-Scott. 2, Highlander 3,43 Year- H , E 7 ! I Y P ls: X, , 9 1 I Y 5 3 9 7 3 9 1 1 1 Y eil' 4 s ,N his Q s 'Z M we 'fi f -.latex I .K ,. , left 1 '- 'E . , . A -- Q.. -ZQ1 : - ' . -- 7 - sc -- ' . - - if . .. be X KMA? Sw,-3 s gg 'f-is ,xg ft X 'kg to W mefrfme ss- Q, Q R is s Reading George Orwell's 1984 is Casey Whitt. 1984! 163 .Vollerbelli L - p L. L 0E'4j fo 3re11clrAC1ubL'2'IBOE '3:HiS5,A - L 'TQi1ivT4Y19s1'fLStUfie15ticsllfmili3? LL Brow ag Blues Even Seniors Have To Bring Their Lunch Sometimes hether it has a peanut but- ter and jelly sandwich in it Viii W iiiii fWs or a bag of Doritos, or even a piece of last nght's apple pie, it all means the same thing- someone is brown bagging. Some students were forced to choose between three choices for lunch: eating in the cafeteria, leav- 1S1isi1ffQSd1fimiers:t AFBLA 435S1:u5 ifuie Q Clfiflf cise C5'11'fGi11R?2i1QfY2:f'SP6E1?h 'DramafC1uLbsL4fv .stc' P res,L2gfAikansaa iesc J Reperafvrys sfheasers -C1aSSfV2,35 I Choir2,3,4-Vi l'oi Prem? i Ls ' i L L Rennie ieci summons L c L g Beverly Sweeney:-FTA 43 FBLAAL L L p L I L i Scott Talley: Choir 2,3,4g AlliRe- i .gion Choiri2 L L L ' - L Denise Tart:-,FBLA 2g.fDEcA 45 'ra s1L 'AFBLAL 12gS,4s rL.p 1' 5 . g- . 23129-? EKG? Ls Cliibir 3 y.Ch0iIf 2 3 45 Liiinettesf Qsaenanigieaaafs , 3 L lgaptgqikgw LVLL ig pLLgpJlpLApp iff, 1 gs .Michael L'1T11Om8S iFBLAfs .2 Sf iBrjysLsi1State-Q 4?'Q1Basketbaii Li 2 354 TfaCkie2cL3AiLLFCAL231 - , Even a Garfield bag cannot take away the brown bag blues as shown by Katherine Purtle and Mi- chelle Leggett. 164fBrown Bag Blues ing campus and going out to eat, or bringing their own lunch. Michelle Leg- gett and Catherine Purtle said, They would rather eat out of a bag than to eat the cafeteria food. Most seniors chose to eat off campus or buy their lunch in the cafeteria. For others, however, buying lunch was too expensive and they were forced to brown bag it. At times bringing a brown bag was embarrassing, such as when your moth- er put something really strange in your lunch or left little notes in the lunch sack. Although it was embarrassing for some it was economical for others. Q 1 W 5 ffl' Doug Thompson: Choir 2,3,4g DECA 2,4 Suzanne Todd: FHA 2,3,4-Trea- surer 25 OHE 3,42 HERO 3,4 John Tolbert: Key Club 43 Foot- ball 45 FCA 4 Paul Tollett Suzafdrvi. Lddij 'Suzy Qudy flfreat: FBLA 4 Jerry Trdtfer: FBLA 4g VICA 3,4g Football 1,2,3,4: FCA 2,4 Michelle Tucker: Band 2,3,4 Terry Turner Linda Twidwell: FBLA 35 Speech and Drama Club 43 Orches- tra 2,3,4g All Region Orchestra 3 Gary Vaden Dong Vann: NHS 2,3,4-Pres, 4g Boys' State 35 Graduating Usher 3g General Business Award 25 Alge- bra II Award 2g Analysis Award 3 Sandra Voss: FBLA 2,3,4g Stu- dent Council 4-Rep.g Choir 2,3 COE 4-Treasurerg Youth in Gov- ernment 4 Michelle Waddell: FBLA 45 Stu- dent Council 3-Rep.g Lionettes 2,3- Rankleader 39 COE 4-V. Pres. Gladys Wade: Student Council 43 OHE 2 James Walker: Choir 2,3 Bobbi Walters: Band 3,4g All Region Band 35 French Club 2,3-V. Pres. 33 All Region Orchestra 2,3,4g Orchestra 2,8,4 -,Kathy Walters: FHA 4g After- thoughts 4-Press HERO 2,3,4g Of- fice Aide 3,4 Steve Walton: Art Club 2,3,4g VICA 3,4-Pres. 45 Mafia 43 AYAA 2,3,4 Bret Wampler Sherri Ward: Speech and Drama Club 49 Choir 2,3,4g Cheerleaders 25 Lionettes 35 FCA 2 Brown Bag Bluesf165 H n Rarely- If-'atal Senioritis Disease Strikes Again enioritis is a disease that is experienced by many and is the kind of disease you have fun with ' commented senior Brian Powell. , Senioritis is rarely a fatal disease, but it can lead to serious complications when parents see that final report. According to Alan Cozart, senioritis is an excuse when Mr. Ford calls you into his office for skipping. As the weather gets warmer, many seniors found it harder to make that seemingly long trip to school. Most agreed with Beth Lancaster when she said, It's kind of hard to go to school when it starts getting closer to the end of the year and most of us have the problem with senioritisf' Many afternoons were spent at the l I horse races or watching All My Chil- dren instead of going to afternoon classes. Instead of doing homework, the evenings were often spent at the movies or cruising Geyer Springs. Although having senioritis can be a lot of fun, Your senior year is no time to fool around because you need to plan your future, said Jeff Haslauer, senior. - 1 1 l 166fSen1oritis 1 A ..,, r' if Q sn .. filsfs ,QV VJ Qatxl r 5 'X 1 Delena Williams: FBLA 23 VICA 3,43 Library Aide 2 Kevin Williams: Art Club 33 VICA 43 Track 4g Octagon Club 2,3,43 Afterthoughts 2 Mark Williams: FBLA 43 Base- ball 43 French Club 4 Robin Williams: Los Amigos 33 NHS 2 fC - Kbloqd Lo U25 ZSQQF Roma Williams: VICA 3,4Q Foot- ball 2,3,4g Track 2,3,4g FCA 4g Graphic Arts club 4-V. Pres. Troi Williet: FBLA 23 FHA 23 Track 43 OHE 4 Pamela Wilson: FBLA 2,3,4-Re- porter 4g Student Council 3,4-Rep.3 Recognition Award for FBLA at UCA 3 Joseph Winfrey Pam Wise: FBLA 2,3,4Q VICA 3 Hob Wood: NHS 2,3,4Q FBLA 2,43 Boys' State 33 Soccer Club 2,4g Governor's School 3 Randy Woodallz Art Club 2,33 Key Club 33 Track 2-Cross Coun- try Dale Wright Michelle Wright: DECA 3,4- Pres. 4 Vickie Wyse Jack Young: Student Council 2- Rep.g Industrial Arts Club 23 VICA 43 ICT 4 Marylyn Zimmerebner: FBLA 3,43 FHA 3,4-Executive council member: Speech and Drama Club 2 Marla Beggs: NHS 2,3,43 Flag- line 43 All State Band 3,41 Band 2,3,4-Master Sargeant 43 All Re- gion Band 3,4 Knot shownl Senlorltls created an early skip day for some students who spent a day at Pinnacle Moutain, such as senior Lewis Moore Senior1t1sf167 Enjoying pizza and Music Television at Mr. Gatti's are juniors Melanie Chandler, Cheryl Fisher, and Keith Hinson. With a unified shout of support, the jus niors pulled for their team in Almost Any- thing Goes. fl.-1.x xg L-3-if ff ik ii' 4 M32 an A 1 'S win A Of' W all 4' we 5' . iq Ez 168!Junior Profile C m uniors were in the big time. Leaving most sophomoric pres- sures behind and disreguarding the confusion of the seniors, who were facing future decision, the juniors could get down to the business at hand . . . LOOKING FOR ACTION! So what was action, and Where was it found? Action is being with good friends at Wendy,s after a ballgamef' SQ Q. .N .., wi said Chris Minick. Juniors even found action right on campus. They became involved in activities such as Key Club, Student Council, and prom committee. They took part in the traditional Almost Anything Goes, placing second. Some juniors did not have to look far for action. Action was right in their livingrooms with Music Televi- swim 1. . .. Q . . if in--4 ompeting in the Tug-of-War event in Al- ost Anything Goes is junior Keith Thompson. sion, cable, and Atari. With a flip of the switch, they could watch their favorite video, or movie, or shoot la- sers at the enemy fleet. Sophomores spent most of the year adjusting to their new surroundings, while the seniors were mostly con- cerned with their futures. So without a car, the juniors were the only ones left to look for action. Junior Officers: Vice President, Cindy Mote, Treasurer, Kim Davis, President, Matt Ket- chamg and Secretary, Amy Roper. .Tnninr I D,-,.f':l.,l1 no I 17O!Juniors Trela Adams Bill Adcock Kelli Agnew Buddy Alexander Glenda Alen Lynn Armstrong Harold Atkins Darling Bagly Kenneth Ball A Agni Ballard Patrick Banks Joey Bardouche Donna Berry Jay Baxter Robert Beard Lezley Bearden Lonnie Bess Yvette Betterton Shiela Bland Monte Blue Marvin Bonney Shelly Booth Angela Bowerman Jonnie Boyd Dan Branigon Joey Brannon Jim Bransford Steve Bratton Kevin Breeding Ezell Breedlove Danielle Broadway Bobbi Brooks Alfred Brown Kathy Brown Jerry Browning W? 'S-nd Qx 'A .1 l,, frff Danny Cowart displays his MTV T-shirt. Many juniors can be seen wearing this type of MTV fashion. Looking at a current Motley Crue tape are J Clark and Brady Diggs. Motley Crue is a popular hard rock group whose video's appear on MTV regulary. ,A K :Roek- -Roll- -Videos hat was once music to the ears is now music to the eyes, thanks to Music Television or MTV. The hottest music craze sweeping the na- tion. MTV is a 24-hour a day video sta- tion. It plays various videos such as Def leppard's Photograph,', Lionel Ritchieis All Night Long, Quiet Ri- ot's Bang Your Head, and Michael Jackson's Beat It. Besides featuring professional artists, MTV also intro- duces newcomers such as Men With- out Hats and INXS. Videos have become the hottest new art form and are the newest exper- ience in looking for action. HI listen to MTV even while I'm doing my home- work,', said Kim Davis. MTV doesnit stop when the televi- sion is turned off. Juniors are wearing MTV fashion apparel. Many students MTV Creates A Music Revolution try to dress like their favorite video star. For instance, juniors can be found wearing a British flag shirt, which is what Def Leppard's drummer Rick Allen wears in most of the group's videos. Juniors are purchasing records and tapes which they hear on MTV. I first saw Motley Crue on MTV, the next day I went and bought their tape,'i said J Clark. Many juniors find themselves plan- ning their scheduals around MTV. Brady Diggs said, Some friends and I left Geyer Springs at 10:00 at night on a Saturday to go watch Ozzy Osborne in concert. Brady cotinued to say he watches MTV up to three hours a day. Besides featuring videos of popular singers or groups, MTV also features Liner Notes, and Fast Forward, which are interview programs of popu- lar video artist. MTV also features concerts and competitions between two videos which is known as Friday Night Video Fights. The watcher calls in and votes for his favorite vid- eo. MTV has become a favorite pastime for most juniors. I sometimes get a few people to come over and we sit around and watch MTV,,' said Danny Cowart. After all, MTV is just one more way for a junior to look for ac- tion. Jun1ors!171 Even while sitting on the bench, Tylous Jones and Jay Hampson gives the support necessary to win a game. eyond The Bell- One of John Mcmillan's favorite after Junlors Flnd A hour activity is attending basketball games. Variety After Annette Scoggins spends most of her HOUI' Activities after hours practicing basketball. ctivities that follow the 3:30 bell range anywhere from football practice to ballet lessons. Whether home- work is finished or not, parties, ball- games, movies and just watching televi- sion were a variety of activities for most juniors. Many juniors spent their evenings at Wendy's. Not only the restuarant, but the parking lot provided action as well. The action outdoors could be anything from sitting on cars to throwing eggs, regardless of legality. Watching television seemed to be an- other favorite after hour activity. Sean Galloway said, When I get home from school ljust like to lay back and watch TV. Some of the afternoon favorites were oldies such as 4'Andy Griffethf' UWKRPQ' and Eight is Enough? When the weekend arrived parties became the most popular activity. I like parties because it's a change from the same old routine. said Cheryl Fish- er. A party could be held anywhere from an open field to a parentless home. Where a party was held juniors were sure to be a part of it. Whether the juniors spent their after hours at parties, Wendy's, or just watching television, each activity was just a part of looking for action. -is Steve Buck Kelly Bryan Greg Burchfield Barry Burroughs Howard Cameron Chris Campbell Scott Campbell Kristi Cantwell Jimmy Capoot Mary Cathcart Melanie Chandler Haley Chapman Steve Charles Wendy Childers Donnie Chism Joey Clanton J Clark Brent Coffee Patricia Cockren Pam Coffman Rhonda Cowert Michelle Coleman Kim Comic Jon Coon Greg Corley Danny Cowart Brent Cox Lisa Crockett Stacy Crump Laura Cummings im C rrier Sharon avidson Debbie Darracott Tawa Dancy Dawn Daniel Juniors!173 I K9 Kim Davis Denice Deel Lynda Dickey Betty Dillard Vera Dotson Lorene Dovers .111- 'lillurry Draper Tammy Dunbar Chris Dunkam Gina Dunlap Gary Dunn Michelle DuPree Sean Durham Vickie Durham DaRon Duer Darla East Sandy Favre V M QJ xiii 5Melinda Edwards X. u if , Kim Elkins DDD X ffitnavid Ellis' sXa9'- xx A f l 1 1' r fgrdi Jackie Ellis Carol Eslick Sharon Ester Cheryl Fisher C. Ann Fleming Renee Flowers Kerrie Folsome James Foreman onna French Jeff Frost Natalie Fuller Scott Fuller Sean Galloway Dewayne Gann Tavio Garrison 'Q' 3 'HKS :C+ J Q f Xl If A s 'ICS L3 .-- , -S ' 1'I4!Juniors r-li st , Wesley Garrett ii Anna Gibson Jill Gibson Alfreda Gordan Gloria Fray is ii r ork 4 Letter Word weekend much of their time was spent working. - s juniors prepared for the But Most Juniors Realize Cash Is Too. For most juniors a job meant extra spending money or may- be even a car. A job requires responsibility. A per- son must be willing to give his all and that includes being able to make a few personal sacrafices. Having a job is great. But working on weekends I could do with out, said Scott Ket- chum. Scott went on to say that work- ing at Safeway gave him a sense of being independent. Most juniors worked at fast food places such as Wendy's, Arby's and CaptainD's. Many other juniors worked at clothing stores. I like vs Wins s X s . working at The Ranch because I meet lots of different people, said Jill Gip- son. Most juniors used their money for clothes, while others went to the mov- ies and saw such films as Risky Busi- ness,', and 'KFlashdance . Some ju- niors spent their money on concerts such as Loverboy, Quite Riot, or the Gap Band. Even though work was a four letter word for some, many juniors found that work provided the money that was needed to look for action. t to r if Q is April Verver keeps busy making sand- wiches at Wer1dy's. While working at Safeway, sacking gro- ceries is one ofthe various jobs in which Scott Ketchum has to perform. X Juniorsf175 Debbie Gipson Kim Gregg- Kelly Hall . Paige Hallford Sylvia Hambrick Jay Hampson Barbara Hart Robert Hartwick Sonya Haskins Larry Hatfield Jimmy Heathcoat Will Heatherly Chad Hefton Cheryl Heifer Laureen Henderson Marcena Hendrix Sheila Henderson Kelly Hendrixson Shelly Hinson Angela Hill Tena Hill. Keith Hinson Tina Hinson Sonya Hoesh Keith Holden Bobbi Holleman Mike Hubbard ' Ivy Huffman Charles Hu ins Cynthia omas Mark lngram Paul Isbell Lee Ann Jackson Micheal Jackson Teresa Jarrett Q- I A , 7 V l W Ml, is Www -K i J K ' ' 'U 131337 K w ' W 1'-ziimaif5gg,ezWz1,,,t.'-gzzwtarlttffgzwggttg,wg 1 ' K A i 1 ' , ' Igiij, Wzfk-EYE? in H. ' ' gzf' Q' it , ff if:afwgtxigw-qtwizsigzmia5 1 ff 3, ww- ffwzz-Mgsfwgemziiigwgfifmwgg it E Q Q if s we -Sam Slgfziiim' ' hx.. Vickey Jarrett Chris Johnson Lance Johnson Keith Johnson Ross Johnston James Jones Tylas Jones LaTresa Jackson Mike Keith Malous Kelly ettlng P YSICH Juniors Become Active In Physical Fitness any juniors began getting physical, that is, taking part in the fit- ness crave that hit the nation. Whether it was jogging or dancing the night away most all juniors were involved in some sort of physical activity. Mostjuniors took part in physical fit- ness for the mental and physical bene- fits, while others do it for mere plea- sure. Cindy Mote, for instance, spends her after school hours at Jim Botines John McMillen stays in good physical condi- tion by running. Nautalis. I usually work out on weights for an hour then I take a swim in the pool, said Cindy. Many juniors exercise because they have to. It's a must to stay in good physical condition if you want to play football, said Matt Ketchum. Whatever the reasons for getting physical, juniors found it was away to stay in top condition and to feel better about themselves and other. 178fJuniors Trisha Kemp Marty Kennedy Lisa Kerr Matt Ketcham Scott Ketcham Karen Kimbrough Arnard King Karmen Kirk Tim Kling Mike Lamazoff Greg Lamb Michelle Landrum Kim Lanier Lisa Lauderdale Laura Lavender Archie Lester Evan Lewis Chuck Lody Tim Lucas Bill Edford CVp, Maddox T:Tamie Manley Buddy Maudry Robert Marsh Mike Marshall Chad Martin Deidra Martin Cynthia Mason Monica Mason Dana Matthews Betty Maulden Stan May Tina Maynard Bobby McBrier P.J. McClure fi, f W.-wg QV as X x X ,L iQ rw Tonya McConnell Kellye McDowal Gary McElroy Gary McFadden John MacFarland John McGuiness Debbie McGuire John McMillin Mike McMabbe Shari Melton - e Secret-Behind The M-eow' arfield is a cute witty, over- stuffed, bug-eyed cat created by Jim Davis. Garfield has hit the depart- ment stores like a fierce lion al- though he is terrified of mice. What makes Garfield so popular? Jim Davis portrays very human like characteristics through Garfield. I mean I know people who are just like that cat, said Debbie Darracott. I guess what really makes me like him is because he is so cute,', Debbie Sink YQ Garfield Becomes A Huge Success Among Many Juniors continued. She said that she has a wide assortment of Garfield pro- ducts, including a Garfield tooth- brush. QS . I it . - 'I we-. .. - rg. of 1. ..k. X Garfield originated from the comic strip, which now appears daily in the Arkansas Democrat. Whatever the secret behind the meow may be, one thing for sure, Garfield is a hit among cat lovers and non-cat lovers alike. gal XT f A-, N.. 1 3,2 r if 4 . fwfr, ,,-,fum xv: .,, .:- M ,vw , 'wr' W , f A 4. 6 'km ' af M ' fff if , Catching up on the antics of her favorite cat is Yvonne Wright. Debbie Darracott's room contains a wide assortment of Garfield products. Y, 7 if W7 'wa A ,Q 1 L ff 1 J ,mf ff K? I Q. 'C ,, 'M 4 1 ff ' aw- , ZW W , MW 1 1 4 9 1 5 ff? 4' 4 'W g M af 7 ' li!Ef LfNH'v 'f' r Lf ' M, 4 A W 'f I' I79! J un iors X si Cie X ., L , I r W 59 7 O9 I 18OfJuniors FT K' f Q Conlee Melvin K 'Fish Mevx X Miihelle Mezes O CWS Minick gyhonda Mink Mitch Mitchell Pat Mitchell Ricky Mitchell Paul Mordecal Mark Morehead tx L, Mike Morehead f Shannon Morgan V Greg Moring i Richard Mo e y David Mosizek Cindy Mote Maxi Mugaluma Ron Mullins Laura Nearn Bill Nelson James Newton Mike Nichols Kim Niel Matthew Nong Sherri Norton John Nutt Liota Otom Shawn Olive Sammie Osborn Vicki Owens Chris Patterson Cari Perciful Kim Perkins Carl Phillips -lanean Polenski PIA X 2 w 'arm P fling:.tUs:P1fWMsimf.:U.w.nwissimiwiaibmizwwflmswgsmUsg2gemitsWiitwszzrsiiwiisggiiifsifrwfrrrrriieggelisasgiiqwrggfl:ni A w:11.1kc wwzrM1,:aw mf2'i Siwfiimweiiiz Wikiat.W:wMZ241w:U Aww itmiwriwsmf 351244 .mwitlzwirw meg-rim its meh 0 so W ugwwwew LM-w5i,,3 qm,3-Wmtgifggi gagmwwwggqsggwwwi.aggrywrgmgvgg 3t,3QetaM,WeGg,,,f3ws,ei-rm,,itq,9,s'1Wesg.swfg.wx. I Witizwffrwzi w if smzwirmmgmgwmammaewtxmeifwtwwibmw ..fa,.ig,m,,i.1f.g n.s.i,1.nfb-i r X wwmgbmivgtwUqhihsrg,iwwqletirzv-we m.,ti2gM,tmmf1 Mwiwmtwziei v U, L Vggm- ..-.fm - awww irt3gg,.Wsia Miigggfggifp eiaitrgqg Wg mfgggg, beg, w .wmwiwfgximzwgg NWS Y ' up 2 f L Q, Q i r .it swvltsztfeg, M.rlwgtgirwguylilzwe, H21 Wai tam? 'iiwgefwgcwwffifztwswU32 iii was WMM 1-'iiwfiixwf-iii Q 2:22 fain: rgiszmww :Mi wilirwaezieWEQWE wgmiwfijr ifwiigggim- David Powell Christi Powell Tony Puckett Becky Pile Chuck Rain Michelle Rainey Richie Rainwater Karen Ratcliff Kerry Reaves Terri Red eeplng The Falth any Juniors became ID volved in re11g1ous activities outside of church and school One such group was Young Life Young Life IS a non denomlna tional organization especially for teens, Sald Michelle Coleman Junlors Become Actlve In Young Life Young Life was held at a students house on Thursday nights Most meetings included rap ses sions, singing, and a b1t of serious talklng One of the hlgh polnts of the year was the annual sk1 trip to Mon arch, Colorado Young Life was another activlty which kept Juniors in the action It provided a chance to learn about Christ and a chance to meet new peo ple all in one sf www, wreck-N24 we-'Eta t www mx New swf 'swift 'H New reamsitiyzsivipggiarzr mygilmiamiwinetiziiirgzsaiiiifiisiiiiizmfL ,M sem t gtg .M U W m..,n,r Q U Q, r,..,,,1.g,.nW.i.iWf1wi. 45 A ww' mf 2 r w w sw - .Fr Q kfgiaimgggziis3-mgiliggibw 151 mi are 552221 if-2 Wag: Q Ei: grim 2 S2 :zz i may .am is maygzzlfimziaimtriilia ,333i.lt5gggii..,mr.i..t, szgfqgfiiwriizzikfaisz Z was 5ge,,w,5:wzK'f r 1 Q W ge it, is W , Z err' l Y 32232111 5122212333111 if 1 P3235 ' tif' i M Z if is 1 i Q Q 1 Us .. i 1111514 gf is 45312257 wezsiwgu lfiizsmgimi 32552151 iblhfiliiil? 'sir w M 4 I-frfgjiglniqe. ,mi iiVSSz'i'r1i3iW Mollie, zlswggiprrhmg ,Q-3322394 U lgmwiaznwgtmifz fb sz, waz :REM if Merwemisigg maze Wm iwisia swims, , 4, .ig this Meister like Matin vii' ww 45 152552 fre :iii me rgiiizim . my gga2l23iLsim2gg,s iiitkiifsii. i gg U at .n3,We3q:' 3 Miszziggfggwgi- v U M-stanza Five eww Jiri nismmwf 3 wziaisiwzimzwzrirsw: si. iiffiiififxQiiwiiifzigrmY Wzilam zf:eJss'3sW,:v ewawf: izmtriirsrwi ,ami 4 it rggfswaeiwtt. :'1Wis2i:ww:iw.::: ii wgireitviiwzt. Mex Manish el was w ma aims Hi ess-what .sg me NWN wearer we it -'rraimarseiieasisias 3 Shelly Booth listens attentively to a Young Life speaker. Participating in an ice breaker are Laureen Henderson and Melanie Chandler. .,N1ari1f2Z1t 4- A111 :ii sl we lwaiailitfmg E 5:1 ..-me i::,wg..1- wsitfnzv-, Wm -,Q nw Mm i,f,1-Us snow eww ti bww ride at 2 -'5---H1.2---A'5'1rfe 'il,,.:a1sM.f'f1w..zfz1r1.x:nEb wigiw:z:w1.wsM s.nwswws.r : we Uiwnzsse t. ifA,,rfggzhz.iwgei,ga'.a.fmwzizmwzkmewwwwaazfzgiwirlzfffwtiirr 5 rg Wiiimrwizi 71, , .1-Nr-IGIi1AVimaimsfiZ7rmt,we1zsv:2i.r.it w:g.sg,w:1a tmmziraas 4 , aware-as anim 1 Eff :imm'z1:.:1ffa-sxzzzzimwrfrlfiziziin'wi-wizip.aiifhqisgfiiwziiws M iifgikm' ,M ., h .,ti, Q NZ MZ., .Vi. AV .t,, k,,i izmcw. wt. 1 M , Mzfrllifm... A r Q 2 anim Ne.fwmzszmgmsm. r I me 11'tsegimsgswfgzswsrwgliis, 5 ,. ,U SW r s iIwzawszzaiwizsimifwfazg 2 1 ' -22ma:fsa:,asffefsfzfzisisimii W l H l 2 Sflftdgimorsfzizia Q f Q iiifiwzrzialiwfifTZZZEZEXQQQZELHT' 1 ffmgi, .al mlm ...i ,nukes 1 3 M 3 f a Danita Reed Laura Reynolds Lori Ritter Marietta Ridge Derrick Robinson James Rogers Missy Rogers Amy Roper Brent Rose Jerry Russel lames Shienk Annette cogin Mike Seymour Joy Shanley Buzzy Sawyer Carey Sharp Jeff Sharp Kim Sharp Jim Shell Marilyn Shelton Kenny Shipman Donna Senatt Shiela Sisson Ray Smith Vincent Smith Glenn Sonk Karl Sorrels Greg Spann Ronnie Standrige Dennise Stafford Jay Stanton Ky Stephens Chuck Stewart Keith Strange Kenneth Strange 182!Juniors 4'-Fi! -1,5 L is Stacy Suitor Jay Summerlin David Summers Karen Swaims Curtis Swain Robbie Turley Lana Taylor Nick Taylor ,Llulie Terry Otis Terry ust Lay Back n-d Relax elax- v. to slackeng make less tense. When Webster came up with this defini- tion, he knew exactly what he was talking about. After all with- out a little relaxation juniors could not have the energy necessary to look for action. Relaxing' GMES Tired Minds And Bodies A -Rest So how do most juniors relax? I usually sleep to 12:30 on Saturday mornings. This helps me get pre- pared for Saturday highesf' said Mitch Mitchell. With the pressure of homework and busy scheduals, there comes a time when a person must just lay back and relax. When it came to this, juniors had no problems or com- plaints. Bib--A ' s'.. .. ,K Shelley Hinsen takes a break from doing her annual staff work. One way that Cynthia Thomas relaxes is by reading a good book. I Juniorsf182 rs4!Juniofs1 J Debra Thomas Stuart Thomas Keith Thompson Chris Thorton Earnest Tillman Julie Tipton Vuong Tran Jeff Travis Reginald Travis Traci Travis Sandra Tuggle Jeff VanPelt Kathy Venable April Verver John Vinson Larry Vint Amanda Waddell Pamela White Sandi White Bruce Waldrop Cindy Walker Toni Westbrook E Robin Walker Tracye Ward Trisha Warren Sahron Wasson Doug Weatherly DeWayne White Micheal White Derrick Williams Jimmy Williams Laurie Williams Jeannie Wise Kenneth Withers 3mwAs,.a. James Wolfe Peggy Wooley Tommy Wright Yvonne Wright Betty Young Mark Yount Tina Reeves Crystal Dyke oncerts: A Change 0f Pace niors with a welcome change from their regular schedules. Juniors found that action at concerts was quite different from that of Geyer Springs, movies, or Wendy's. When a good concert comes to Little Rock, I'll be theref' said Evonne Wright. This change provided juniors with excitement and a chance to hear a live performance of their favorite group. A variety of concerts-from country western to hard rock-came to Little oncerts provided many ju- Juniors Take Part In A Welcomed Change Rock: Loverboy, Van Halen, Quiet Riot, Lionel Richie, The Gap Band, Hank Williams Jr., and The Oak Ridge Boys. Tickets to these events cost any- where from 5510 to 3515 and when it came to finding the money juniors came up with a variety of ways. Some of these ways included saving all extra lunch money, begging parents for some extra cash, or borrowing from a friend. Concerts not only provided enter- tainment but also momentos of the ffr ,ei M I f Q night's experience. Groups sold but- tons, shirts, caps, and posters. Even though they are pretty expensive, I try to get a T-shirt at all concerts, said Missy Rogers. Concerts were a chance to take part in something differnt. Whether the ju- niors preferred country, soul, or heavy metal, concerts allowed them to ex- perience a change of pace in looking for action. Rosemary Herbert and Jeff Sharp talk about last nights Van Halen concert. Buying his Black Sabbath ticket at Dis- count Records is Greg Morring. . c 1 ' L' Jun1ors!185 21 15 gage, we-rg V- Q fi if 11, . 1 , V' - - , .- , f K , K, ,,., f:5:-fj,- Q 1 '5 X-in zkliaj'-'KM ,f S. K ' ,- .ey X. -wiki n fy! f QM .i .1 X -west: vig Rafi ' LM: ' we ' 'ii'-f if 54 33 - ' ' A f f vi 1, Y if Helping sophomores Freddie McMillian and Bruce Sweeny, Coach Keith Browning points the way to their first period class. I -,-q- my F1 1-eq--1 ,n Y 11 Ill lgafsophqmgregngmfileii.if' ' 1 1 in 2 fi' ' A - P 5 I Keith Lyle, sophomore, keeps the score for his team at Almost Anything Goes. Sophomore Class Officers: Greg Moore, Presidentg Sona Muradian, Secretaryg Barry Wells, Vice-Presidentg and Brenna Johnston, treasurer. 'B are A r E ' 3 A ,Wh .V f ' 2 2 mfg ' Fitting I Chir12:22sfaE2f.e .Y - an 1 - V essex ..-ewmfrs.V,.,1!iw.Q.smmpmwmufazss.we-.e.anm.F-wee-5-41--Qfffzf-K.ffvif- --Y nf- :ofa-aafizeaq-,Ff--1-V,:.:a?fs--2-.us2:2-- ,f-.,-'-- -' 1111-fig ---Q.-,-1,---1-4,-51:5-2' :: ---af' --- We-, - - ---e Ae-9-,,'-ef-L1+f1-vangfzzt F mwtm-awww-nl. MWummmAwmawwmfmmwmrwfmmwmwwwmumfwa uQf4wM!fuuwuw.L,z.: w-gga:,s-nuuw.ew muw-w-f1L-g-gmmmnwmg!g1-sm-m-enw---- N--w--MH-1- 5-wyaxfffg--vie?-is-wwf----:J-Q-:ff-I-M--2--N-11-,L-nm: he worst thing about being a sophomore is being asked 'What is the worst thing about being a sophomore. ' replied Dan Sammons, sophomore. This may be the greatest worry for Dan, but many other sophomores worry about how they will explain to their parents that they wrecked the car or why they were two and a half hours late last night. Now that they are in high school, more is expected of students by their teachers, parents, and peers. They are now able to drive, date, and are given more freedom to make their own decisions. Although this may sound wonderful, when they have to face the results of making the wrong decision they regret it and wish someone was still there to tell them what to do. Fitting in can also be a big problem l for sophomores. Last year in junior high they were considered Big Peo- ple on Campusv only to come here and start all over at the bottom. In order to fit in sophomores worry about everything from what to wear to what people will think of their Smurf folders. All this responsibility leads to con- fusion, depression, and looking for- ward to being a junior. Drivin : It Worth The Wait? Some Sophomores Say N . oday, driving is one of the fastest, most convenient, and easiest ways for man to travel. But, to most teenagers driving becomes more than just a means of transportation. To them driving is an adventure, challenge, and a step into the freedom of the adult world. Any eager 15 year old wishing to en- ter the adult World will probably say that the best thing about being 16 is being able to drive. There is nothing better than being able to cruise Geyer Springs behind the wheel instead of sit- ting in the passenger's side. One good thing about being able to drive is being able to go out more,', said sophomore Jeff Harrison. Kim Taylor, sophomore, agreed in saying, I canit Wait to drive because I'll have more freedom. But is driving all it's cracked up to be? It's great, except when 42 people want to ride home with you at the same time, replied sophomore Barry Wells. Driving also presents other obstacles, such as, mailboxes, other cars, people, small animals, young children, and bi- cycles. The tragedy of having a Wreck leaves one broke, grounded, and keenly depressed. So with all things considered, maybe the bus isnlt so bad. his fb 'if M1 Unable to drive sophomore De Ann Cartrand gets a ride home with Junior Cindy Mote. if-ggf fs! 1 at S r 'ww RIN 19OfSophomoreS 1 S ., ...., . . .. , 1,i1: .,:.,..1:E ,:5.: zfzs E5. fivz IE. .5 Ii, f:iis512225ii.Q: 2.E.,.. .,,E..Q 2,,.:,1,.::::. g Being the first sophomore member of the yearbook staff is pressure enough for Brenna Johnston. amen We ... f WW! Sophomore-zsf191 sf s A QT 'iiggotx I' 5 as XQQQS l92!Sophomores CJD QQ A 5 ... 'S f, .ei 5 Q A K l I What Does Dating . . D af t : Mean For Today's Kids? hen Johnny started ele- mentary school he came home everyday and told his mother how he hated girls and would never get married. As he entered junior high his attitude changed a little. He would at least talk to girls. But he would still occasionally call them stupid. By the time he was a sophomore he would begin calling girls on the phone. Then it happened! He asked a girl for a date. Today, dating is one of American teenager's favorite activities. Dating has become a regular part of teenagers' lives. For some teenagers it is important to have a boyfriend or girlfriend at school. For others it's not so important. It's not a necessity. If you find some- one you really like, fine, said sopho- more Danna Miller. So when the devoted bachelors of ele- mentary school become sophomores, Look Out! NAP provides a time for sophomore Dana Miller and senior Dicky Staggs to read the daily paper. Sophomores!193 ---.J4 -...... Qu:- ....T.. Wearing the latest in casual wear, sophomores Joe Griffin and Don Luzader find time to talk M0,,,..,... before first period. I 1 'V , ,. .,,. . - Q , . Y Vw fu wlhirarkctmb. x my fm A M' x' rf,' V W? 'QL , in Hn f 'fl' 1 I I mr ms M' i:Ei:Ezsareifzsgiszsf-2--2-' Y M B f E -1-'mm 2,1 .:.:. 5 ,,,,,, H :.. . A WE u uu u ,,,, W ww ..::. :,:ra . . Va ...... M ......,. llzuqzlz 1, in Ez ,..,.,., -5. .... mi WM .M-W-M mg w--N----W'--M .,.,. T M T '--- '- W MWE Mmmagif 5 K 5 .,.. W F W ....... W , W- ,mam-W im ,,,. E . - W N NT ,,.,.,,ri,,i.i L E M mm M1 'V e w, 'W ,,..,e M ----- . .,., ,.... 2 M 'WMw m ?'fWWM ' -- .:.: ::::1-w:::l1s2z.2s.-E-5 EEQISIEI' ME, , I-,,:,:.:::.:.::.L5..:.E:.,.,.:.,,:..: ,,.......... .. W ---- f - -'----- -- 2 .. , NH ., f:,f-Eiiigzifigzi PIGDDIGSZ Are They Still Izods, Polos, And Calvin Kliens? n the past a prep', was someone who wore a lzod, Calvin Kleins, and topsiders everyday. Now, it doesn't matter what kind of shirt you wear as long as you wear four at the same time. Changes have also taken place in shoe styles. Instead of everyone wearing tennis shoes with a swoosh on the side, some students prefer Vans , which look somewhat like a distorted Checkerboard. Nevertheless Nikes still remain the Big Shoes on Campusfl Even though fashion may change, Preppies will always be around. They may not always wear a Polo, and penny loafers, but they will always be in style. 5. -wa' My vw 4, wi g .Q ,Sai Q, ff 1 ' ' .s QQ! is cg' FN CDLDYX r-gf f Q l96fS0phomoreS J V GJ '19 fb-f if , '::'.S.-?-:--:..:.-:1 5 V-2--' .ra5-5f?f- -- f . 5 f::..:.E:'2-::--- :: ,-1: -. I. ' ' fm E Sophomoresf197 Is Big Brother Ur Sisterb Watching You? h, aren't you Mary's little sis- ter? Anyone who has an older brother or sister has heard these words many times over. The situation can be even worse when your older brother or sister attends the same school as you. Having an older brother or sister can be a blessing as well as a curse. A bless- ing can be having a dependable ride home when your only 15 and you live 6 miles from the school. A curse can come when you get home and your brother tells your mother that you skipped 2nd period. You begin to wish you were still at school waiting on the bus. Along with the cherished possesion of an older brother or sister comes many new titles. Perhaps the most popular is You're John's little brother. Then 99 there's the loved Well, It's one of the Smith Children. Probably the best one is when the teacher calls you Susan, but thatls your sister's name. Although having an older brother or sister may be terrible, just wait till your little brother or sister has one of your former teachers, then you'll have your revenge! im., mtg vs, mf-M -sm U' M... nn 5 as J Q Www L -x. f if t ,X ' I ww- I fl' 'f W iwmm A 'W MWA SEAM W .... 5 i f' fiigiaisfisiisiisifs '-':f2: 2 ' f1'f- ,' Q ffi Y ,lll .3 was g E l gi M Lf '--'f-:': 1 ,,,, ..,. 15 f':' ---'---- 1 m'M,,jNg,,wjm.. .. r ...W N 'm '-4 . 1 5 Fm -1' eliilfiflfiiiiiia .'.,g N... 5 'ii' f Mfisf-t mtrwefgfrmmm Eulefkw li mmrf ev K ' 'LW' in ' ': : ' t irlmaw ae 'fimfril i A e 'M M ..... ..,.,,.... .... . :z - .ze ,,,,,-mug .., .:.'2 W?ec..s':f.:ggM..T..?gf'N'.r.,1-W Www 'M W -N - - ' '-'-21r1 H . ,.......r,....,, ,. ' -'-s f'15E3:I :.. ,E3-5 'F t,r.... ,.,,t....., .,............,..,.... MN - ...... :... . .. v.:.. -...r.....-.r.,.:.- s :-, 2-E22::2':f:2-E:E1 .,. ,.... .. . ..,' ...,,.,...............1 : ...-.... 1 .-- . .T Although they are at school sisters Kim and Tina Odom still manage the find things to fight about. 1 1 W wgg 42 2 354521 ,,,,...? ,H ..,,, . V,-f ,- V , .,... ,..... ..,.,., . . . 515555394X 'V WV' g?W559m32i55'mf '5:5: ' 5E??Qf7:': Ifilfiffifiigiii aff -. ...V 4. ' I 1 1 M 4 ! A,a ,,...,., -14-r 1 Q .::f:: 4.5: A sm 4 5, 591525525 w gfvw Q 5 ,, ggszgggggg 4 3.5 vw- Hmm gs .sq W ff ra g 52 '.?s'.,.:::.5-:.gE',:'-.gg' :!: . ' ' YQ-5343? 1495111-15 a.3,wgEVf 5 g k 5-25112, K?w: Sigligfu fm F? Ai Us w Q gggv 4 61? -E:-:.::.:: -E5-E A 2 uf 321 Him vm 6 Q2 5 Q W 5 ,s w 535 WW EJ S3mji5?gg5W -g- :5- aj me gb gms gg? gg? Qfggga 551555354 5 -f P ,gg WWI an 4 sag Mrk? 'Q wg 35 '5 59V f- W1 K2 H 235W QW 7 1 + 'l 'X .2 4 ivbig'-v Wg? 5 W iufwf A-H 5' f vw Q W K M' K F' U' ' :-s '::W-:- ....: --------- 5' P QW Q'Q5i33?i5ff WW M355 uQ,gfWf2'fi f wb qffiiqg, km ---- --.... :5: -,... I.52i2E::.3Z3Ei-I:EHE:E:la: -.-.-.-. . 2255255-2' lv , A Qfpiw V4 mmm rffiikmf 4-wwfmiii wfm.. '-+r.,sM:4a ns 1 f Vu 1 , M...- 9 'E fy A? M mv' etting Involved: D0 You Have The Time? later. It is cruciai for these students to Too 1 Too uch To Do Th h t' h d l f ' TG B e P e 0 p 1 e theescthcodi: rilceaensuniagermaindmfllflg moment in the front office. Administrators and office personnel are people too, but the student body rarely gets to know them. Between at- tending meetings, trying to organize pep assemblies, keeping tabs on absen- tees and tardies, dealing with unruly parents and students, and performing tedious office work, we seldom see the personal side of the people in the front office. At 7:30 a.m., most of us were just roll- ing out of bed. But for the people in the front office, it was the beginning of a very long day. According to Mr. Sam Stueart, Dean of Students, A normal day could start anywhere from 6:00 to 7:30 a.m.', Mrs. Nancy Howard and Mrs. Ruth Hartwick had to arrive early and sometimes stay late to handle the normal chaos of the front office. Mrs. Mattie Ruth Tipton, the school registrar, said, 'Tm not like what most kids think I am. I really do have a sense of humor. Her duties include keeping school records, handling all attendance and enrolling and withdrawing. She was also in charge of all of the tran- scripts of the student body. Mrs. Tipton remarked that McClellan was one of the few schools in the district with a full time registrar. Mrs. Martha Gresham, another of the office personnel, is the school book- keeper. She is in charge of the new com- puter system that was installed this year and for training the students to operate them. When asked about her image she says, I raised four kids with- out killing them. I can't be all badf, Mrs. Charlotte Atkins', assistant principal, responsibilities included classroom observations, patrolling the school grounds, and handling parent, teacher, and student relationships. Mr. Oliver Ford, assistant principal, had a full time job of keeping the cam- pus clean but had many other duties besides these. Last, but not least, Mr. Bob Cross had the responsibility of helping all of these people to create an- other successful school year. . ,B Regular substitute teacher 'hong receives her classroom assignment from Mrs. Ruth Hartwick. 4 A in Q ,,. .f s N ' fl stai n . . . Q., is 6.-t NVQ, W N x Q i kr 204fFront Office Using the computer terminal to check on absentees are Mrs. Mattie Ruth Tipton and Mrsg Martha Gresham. W Y r I Checking on the absentees are Mr. Sam Stueart, Dean of Students and Mr. Oliver Ford, Assistant Principal. Office aide Kenny Ball waits for his assign- ment from Mrs. Fharlotte Atkins. Assistant Prin- cipal. Being Mr. Cross' secretary is a full time job, hut Mrs. Nancy Howard has many other duties, also. Front Otf1cef205 New Kid I Town Along With The Students, Four New Teachers Appeared On Campus. filled with excitement and tension. The new year not only brought new students but new teachers as well. As the students entered the choir room, they remembered the last day spent with Mr. David DeArmond be- fore he accepted a new job in Colorado. Everyone anticipated meeting the new teacher and wondered just how he would handle his responsibilities. When asked how he felt that first day, Mr. Greg Murry replied, I was excited and maybe a little nervous, but I wasn't he first day of school was .ff if in Ifasdift, .Z06fFaculty scared because I knew everything was going to work outf' When overcrowding became a problem in the math classes, Miss Beth Ganter was brought in two weeks after the regular school year be- gan. When asked how she managed, she recalled, It was very frustrating. I didn't get a permanent roster made un- til the end of the nine weeks. Mr. Murry and Miss Ganter were not alone. Mr. Fred Houck replaced Mr. Richard Wright and now teaches Advanced Ma- chine Lab I and II and Exploratory T and I. After the first few days in class, stu- dents may catch themselves comparing and expecting the same work from the new teachers as they received from their former teachers. Mr. Greg Morri- son quickly solved that problem. I told everybody from the start that I was not Schumacher, and I would do things my own way. Students who tried to compare the former teachers with the new ones, soon realized that they would miss the unique qualities that the new teachers offered. Expressing his approval as he directs his Traveling Troupe during practice is Mr. Greg Morrison. Uncle Greg iMurryl gives a big smile to choir as they warm up to sing. Mrs. Virginia Abrams- Counselor Mrs. Nancy Adams- Elem. Alg. II, Alg. I Mrs. Christina Anderson- Counselor Mr. Mike Anderson- Business Math, Stu- dent Council Mrs. Mary Jane Beard-Alg. II, Elem. Alg. I, Analysis Mrs. Kay Beckworth- CCE, FBLA, Senior Sponsor i A Mrs. Lavonne Berry- Basic Eng. II, Splan- ish I-IV, Los Amigos Mrs. Beverly Billingsley- Debate, Intro Speech and Drama, Adv. English Il, Speech and Drama, Debate Coach Mr. mam Am. History, Life Sci- ence, Tennis, Football, and Basketball Coach Ms. Mary Bridges- Parenting, Tex. and Clothing, Home Ec. I, Foods and Nutrition, Adult Living, FHA m Mr. Sonny Bull- P.E., Biology, Athletics Mr. vE,gl,,B.ullingLo.n- Am. History, Inter Re- lax lations, Am. lnqu., Dept. Head, Youth and Govlt Mr. Earl Cloud- Elem. ll, Basic Prog., Cobol Prog., Department Head Ms. Judy Conner- Res. in Inst., Res. in Inst. Math Miss Martha Cothren- P.E., Basic Eng. III, Am. History, Girls Athletics, Girls Volleylball, Basketball and Track Coach, Sponsor of FCA Mrs. Sue Cummings- Typing l, FBLA, BOE Club i Mr. Earl Dilworth- Eng. Il Mrs. Terri Fielder- Business Law, General Business, Cheerleader Sponsor, Pep Club, FBLA Mrs. Carolyn. Friedl,-i Fam. Fin., Ol-IE, HERO 4 A Miss Beth Ganter- Elem. Alg. II, Basic Math, General Business Mr. Kelley Geurin- Life Science, Biology I Mr. Steve Geurin- Psy., Fire Marshals, Miss P'E'Q'2iH5?iVW'iW Ms. Lanell Hamilton- Voc. Math, Geom., Cal. Math Mrs. Kristie Hampton- French, French Club Mrs. Joyce Hawkins- Media Center K 2438! Faculty ,um gxf x Using her free time to h elp sophomore Brenna Johnston with an English assignment, is Mrs. Woods. Y, Y, 7, ' Are A Competent Teecher' This Logo Could Be Seen Around Campus After The Arkansas Special Session ne of the most disputed issues this year was not who would win the Superbowl or the upcoming Olympics, but what would result from the special session and Bill Clinton's educational proposal. The proposed bill would require the teachers of Arkansas to take and pass a general competency exam. An alterna- tive to this national exam was to take six hours of high school level courses or above in their field. This special session brought on oppo- sition not only on Capitol hill, but also in the teacheris lounge. In response to the teacher testing recommendations Coach Marth Cothren replied, HI think itls great. I don't resent the test. I want to see Arkansas grow! In opposition to this view were math teachers Mrs. Mary Jane Beard and Mr. Mike Anderson. I think attention should be brought to education in Ar- kansas but I'm insulted because I have to take the test, commented Mr. An- derson. Although some teachers may have re- sented the test, most agreed that the state was working towards a better to- morrow. Expressing their views about the teacher testing bill tojunior yearbook staff member Mari lyn Shelton, are Mrs. Heard and Mr. Anderson Facultyf209 Mrs. Susie Roberts, journalism teacher, con- fers with other faculty members in the teacher's lounge. 210fFaculty Mr. Jerrell Terrell- VICA Sponsor, Tag Coach Mr. Charles Terry- Earth Science, Athlet- ics, Asst. Football Coach, Asst. Basketball Coach, Head Girls Track Mr. Charles Thompson- Eng. HI Ms. Charlene Trotter- Eng. III-IV Mrs. Helen Tucker- Soc. Skills, CCE Expl. Health, Christian Council, CCECA Mr. Joe Vick- Orchestra Miss Susie West- Eng. IV Ms. Diane White- Special Ed., CCE Mr. Mike Williams- Grahic Prep. I-II Miss Brenda Wilson- Data Processing, In- ter, Typing, FBLA Mr. Bill Wood- Chemistry, Physics Mrs. Milgret Woods- Eng. II Mrs. Dorothy Woodward- Typing II, Ac- counting, SAU, FBLA The Forbidd n Territory Students Suffer From Teacher Lounge Phobia. ou're dying of thirst and the only Coke machine around just hap- pened to be in the forbidden territory of the teachers' lounge. The fear of this place may strike any- one anytime during the three years. The thought of going into that room alone repels people. You may persuade a friend to go with you, but that could mean double troublef' Getting yelled at by a teacher or even possibly getting sent to the office can all be the result of a craving for a Coke or a bag of chips. Obviously, the lounge was meant to be a refuge. A place to relax and enjoy what little time teachers have to them- selves. Most teachers could be found just lounging around drinking a cup of coffee or smoking a cigarette and read- ing the newspaper. A few stood about and talked about their students and their problems. But some, such as Mr. Ken Willis, took advantage of the quiet time to have an afternoon nap. Looking over her daily schedule before school is Coach Martha Cothren. Faculty! 211 Familiar Faces Some Subs Have Become Almost As Familiar To Students As The Faculty ubstitutes. Since junior high school, this word could strike fear or joy into the hearts of thsoe who heard it. In some circumstances, it could mean tak- ing it easy that school day. But for oth- ers, it meant working just as hard or even harder than when the teacher was there. Even though there are 20 to 30 sub- stitutes available, 7 regulars have be- come as familiar as many faculty mem- bers, in fact so familiar that students have affectionately given nicknames to these Usubsf' Mrs. Lucy Ray has earned the name Sarge because she believes in enforcing the rules and students obeying her orders. Mrs. Stovie Mc- Clure affectionately became known as Mrs Mac. Mrs. Paulette Long be- came used to the Red because of her eye-catching red hair. Not all subs have been here long enough to earn a nickname, but some have become well known by other spe- cial traits. Mr. Richard Mimms has a degree in elementary education and is certified as a curriculum specialist. Mrs. Vickie Cotton, a former student, decid- ed that she wanted to return to the classroom but not as a student. I was tired of sitting around the house. I've enjoyed being a substitute, at lease most of the time. Although many students enjoy the 1: .1-1. .eggs . S - ESHHL substitutes, the extra work assigned by teachers was not too popular. Many substitutes have no say-so about the work assigned, but they do have to en- sure the teachers that the students car- ry out the assignment. As senior Lana Hunecker said, The substitutes are real friendly and fun. I just don't like all the busy work. Sffipamja 2l2fSubstitutes A former student, Mrs. Vickie Butler Cot- ton, leaves notes at the end of the day for Mrs Lavonne Berry. A veteran sub ,fMrs. Lucy Ray, checks lesson plans in typing class. ' I ,x , 1 J -I ,if 4, Checking the role is one ofthe first duties of a substitute. Mr. Stacy Myers completes this task. rm Lg V , -11 ,VMQEQ Q ,gmt iw' W ay umm, 1 F' I f VW gg J Mid A 6 , 5 ' A Z , ' 1,7 25 , 'l 1 I y 2 r - V ' f , ft 3365. . M4 ,, , W 1 My .14 2 W fff in? fr E-di v 'il' - A ..,. ,ag nf, ,u 39' f W, f 6' it . V M5 'iv ,U ,iz A- 4, 'V W f , Q A f if M t 'S 5 1 M 1 f Even subs, just like teachers, have to deal with the new attendance cards. Mrs. Norma How- ard begins the day by filling the multi-colored cards. Substitutes!213 You Are Our Sun hine The Best Of The West Earns A Well Deserved Rest n the eighteen year history of our school, many students and teachers have passed through these halls. One familiar person often seen in A-wing was that of Miss Susie West. A legend in her own time, Miss West has taught students and children of former stu- dents. Miss West, whose career has spanned over 32 years, has maintained many high standards for her students. Al- though she has strict rules and tough standards, she has gained many friends and admirers that will always remem- ber her. In addition to being an excellent teacher, she has been helpful outside the classroom. She has given of herself by helping students to obtain jobs and scholarships to walking with 1983 gra- duate Charles Jackson whose mother could not attend the basketball Home- coming game. She developed the concept of depart- mental heads, positions which were later created in all of the Pulaski coun- ty schools. Besides giving 110'Zi of her- self as a teacher, she also takes time to recognize the high achievers in her classes and the athletes who excelled on the court and field. Miss West has had many student teachers under her supervision, includ- ing senior English teacher Mrs. Martha Humbard and junior English teacher Mrs. Nancy Jones. Mrs. Jones com- mented on Miss West's legendary orga- nization: Miss West lost her keys, and she found them in the filing cabinet under 'K'. As anyone knows who has walked into her classroom, Miss West is a col- lector of suns. She also has twenty- three sun necklaces from all over the world which she has added to her sun paraphenalia. Of course, her favorite color is yellow. She has become one of the most en- during traditions of our school's histo- ry, and we will miss her as she retires to her home in Russellville. Representing all of the past and pre- sent mighty Lions, we wish to pay tri- bute to this master teacher. As a dutiful teacher, Miss Susie West reads the morning announcements. Surrounded by a few of her sunshines is Miss Susie West. 2l4fS11Sl6 3'l1llwr ,,,WV if , , f ' Www W' L1l+45?5iLs,f - I -Hz ,ff , 'Nw 'H2U'fnk'+,m M,-w M559 54-mf: . V is 'fam If -T W W ' ,, af f .J 54? , K 1 4 f ny, ,, ,. 4 ff, I f if 744 2 w ,Z 5 If aff W J A, Q f X x M X f 1 1 f, 1. 5, ..ZM:IEI': ww WQSHQM ww -ES' ab my , :.- ,. Q Nam wzwnalw 'fm E piiizifiiigggH1?gffff?if2g?55ifm, M Q,-E ' 1 wni iwzk EEi?,5?EgQi-T52 'lg3i:3gi:,gviig23- Lp wa5fZ3'iFfm Wa :grae if wiizzflwifkxiw fi A A ' ' Zim?-v- ,R 'r??fii'i3 eg X Vfffw fix-1 QXSSHQSW wwrfwsgg gfwfsiwisffQ-fwgnmfszwmgfi.. Ngml- wzw.':Srgh,, we a.wgW.,?S:gw,gfvgmg -Vfzmzwiwzgw,w..mmn A :-,sw ' ww i,gg1!SWgggyH2W gy5gb,,mffs:16:nggs,fA-syitqzw zfsfawiihswxim,-'. K wlgmf. Sign wfrgw X agwiwg-'X Niwfw gwfysy -fzmifmntwfliw' 4 .Qu vw ,rg ssiifzwgz ggwgcrfzaif Wzwqzisgg: QBQQFSQW:-Qzpaazv qw :Sm Q' Qswgwiizilfafs 'kffgifx :lffffr 'fi:2f2ff:z'?2vSfFiff Silvia .:-as-- : Q37 sgiigwiigg ' Hw.gfQ3gU , -,Ewa - z:pfg5m,.Dgw:,zy., K WV ?:wE ESfE5Q,?ie2?f1225'i A , ff 'fiifmh ' WQFE5' f1?2f:E1W2f2:Si:5f 11235 :UW Ifzfmw. A'12f:'iffiJf2f-V -4512: ' fsgbizfizwzfsisiffz 'M gisw' A fzqffimf- 3, Yffviiziszifgzzisg, ,sylf viii Wfiisfzm, Ke 9:3 gg, gsgggggw ik 'f Llvlggszq -55:16, fijgiffhlzslignsq-. 59:31 wffh 'Www fsisgiiflx Q. wifi? sf ' W-21151 Psgw izffsgifglhfwzgif, A -fxsiifm A g 32 Szizsgafzwffffwsgi . ' if wZ'E:FiQf1fLgflSS:QS '1245' ifizfffzifmx ggziigifigsggiiziizgasgf -:eff :qE31g:,:?5:g2ggQaggs,--,'1f?21 fa 222521222 Wizhzvzi i Mizwexlx Lgf A1269-Y'-izfwizxfisimY '-f:f'?f'3V737 : N, ffi?ff3?SSQg3? 5 S mfffgililgill fliv 4ig'5Si2Zf4iSQ2ii2f: 'irgfswwv M-ff433,::SZ21'1L. ' y .:ffigf'?i:f G 5 'l v f Siwgkwggw ,igyg :wig 3'-ZgwE2eg?UL,v-12545225 Wim Zvfpgwuqgm 5 bww gf WZEJM QQ yum 5150. A-af2'wwF'v7g12-wgmngAg-Ujffi'I , fff?gwwes,x2 f B-.sw ,,w.Q.Q5Q, ,Mm .. . sfwn .wgmm Mlm Q Q mass M wwgywwbmwb ga. Him , ' - - ,Am Q. M I Un- w HW ggi g5?:5xH ggi:5w:HfwTi,a www. wifw -iwifzblwzwizwfz fn tmlw U?-M www, N54 sgklfg gsaffwzlmi ' f ffm 'f4:S:fffpfm,ya,m 4' 942315-f :iw we KA fffgiia- 15 - mam., ggi W 5 QL V :sign 1 , U Em 1 1 Q 255: ff-f www 8 mm, Q M. ,gawk fx, A V ffwf mms, Qzamg 5 ,,g1gQ'.-Jzpfnffa Q .wigs WMMSH U Aww M .1-ww f-f,cwfe,mvWv ,3M,Q,,,f.g2f,w aww 4,553 M Hi? s MgMgQg3:5:f2:Q?: 455533535325 Magfzfamzggvggggwg.sri ww Egg, ' --. w,,g.aaggqx , mf. mms - was 4 Mg Qgvafemmaqflgqff. wvwww ww ,gg gzqfzgasgs Q 14552555 U Y rggiggff A :s Q 5 s fm .. ,N za. Q ,gwggg vMaf3w:1'2v wi agp :- Zzrgs was - fi 1 2 .1 f -' fs- .k- .... whims, s Wi, M,,,fl,bm,,gQ Wwgf HM :E WfwsgQgffgissgfywmerges Bi 'Y,gS5ggb,gv555gg5.b,U,5 ..s: , Q .13 -- ng -::,.g.:5 nlefggfivg wig Fifa 5 5 W 211555 2271? 253 1 FSU: 1 bw K SE fi!-:ififia 52'5I:'15-55.25 WW 2 ' .er- 2.--2:: in 55511 Q 12 1 3 52133552 2 :5-g ag-AE g:'-g-,2::gg -. gggm 5 :: - X 1 221325 ' F fig 2:2445 si w wf seg 5f3.:::.3gfg5 3 'Q :Z W 15 45:15:55: Egiigiw ,...5 fig-52 E J ' 2? f 1 fl 5 5 ' X -:: 3- X E 535515 ffggzfsfx 225, 1. ' -,:2, . :g.gg:5j!?E55:EE5EE, .,., a -:HL fi ,. 53522 :gg 'f WSE ggi 5 5 ,. x em 5.5 5 SK S s S 'L :fri-2212 igggm . i E223 ,E 1-ff? . NQTQYQE 1 -5 Z5 '- 'TEM' - 5: ':!1':gg2 - Q. ' if .W 2 -'- ff r 1352 E . ' 5 S Y 351 . 5,5 K , . . my vis E figs K ' V35 '15 E -K gg E Z2 ag I 555 X :Ei 555 K 12, 5 .S Q, A 2 ssl, 5 : 5 E 'Q pig' 1-.ri fffifwr K A A fa-His s EQ 1 Q K , 15322-gf: . , Sf' 531' Z . S .:. . Q 5 , E:lg::E:5:' 5 5 E1 ' i 1 4? S S Q gg A A 1 ., we Eggs zzz - sg 1 311-YQV QQJ W 'S :Q :Er-:. I , U aaa:-, ,.f:: 5:31 3.1 , 1 E 'E EEEWM 5 22 is J M V E ' E 3 11 ' . agp gx g mgi 5 Q 55 Q E K gig ' 2 k Q 1 b E5 1 5 53 M E ' E1 Q 5513555 E 5 H211 y E lf ' 5 525251 EE SE QT? W sf:-z . 3 1 E: Wk 25555 1. 5 5- 5 A , 1 1 gig fig ' K? f ig 15. ' e , 5 : Kg 33 ,3 3 EE? .les S532 s X951 iw 1 EQ 2 5535? if fa V 532 sf 1 2 5 55.2 25355-isa? 'Q 1:21 5 ' ' 525 524 5 as Q gs .: A 3 M ,fs g E fi ? 45 E gg? 2222 2:2559 21 21 , ,s i 1 ggi - 1 1--.2::-'-I-?5:' X W E135 , fi ws ag 'a 32522 5: gf G :fi 5 : EEK E 5 ggi ! is 25 - ,E , 1 151 ' 1:15 G 5 a if? 1-. gs gf I 5 5 N9 Sw 2 Eg g ig :aw 1 Ii 12 sei Q4 5 is h f K .-.. , . :::g- W 5 - . E 6 -ga , A X ' . :wif 6 S3 1 5 ei I 5 H Pm fs,mgQig2sQgfH We -1 u z ,msgs wggaffm QQ E sg i g gi, gwggmigngsfffggz 2 , - :-gg gm. ,'-1,553 Q .g:,: a if eaiiwfswiwag Map , g5.:.,. :-.. p342Zvs,3 Q, , iggzffsiighisgw 5415 ' wjwgfgfizizrw ,V K i Q15 ,. if by fx ry wx , Wmmb Eff H S ':-:---:-g Sw:-,:--...:g-:--:::1:- Mifzwfzviwwh Q if Hg ..: .,g:Ag: gCf-l m:ww:ugw,gX,,..v :Wi 1 , 13:5 , 1 Szmizqfsizaebigm, ww?- : Xgaggqgag W W, gi? ,fz,wmWgQguw,gMm ,mga - Q.--:.:-: gwwgpm gfwgswf - ,g,,,ggwg gilgQ:0.gg,e-,i,w.mgbgw:fY ,hz J ::.'-::-:- :: gs .wig fftgwwiw msmg wi Mums 353 -.:.,- 1 'W :gm -wwniu My M , ,MWEGW nf Qgwffmsaswqfs,-, ,wg I5.'-53523553 X535 . QFiiwifisfigsfrgiiwsfixfiw ,lwsiasiwzgizflsbigwm,-i lax i .. , ,, .y n wg .g M. J , vu. , 9.553 WSWS his Q . ig fs. by M v. 0, . EH,MQ,,g ,N g ggmgmmmgffmaiwgwgu gggwgmwf, Qzwagwm, s , .Q-,. M gpm 8 WNQ,:Q5,,fM fx4x,p,q,f.3,f,.a5wya,,,wgW,, fl .,,,,gwS, . k E' -:w::':'-:-sf-: f ' f 'fx V in ' a,,,,gg,m mzgfw ,,32g?gV35Wmg9w:3:Qa 5552541 H ii 5-zfftggh., gg., : 1? gg, 25 2 413-N g:wiM'fi5'S2::!1ffSg--Q.fwfr..wgiiifpr-2Efg5u:1:w2:H-:wx Q, Us , Q f .l wwfagg-ak w15w?,gu,sw,w2w,w1w,f.'gQgx5f.,w.ygw wf,mw,,g3aN.w iwgmfkfgmswswwww . X 5 - . 5 i n Q:,5W4mMwm,wwwgqwsmA 4Q,M:w,,m3My 5, 1 ,. ,f,w.q .,.., ..,,. , QW Q., .W 1, ,Msg s,,,gsQ,,p,,x ,',,bx,p, v, D yum xy RM QR M H S f, M Q, v., Am sb V. . 4 , 2 ' :EE S 33 : 2 ' 4 f Saw, Fi? 5 ' rZsai.5E,:-. I 2: -., ' SW Weill: dgliqsgwng mw1'::l:pEw235g2zfsggwigfiyim, giiggv sw faggigfifivagi,flwigfiw QM Kg 5 3:5 4:55:24 gizzgfgiiggggafeg,gSk:ggg::g:gg:g:.:g:m:gSgg- 545:Lf2?2Ese2Emgssi2g:,f.gfvgiigggff'g:ggf,, gig Q fg?:.:g?s:: 1: ,,w,,w M,5fag,g gs-ff:b1,bx,gfxQ'wg1fgw3ugghgw,.5 1,,5gi3ui3.gszQ4g.,g:jmgngfhQM,5gwy!5gffv4gp,,-,ggqEfpyvf,,.f.3p.f, v mg B Q3 x ifzggig S5gHf5Qfg Q22bg3sgQg2Qf: '-:gee-Q1-rsgizfzgfz.Q--zafzwffwzgfPzhrzfgfgfszf.-firm.W-:fs::'wwf.:N-, 2 .,g-f Bwfww ww? R wiwewwai ww xiffxwwwf wsswyvssxwfgy,.iwA::Mi-mwosyfwig w-'mwwwfwimwjv?1Q?l'1:f H -Q ,- yang? wg an gag, 2 hwm.5,,-15.,Q,,3,gg Qfyngmg ffM5.WM,,l3-,Li,lf,g5q,:,3,,gg,-www gm, ,gums 735 , 2? 3 1 H 5? E2 , L ,giziissuzfiifzlrgiixlzf'wzfgifffzzizziirifzf.sifzzlfsfizwsflizgfgzl..A2250U flfffizf'?1S?2:ifif:E121iQ:5Q:wf.2i1s51:i1'Q:mV, EE x j f Q . Q bffisiig Mxf.f 5g6+2QEigiizxiisizsiziiiiisfsiff2fEir:R:2f:S2?gQ vJWffizirsfizilaiwfsisirf:i15545 fffEi:'?2g?2fgi2: LEW . Mm x mdmg 5,5-,:,, wi v kwin Kgwleigw Wvizqgz-Sgwwfifgg iwigfnifw,,sailxggvggwggigh,yigngg Neigsfgmiwggwgigf 1-.ggiipibbifggsxwiifgwifwx ,i-w3Qg'J,' Wg SS'f:2Q1g3+nE'3M I':ggI'I'E:'- wif-iw :2. - ffm bf 2:5 vig K 'gf':3,iiQS,i2n migwijqxggfigga k Sizgwpg J Gig fm:g6Z,w:QZgk.g ,glzgig-? iggegwgfiiggb, swgfgggfgw 5565215 Nfaigqizggm V1SUM:f5a:QtgQigwNjQff,u , M . R fifigggggrliff Sggglfggggggsgba Y 5fmigfgwgigggsfaigdfigzwzg:nAK .p:Ei2?iA3g::Si:::gfgaqgrggqs,x-qsgiigalgzi.:ggzisyggiigffg :gwigggw wx yfiif '-E: wgoiis Swgwigsfiikw Tx,PSZ3'-ZHEW Zgwljgfifjhi' QWSMS'-':-if' '2'W+s,533f'fS bZJ4A-Si-232, fWWifl?, fi? yijfijwligyw 53? 46133: X 'EWS ,wikiwf M.f'i,3lfSl2HSw1b51w H x ::' , pw.3-5g5RE2.we:s2gj3E21gigp5gP:prwggzfwfgeigfzfyigggzzwv .wsiiziizwgggggsbzgHzgiggggf- f-i.1miisA?EF:sEN:gf:pgxsg:ggQ wgrssgxg. ''fffgkiiilgiiiiXETYS1gg5g,ZQ5!igfE2v7Q3Ziigwg as Wit: wiv.g-L4235.-'1::,l::51zg5f:aKmv?-izgwgsziszizsiisg , fQE1'ii3ff f' 5: ,, A ' 5 IE ':1?1-ifiiiijiig39:-Eg'?I'1iiiii2?2.fS1159 fiSQgfe,Q.5Si'f2'if2iiiW 31'??5i5fmi,, :Egg 3 4:53 mem wi elif, 1 agp., . ligbfLT-SM'1bZMEw155g3iMaQ,v5.Q,'551il..'f?1QZ.fZSj2,nQNwiShQiPfn,QDrSg syxmibhifw-3h.v,x5, vip: pgbiggmi-'.1f3Hi,, wgwivg N. 'ft1'rf3,,1 R, 2 gm. A-1. gg 1 , m,,,, Q A-1 M 3 M aW,m,,nW. -. M LJ-,wm,: Q w,,,m.gw-ga gemfm wx gmiggw gf fb ,gwgw HQ in-kwa mam.: Q fs we Maw? .M mv W My W WS- rm K 1 'ififiiiiw 'iv YwEWz3i5iW53Q52gE1flifgf Q 3:2 wiweiwhfii' 'ffxifwrsbiiiw A Q- :sNewff:ggQag32vsEg,sz:ggAs::flfwesivfrf:ffmagszafgxfwgigsgsisgfigisasssf 0535.57 IgvZfgQi,Egiggqggg2E:q3g4-3:3553 5351155ZgfmifgfgzeyggsgizgM5511?,,g.g.gg,5,RQgm:3,fg3g? ggfggiggggfqfiglggfggggggiix'Q E 55555 15555155 .2 -gg, X - fs fA ham: ffi mwzzg- Sgzfswsw my f 1 iiiiigiiiifiqigkgisli 'iiwiifiw ls-Wweiaizfxswmfhab rq - sS,m':?:ffiExm swiss .bwisffs -I M15 22 ,543 A iiiyggibzwgggigggf J 0 .L55J.,f,gg,,iigQ5Sg,g,gk5,swg QM Q,g?iggggi,gm5igglg'gQgq Jwglxiiggfm Mgigggaxgtg gy 555245 fm Uv.. fwwiszw fy 'mf G xggssfvg wiiwvismg ,wgwfmf Qzzgzgm ,wgsxgw 'Q Hiww gpgzvggw, 4 ww ,Jax nz:-fsiiggiaswzqfs'fsbig:3frifsfgiggigggrggsgiigzLgqgqggwssfiii 95:5 5535? ' ' SNS I MW ,Szkigjf-.tfimiiffiwqffk Mmgwi' W hgiigfw Qkififw Q, D' - XQTW YQ :Q '-E: '--2I:Ep:5:2::-23:2..--. H fxsjmmxiiwm Wgesfgg91qgmg?QSZwfggniigeigwith Qsgsggggggugwg-Sgeglx gwvgbfig , 135, Q ':xg152a5E:j: - ,-22':: ' :I E2 E' 1 25 ' ig' wifidfmxfggwwwQwwgwzmlmagswrfuSwiwkemwzmw gmwism 3-fm2mZ,2WV,mS A Q -New ,wxwfw M my wufxwg Ywmwmu wiwwsw WWPNS Y mggiw wzg55gEXiQ2D,gw mmw,,Wggmsm,a,w.:gSgw,q.,:g1,.,a h,.,w,gw5, ,m+ w R , W -W Wgmwgsigmg-fszzWgfwggz: zgmgpsg-wigqzhia QsgAggs X:f5gSm, :g,g?gg !g fbixggs fgasggg fgggzxggqa Sgg:S1gQ2,:s' an a gggvsi 25 wigs R --1 Q -ww if B Hx .gl . 'ww wzwzxfifb 4' 2:-:- H- 1 gg, .',-x::.:-New W' 5 fwlgm M M, W ' fr eak-,gflggig x wgxwllgf sw , 1 A Qiffgi - - :xr ef wgegggg :. .I vi 3 fi: wi s -: :.. 2 S -1- rw -., m pmgmi .... Y 'isa ggfgiig m - f gwf. Q wwzgxg g 3 Qgvgyr ., 5. 3 -: . ,j ---- ,qs Q x Vw gggww, .- q w, fm s wgrffflzii f wiv 2 Q Q3 52 55-2. i:.a- -2 3,35 is X' ,-bm, lg wr' f'+fifff sfsG?g 3555252535 . Nigga, a M , wsu X f f HEW5?WSM'?'w ?fi?3?S535?'555?5b?5?3m'm?m'RWE-45355355 fwfgw V'Z5gEf51F?fNfW'?Ni5 f:z????W 5?-?K7E5mWfS15EEfEE534:55'3mW?E?Wf53ff'diff' yn? ,EEESY gi g55E55:g,f?g'ifj?5Q5:fQWgg5iW5i'G122'?'55??TSX if?E235ifiikafggfggQgfgxggaggigisigfiggf'ififggggfgimg253315131 2 XXX 4,012 are, fl asia E3 , 2 AX. E vw we 1: we 2 s www D mwgyw wwf iimgggggylgggggy X ngnzn XM,-XWMUXmXz.,.5'3gVXqxs3gawwMf,..,X,5Xngagggwmgg 'xfgwvwfiiff 13 muse: 2:f:?:f::::2mmX me 'f-1: Q ., ,. . Q,:,5 .7 XX,sQi2X:w53ygyzX:XX+Xs4X:2g gi MF, MQXXXSXQX X. X' Xmas XXQXXXWQ M XQXXXXXX ' M Q Xfgamqsfzs 4, WAQQXHQAXXXQ tsmxmf .,XsQfX:2zmX::s M W 0.155232 ,B gif X Z ?g.XXgXX.... ig.. Q M N Wwg pm 5m.,,.g mXXX2....3.., my X W W M X W Q XXX.af::::gX5:f::1:w .swfwgwm N f:,.XXma wg Q1 .. KM' W N MW X .mg X, X . , . 'JfZ'ifTYTNff1 f Iiffnfgm QQWQWW4 AV1i55fi v11l75JifMfZmXihww xi V 5XXggg,,wi3X:,,3 35,2 .gwgsaxgxgggiis .S .. ,xi, V AZ35T553mgg:.X yiigggmggmm .X .-.... XX ,X f XX wg XX :..g:6.1Xv . Q Eg 'f E-ri-IE. 2 I I--:si-.2:'2a2a22..2:.-.- :- 30 2 Y 'X' - Nigga? gswggwflxi WU H 5 5 'mifi?'XS'ifg? Sismiizzbnzgsffggf Q ww ml gXX'1E5x1Q.1X,.XFf2-xfXz,,ii'1wQfggiigiipiiiwiiibiiwfwi ZYS1x?is52'SSg,SE?2 ffwffwvmXXWXSYXMXXQVXSSQXwg,XE.QxSs-mf -' ,, ,,,,,, , ,,,, N ,.,., ,,.,.,. , ,.... X., .,., .,., Q ., Q XX . Q 3' X WM .X mimi am . ,, , A... .W mx-X... . s. . . Q. ,,, , ,W .. , fm .gin . MXM,.MW, , ...W X, ,. w Y. .. --X -.-. . .. -... gQ.,..5. .... ...--- E W , vs Q v 5 wmxw -?f1'- we M 55, WM W mgqubws ,vp Q-W Q X yfgsggg-gww3gybAggw.,X wggeygvglfgfgbzgfq-Kg' egX55fggyAfgggfepywX,ww.ww.M.,,323PQ,g:'5g,1ggfv255ggvgfbfgf m ms? wi K W '+ ix i:XX 'S2.fH XX mmfgw 53 X 'mf cfm? W Si X33 x W ny- Q X X Y, Qgwgg 14, M ,W is 'QM ,ZH X Em Fm , Q QQZLQX, . X.. . X. A .XXX X . .X .X .X,.w,,.,M.., ...,.,W,e , ., ,W Q, y a, H- 'I YW-iw M X Y . X IWW W , , NHS 'M X x 2 , x, 'WZJLZ '..,,V1. W' P 1'f47 'Jhf A wmwwX., 5 RAW ww Xa fn JR-:I 2253535 gziif? ggdf?Xl.5X2.??3'SE:.?,g XSzEfs5e5,,,5fAf H Qggzxvf gggggffzrzyfxf wzQ1:5a 3'2,2wifggiX ,ES W ni .1635 Z ,X K K X V f :mb w as E22 X, if XX -, .mga .. , ,. kiyfimgxm A Q X rw5fXe2XX. 'K 2 .Q .,,, , ---- -I-22 :-:-:ar: '.5: ,XX 54 wwlgiiiif- 2 X- SQ? gy -wf'lw:1,1f- B V53 XX5g,ggfwX .- 'g'L::'.:V- WSGQRZ, . , N wr' wg. Li,-513:31-' '- -G Xdiwi . ... 'Rf , M - fwwsz- X gg i MM W iw. :ibm L ,X - ' aifzlzz iglv Q fziflsz. Y Y . .....,,, .,., , .,., ,. .,,, M... . .,.,,., .. . 25 .a , .'-:, j::-:.:: ' ggi, XX X.:Xf:k2i'?52a Wggif hm 5 W X K ., N' - fi X .. . . H , ..,. ' :X::'-Xg.:':5:':',:-: ' Q ..,. ,gXg,5Qm2:5:XjXggM 5 qqXXis'Xz'. 'ww S. X' WM 7 XShS'v-XXMXNX' W' -' -M5 M UV ' U XX flag., w X . ws? X . Qliwfsrasgiz' 1 1 X my ,MX,,.5., ,'4,f,:'- ff, .-.M Q Q . 'fTiii?3fX5i?i L f Q A A K3 A , Qfigaiiiitzfjg L.-' 'X 5 , 135255345552 . 35551553 ::f:fffiggg5'f5S2 Egiwigfifiiiifzrw ,X Spgfigij? U, Qwiiiiggigigibfliazizzfgiigiggiigififii 5gg:,A:'lj?:::L1,ag2S?71lf?iif .X S wff-:favs .52 H s.s.Er:2::,.ffv- :sg Ffiwgzgf .X 3 A A yew ,Q flhgiziggij ijgiiirgi-ZXQES Hwwzbigfzfifikgz Rglgilgvwgw-NwXXXX1XQLgxg3 iiizwixisz:i.m'5X5I,tXflg23fWg:5w'::.iffiff',rfXgE3g1XX2. A l5ig El G Q ., fi'mX?S'fs?M ?gQ:e:gE?3g 6.511525 miles . X 2 Wim? wffg2MXXXSXXXWXXX5XX.Www MXH, ,M-fwigzzzs ..iSQ5sYZ53gEWXI :Egg 'f ami ,M 5 TW awzg:2Li1f::f5:fg:b sXJi iivwiirgafgfgsaszpii gH 'f1zz.:ggg4::::-wasXzmffgga ss v 3 ... X K MQQQYLZJZ ?5':::E :Sul , V ai BX , 'illfZ'5'if'iR?Z' ':XXi:szg::g':2:s:+:e m 1 Asiifv' 1 Eewigmgfmgigai22622155223iikfifiiiiwilgi 5Y5:.5zi2l:zi:iiQ:::ssiwiiissfxzzi . Es'5:.:2: ,,, 5,2 ,gz:rz5Q x ' s:22 gi5iSQg5iZ2122gfrziigiriggakieigiesszzsii2:-sgsgssgai x f3v2ie1SS?i?l?iQ ' , ff 5 X as . E. 5 fgmmzzglg fg Q55 5: 15 .,.,.,. , .,.. 1 , NSD H1 555555561 X gwg -:::,',. wigxjfiie Hi ? 'bAA T Imxgg iz X2 11 M24 :QNX 2 fs' -W il, 35,1 19 mg., Ka WwsXm22-31.'fzzs5 Wsfsimbzwwiw , ,,,......, . 0w f::,:ggggg53mw?? 12f 5.1. 5- X? iw 355 ff ig X2 i m eg 5 Egg 25253 E ai f V' ??5Ef2Ej-:E-if V sf ' if EZ 1552523 .:E :fi-fEE' EE SEEWV H ggfigisggiigfiff Eff 3E'f QQ E2 XQZQXXQ SESYE ggggk a s:-: .::::1 I g zwE:z,g555Egm XX a 1 22' 'ii W gb 19 EM Q N235 15? f f :1 -f ff sg wiik 55 2253 .5 ?H igMXsgE X ?f?32S i5gg52 ?Xi 25. gi S i m gg :n-: ev 1 5 ef XX e ' :X X '2:-.:2e2.':: -2. 5 :.. :.::'.:: -1 ::::.':' ln' . ,.:g 5552 3 1f5ifXQgi - .E EQEXEQ sf X' p f mg sg 2 gigf ' il gi F' W E55 QE iw N X A .... 'ff V X? sine X X , ,.,,-.- :a:,: -...- .,..,. ,X , ,,,,,,, si ...gg :saw Sgzi 1 51 N' 5? ss.:5Xgmg X s -1 5. , .5 5 z 5 ' 55:45 5 X 5 3 554 Q 1 ip 5352 fi K zi w igga iwemiiw igffw .5 55323 5 1 ' :arg I 5 'iii ' f' f ff 2 f:ff is .... mwsgszm ,. J fi. .2 5 gy .3 .5355 l if WX X X f , gli gi A X2 2. .:g. :f:sz:.- ::::g:f WWW W 41 N :vi g A :a:ra:.:r::::rf::2: 'M 51-H M sw- E 5 S513 fl 3 3 W ii g4 5 453 2535! ' . 5 z E 2 Q 5 1 X 5 . ggi! EEE 5: EQ 3 52553 E52 if Q X six? X 4' X X 1, si 5 f ,Q JE X 2 1: s:2f: .2::, :X La: X..,:?f:2f:fa:.:::fa.s 'X ag. ,,.,.,,., mf: -Lg.. i g Q. Magi... v Q 3 5 :s.:::2:f:'-X2 .. I'.:'z.-s:::: . . EXE-:X-if-: - :X X:-fs-:I-X.-M22 5 Q s5ig:f:fX.f. -f-52' -:X .--, 5 5' 5 ::-5 :, 2 ' X ggi? 53,35 , 'm,:,.:g:-: 2 -Eg-,su rg - ., 5, '- . A 1: 5 ---- TZ ! 2 5 E ss? ii wife 54253325 3 Gigi? E if XX-w a Q E E ?fi4 f Xe Xae' 5? X. X, SX es 25655 3fi3Qer w5?ME5E?'QT1::ai,. 52 5 333- xg I 5 E Q S , E .,. I A , .,..: .1 .,.,..i, E .,.... .,:,,,,, V I . E. ,., A Q ,.X.,,, .,.,. 3 T Q ...., ,V Ni., ....:E .b.. ....: ..,:. gl. eg 3,3 5 5 e w an Wig-X-Mg g Q25 YH-S 2 52521 2 my z wegie. X. X . XXXXMXXX - X M X, gw.,:X'.z, f..,gS5:ff.. H.XX nzsfz. H:.:....X:s2 5:12-' M ig N 5 M .-.4- -:X-. 2525-1:2225-X-:--2 .... W1 f5.:: :......-X... .,..- -:rs--:r:r ,::-':-:::J iMff'S --:r2r'r--Qiriisr g g:':':' rEr:::g::-'-- :iii 2 2 Q1 .-s:- .,... 11 X w A 1 X ,fr 5 2 -z 4 ,Q ' -- ., f- I QA -X - --K -..- X5 32-ng 2 Q ...J mis' f ,z Q75 Q. ., - W gi X,wX3'2fi :., -- E f f 3 3 795 il' X ZKM BZQ is ggi i f 1:i32.:Z:,i,::X53g5 gg g ?E,gEmfs g?, ,Eg N ---- 2 a 5 ' X ilgif -:F-.sg'gEiE 5g2:5 YQ5zfMX':,2i'- Z,2.,X.'b2'.g5SZ5f'f QW f,JfSg,..,, :2?j:j. I 5,5 X X ---' f 5192 ,ggggs ig X ' 22:23:52: 3 .:-: - ---- : :X-:. ..2'i:Ei'..i:.: ' .:2?fEf2 f 'V in '24 Hiwlizszm :TQ E ISQSZRXXXX. it,-X53 5S'iD'EL'2250f'i?5' 2 .2.fE fs 1 fy v Ki -. -5. WA J Ni . .,,.. X 195: :f K ' Z 12 3' 22 Z B, ' Y 45 Q' 9 ' 463 1 X ,XLXEIJSKQ Q? fi mSfXX ?z5fwfEw- iff-XE 55 EQ eg? 3fX':l5 S5 ' if H i ? S SM f W 415 553 2 i ....... . 53 fe l ? EA . :5Ef . 5 Q S25 3 f ii? ggi 5 35 .2325 f 5 Q- Z3f l M 3 ws . 5 W 1 is vifgsiaesei g m:: :. ZW XQ - 3' 51,g5gsgsssg,.. : .2 ggiqsggf- ..gzg::ge f1,,X g I 53 .5 73, ,iw 5 FSE U les- 3 1- :.ifs:f gEi::5:::i ' ' ?f'52515?:i5?:3E'5a2i W X 2' gg g v ffi iii Q W E q i f H : 1 22 125 1 ..:'::... 2: EE: Eg i Q gig, W 532 55 D, Egf M55 9: ff? E W U 'S Q W 1 K W Q' Vi Q if if S iw iwaiiislii 25 35322173 f 5' f5??W X S A E 1 f 4 525 25 5 52 XX Q Q SEQ E2 M if lllll .I f .. 55 322 -251 .5 . ., E ::'Q'?Q5'5 5935 Q dffi .mi 5Qif:2 V?3m2.5Hif W WSE iii , 5555 X? 2222 'I 5 W3 2 5? W5 f 3' 7 Yfyimff 77 H '3 QM 9 f l 5 l imi .fi 5.55 514 ......S.5.Efi 5 52 .525 fig XAZSHZE WLS? 'EQEETEZ3 H 35 'ff E 3 1 2,32 M W 65252. 2 W' 3 ,NX in -,-- M W? 53 ,S Xaajifq xlggiiiiis-Xzi' FL?2p21s.X5QX2gg?if.,5g,g:I4'SgXZig,2Q,XX1j:,?X.yXX.3gi:g?QS2'-S,:.Xz.'1i 9',,,f'i5gXZ.l1:Lj in 2: .,-.-.-..- XX' X X v iw 2' . X W K Z X.. W if M ff 'ww'Qma:,X.,im'f.mzWw,:zmX'7mX.a'ff'w5fs:f'N:'xsQ,,smX1XXXs2sT'Q 2i'5W', X MLW ZS? QE 2? 5 E' ' W . , MX XX W 'i v Q X fifwfi? H' ' rs lfiiflx -4352 Yiiiimi my X, 12: fx: 1 1: X7 f 5 X ifzfwrf 1 1 ez fs-:L QXZW ' V y y . f giifkf gigf, mf 4 . ?Xi??5?55fffQf 2 Eg 2 1' 4 VY X ' ' W A ' , ffv .X XX. ---' If 22:2 'fmWf:wL:zrf2' 1 MXX 2:- 2 ,,., 1 . Q if X :Zi Mr:-sigma? fgg5?m,X2ae:.e..XzX,.. hw? giwwQQX.X:mX eq XX??gX,Xfi,X'f252'f2?Xwf.f2mfXff253?55,X2MSf, H-X2gfg:X2Xie:5XX,.1.3 ...ga,Xg:fafZaggfzzsfgzggevzgiwiai W'-9 K X XX X1 le .. x g , ,W ,,,,X , ,.,fW,. ,ff . Wiwgw , X 4 ,X ,X...X,.mw,w.XMXX-XWMM XX XMMXX .X ,XM XXXXXXX.f.,X.XX Xw.XMmi.f2X ,W Q gs 1 1 i ,, X ,, M, if if W2 S Si 2 will A 4 4 E 1 il? 4 Wi? Q 2sfXXXM1Sg Ksi5i f 3 'E 556 ' X f W 5 W'? 'Zi2GVf Q X? Egwf 12? . si if .. Q... Xgg gigj, Q fEX 355,25 33235 giffgzigfi? .X Xffsstiiimizi 2?2s' , ,t2X 53Z1E1.?ifsf3' X1 ,X Q ' E ' ,V UE 1 Q 5' E .: 2' ,:5 51,,f::Q.Qs5'.:'5: . X32 Q17 , 5 Q as':SfM2V' :::-:X 1 .:' ..5:'::.: ' 1 .:.9:.:fI ':i ' X 5' X Q ig? 7 Z: Xl' -Gif S: 35212 -QZEV F fgigfiii, f 2, 9egm3f3XX? 1'? X7 224'-: E5 ' : Ze-I in z Q X :EQ X . . f , X . - XX :-.:-::2:gX:' -: I. , Q ..... . ,HW iXz,,222, 'XX ' :2 'ffffzezggfrsfz f 9w221.w .1252 ,..X... . .,.. M, ,. ,..,, .EE f '56 4 , 2 3 K , ? ' 2 QX Xffi igfif 1? fl :2:j.:2..2s2-. --:X-':2:!'2f. 2555 Q51 fqggf XM' X54 4' XXZWZ - ,.'W?32'A4'f3? QL :... I1Ef' 4 . 5 5? 1 XX ' 5555 W 2 1 XX v 4 ff X ,J W AL 2,49 QXQQXQQQX Q2 L:: in if in ww 'gm YW Ulm WW ,We WX . mi ? --:,-X,-X- -:.: r:1 '5 XX ' ,.,,:-f- -:,:,:,' HX., 2532? 2:55 5' 2 gf 2 354 gm X '5Ew,,g' 221 ZTZQZXXSWW new 1:62223 , My QM 224 giafffs 5 igfz' 1 2 SX f gg X 2 E' . M X. - X X X , ' .,,.,.., . 3 X .2 552 fi? g X EX 23 if + i n 3 5 22 ggm gfe 1Z 1?ggg5??5g , mg ggi? X. : XV . fg f i X3 ' fi? if X g XX Wg jp: Se liigf' , ' : ZE: f:Ej W 2:5.:.::y,: ', V ' o Qay, 5,fSf g1gg,w?XMXsE5' g E SSE! ' I , , 'Q-XA-15.512154 face Ig 5 ,,.,., xf lml , EW? + ,,., fwgjg fkfgff EX ff X 51,5 , S , 5, 3 ' E XX ' I X Xg Xr . Xg zfz ifaei- A Egf U' X X' 5' 2:1 J -X ' 12521 'f L H wifi' f u W 254 ' ' Emp 'X 5:-sizei f 2 'i 5224 252 E 5 ,f . iw X 3 I V f 5 f fsssssf .251 :ae W '- - ' - X.X- ..,,.,,.,. , W -X Z Hi , 32219, ' l fiz ' X 3. 'f . 1 ,. 1 El 5 XX QM ' 1 XX ----- z f E E XX ga M-W5 'Km f 7 ' :':::' 5.35Eli3i5:f:?: :': : : ' f'3':5:iff5i5: ' , - . . ' E Y. X ' -LM iw ' ' N 515: 'f33fff'X:'12' ge..-f ..... ,.,., : 1 X ' A Xs H '-,WWW - ww 1: '-f ,gg-..::.':2f:::,:g , 3 X Q 1 Q f MW Www X I X M ng .X k ZEN..- ,X ignhn 1 53 EE gwmwg 3 .,2l5Ea: aEEs mg ii AWWWWMEE ?aM ...B-W QQE EEE? E ---X--X-X- -Um CONGRATULATIUNS T0 UUR SENIORS -swf. fkx. 'Wir 1. FIRST MISSIGNARY BAPTISTMCHURCH Mabelvale, Arkansas 10300 Mabelvale West Pastor - Dewayne Hoppert 455-2417 ywhere Jimi., V, -----l-Best Deal Anywhere Congratulations, Becca! We love you. J . Follow God each if gf day of your life. X MOMMA, DADDY, 8: HARLEY 1 t ii' iii' Congratulations, Julie! You Made It Troubles! God Lives In You. Keep Keep Him First In Your Life! Smiling' You Make Us So Proud! Your Beautlful Smlle And Loving Wit Have Given Us So Love- Many Precious Memories. MOMMA J0 MoM AND DAD ETROPOLITAN NATIO L BAN Nl b FDIC B D lAny wh Qual Antler , lt N, ,glufhre Phone: 4554072 it-all-.. Q' 2 N .- 3' ' . ,. . :7 26 I 1 -5 Qi: 'Ugg 2 ij 53:1 , 555, , if f 55 5 rg c l . 1 z .avg -w Ne :was-Se 1- ff f?'J f -mag as r .V?4 '-- lf, 'Ve 96, , 1? .,-I ,f 9-'L ls:- 'X75 url' gf' :xl f F ees I ' I 'J F 21255 - , 6T T,-if 3 ,Wg WL ' : ' 3 avg' 9 'F .- , .iff ,ga Pirf 9'g X41 if if if - 1 f 'a.-m-fl L4 Lfwfj .555 lx ' J fi? ,' ' x'iiil.i 'i ff I is fs: 5.l1 'A,-'EXPN N JE 'bb 3 9 D' Q:-' ' I for Kanye: JUJ rgdefjdbfb 12400 NEW BENTON HWY EXIT 126 I-30 LITTLE ROCK, ARKANSAS fad? WL2?!0ZIOfZf 3124 .MZIZQIUQ ARKANSAS TRANSIT HOMES 8400 Mabelvale Pike 501-568-3347iOr 501-565-2209 Specialist In Moble Home Transporting Bonded For Liability And Cargo JlfP14f7f7UAQ Wg Like Walking Into The Pages Of Your Favorite Home Magazine Over An Acre Of Furniture Dreams . , . From People Who Care About You During And After The Sale. Shop Mon. And Fri. 9-8 Other Weekdays 9-6 Sat. 9-5 5017 Baseline Rd. 72209 565-3428 f Congratulations Seniors! 220!Best Deal Anywhere Utilizing Metropolitan's bank cashing card is senior Rhonda Smart. Best Deal Anywhere uick oney hey came with pictures of cute little puppies, pastoral landscapes, flowers, or the Arkansas Razorbacks. Some came with monograms and graphic designs. Some were just plain - blue, pink, or white. Whatever the design, they were all used for the same pur- pose - paper money, or checks which allowed students to survive the financial crisis of the high school years. It was a place to keep my money other than my drawer. said senior John Otto. But I only wrote five checks the whole time I had it. I had a plastic card and used it instead of writing checks. From paper money to plastic money that could be inserted in machines commonly called money machines or automatic teller machines that spit out real money became the newest way for students to deal with momentary problems. It's fun to push the buttons, said senior Tina Sanges. You know you only have two chances to get it fthe codej right. After that it takes the card! I know, because that almost happened to me, but my dad yelled at me to grab the card, said senior Rhonda Smart. Whether students used paper money or plastic money, the most common lament was that there was never enough real money for their needs. Sales 0 Service ' Rental GEYERSPRDKS BUSINESS MACHINES Office Furniture Southpark Shopping Center 7515 Geyer Springs Road, Suite 3 Little Rock, AR 72209 Jack Webb 562-1623 CONSEPT II 6416 Asher Little Rock, AR. 72204 562-6831 Or 373-7903 0 Custom Photofinishing ' Photography 0 Studio Rental Phillip Page Photographer Best Deal Anywhere!221 34,3 GUN EXEHHNEE Complete Gunsmith Service A B im' 2'-gr' f sen minmihs 5317 West 65th .6treel f Buy X-f i65lh St. Shopping Centerj .- f Trade Lillle Rock, AR 72209 -5 15011 562-4668 Murray Draper ' Owners ' Thomas Draper S Licensed Class 111 Firearms Dealer Designers of Custom Jewelry B ' 0 'I 2 In d a I 2 I qoldsmllli ,ff F I n r I 5 I: . if 3. v 1 1 Q kim 7412 Baseline Road ,if X 2--3 74I I Baseline Road Lillie neck, Arkansas 72209 3' Us A 563.3333 562-4631 i ' X The Symbol of Oueli+y SHERMAN SPARKS SARAH SPARKS 1 f B' W oooo hh! it mill' BETH 5 awry Flys' XQFEAQ, HUTTH This Bud's For Us Brian Alewelt Page Parker Jeff Pratte Billy Matthis Roma Williams Brett Warnpler Steve Richardson S.: sv 5 J l I Bobby Jenkins Louis Moore And Todd Durham .. BEST DEAL ANYWHERE angzatulat ions teve ! X We Are So Proud Of You And Your Accomplishments. We Wish You Success And Happiness In The Future. Always Put God First In Whatever You Do. With Love, MOM, DAD, KAREN JEFF And SUSAN Matt 6:33 Phil 4:13 osrnaosvfn srnmcs mr: nocx An. PH. 562-2577 HAIR REPLACEMENT BYZNEW MAN 4 lil L00 X ,I J Q xx UMILY um AESW , f' ixgiii ko X L CJQOIZ ggzssrzcvootf QHEQR f5Bates ti, Pearson A Chrysler Plymouth Inc. TLE TELEPHONE C5013 568-1010 Congratulations L0QAN'5 Michelle! ALIGNMENT 84 BRAKE SERVICE We Love You And Are Proud Littlfiicvlr lililllalnsas YOU., e Logan Phone 568-6020 8 HALEY B t D lAnywh FIRST FEDERAL SAVINGS and LDA Baseline 81 Geyer Springs Little Rock, AR 72209 500-1000 n e, 9 li -.4 ? 'I . - of Xu rn l x IUERLE DORHIQH CCSMIIICS 'The Place For The Custom Face Jeu'elry - Gifts - Accessories - Em' Pierc'i11g DORIS MING, Owner SOUTHWEST MALI. 838-2935 Uiesidencel I-30 L Geyer Springs Road DOH 562-6844 lBusineul Lihle Rock, Arkansas 72209 0 Congratulatlons, 0 L1s a We Love You And Are Proud Of You! M MANDD D I 224fBest Deal Anywhere MUZZLELOADING-GUNS 8: BLACK POWDER SUPPLIES BLACK POWDER - CAPS - BALLS - FLASKS POWDER HORNS - MOULDS - POWDER MEASURES LEATHER GOODS - KNIVES - ANTIQUE GUNS GUN PARTS - CLEANING 8: FINISHING SUPPLIES RIFLES - PISTOLS - SHOTGUNS Sc KITS R 8L L GUN SHOP, INC. BUY 'lr SELL ir TRADE 7810 DOYLE SPRINGS ROAD PHONE2 LITTLE ROCK, ARK. 72209 f501J 542-6503 David's Flowers 8: Catering Antiques D G 8521 Geyer Springs Road Little Rock, Arkansas 72209 568-5776 David P. Garner, jr., Owner MEN CHILDREN WOMEN THE ASPEN Hair Designers 5412 Baseline Rd. Phone 565-9759 'XPUT Your Head In Our Hands Appoinrrnenk Nor Always Necesseiryni - A BEST DEAL ANYWHERE CUSTOM ARCHERY Congratulations PHONE 558-2338 Shelley fha im! v TROWCAL FISH V We Love You! PRES ERS F? E FS T S8-SU ES 020 BRUNO FXRKANS S 2209 E xmi,Ns'aa5 .sf WESLEY WHLKER'S 5?1feFa:,121d C L E A N E RS 565' 4202 Miles Begins With One Stepf, Lao-Tse Yours Has Just Begun' Compliments of CLOVERDALE Love, PACKAGE sToRE MGM, 9107 Ch' rRd HEATHER, AND 565518 JEFF B tD lAy h 1225 B R AUTO Wholesale Prices to Everyone Machine Shop Service S U P P 8635 CM Rd. 565-557l Wholesale Au+o Paris AC - Delco - Gales - Rochesler - Wagner - TRW Til - A ,f XA, w L Q - . 4, X at-,,,-gr . 3- X, Rig. - 1 : - I A EAR FTER YEAR, --THE-- CLASS FAVORITE g-1 nnnus-El Ongratufazffons, au!! From MOM And LISA We Love You STATE FARM INSURANCE COMPANIES HOME OFFICE-BLOOMINGTON, ILLINOIS ,Q S B DON FITZ AGENT I OFFICE PH.: 568-3222 RES. PH.: 562-0278 6319 FORBING ROAD LITTLE ROCK, ARK. 72209 IGXQYX X xx 84 I 4 Geyer Springs 'NX 568-7306 226fBest Deal Anywhere BEST DEAL ANYWHERE sum Magic U55 Eiffaramcs Our Youth Ministry Is Committed To Helping Young People Discover What A Difference Jesus Christ Can Make In Their Life. GEYER SPRINGS FIRST BAPTIST CHURCH 5615 Geyer Springs Rd., Little Rock 565-3474 S.W.A.T. QSpiritual Warfare And Trainingj, Is A Special Service Just For Youth And Is Attended By Over 150 Young People Each Wednesday Night At 6:45. i f 4 j-- - ., 5 E a+ I 2 C iQQl El Paul Sander Rick Caldwell -Pastor- -Minister Of Youth B t D IAnywherel227 We're The Lions For Evermore, We're The Class Of '84! Congratula tions Class Of 7984! Seniors, ELISA, JAMIE 8: RHONDA I r XX' BAR-B-Q GENUINE PIT BAR-B-QUE B-B-Que Pork 8a Beef ' Smoke Ham Turkey Barbecue Dinners Ham ' Pork Beef ' Chicken ' Spare Ribs ALSO CAN BE BOUGHT BY THE POUND DINE IN OR TAKE OUT 562-8012 10308 Chico! Rd, We Want Your Car, Han! CUSTOM get ,T TROPHIES, PLAQUES 'a I 42- si ENGRAVING ' E es f AAA 5, TRoPHiEs I 7414 BASELINE RD IITTLE ROCK ARK 72209 LILLIAN KERR Piiowr 568 3699 V! fN 1'v 8 Congratulations To: Angie P., Cammy P., Denise F., Elisa C., I Greg H., Jamie J., Jamie M., Jeff H., Lana Bet'g35nlXI0lgSl?0Trap H., Lisa B., Mark J., Michelle B., Michelle y p g3L?:,'.'ggflg3p1fggnda D And Tflsha F BEST HOMEMADE CANDY IN LITTLE ROCK We Love You' Business Phone: 562-8661 9014 Chicot Road KATHY 8L MARILYN Little Rock, Arkansas 228!Best Deal Anywhere BEST DEAL ANYWHERE IN THE NEW GRAPHIC ARTS BUILDING CREATIVE COMMERCIAL PHOTOGRAPHY LASER SCAN NED COLOR SEPARATIONS LITHO C0129 'cafufafioru Brigitte .I PREPARATION CIXIXE lic, U5 O LL I SOI-375-8266 C! JM 9TH Sz MAIN ST. P O. BOX 3021 Q 1 O mf PEERLESS gong 6136! QCLQOIQ Have You Ever Wondered Why Your Closet Is So Crowded? Have you ever counted the number of t-shirts in your closet? Panama Jack, Ocean Pacific, Beverly Hills Polo club, Sasson, Jordache - these are just the name t-shirts. Def Leppard, Styx, Loverboy, Stevie Nicks, Ozzy Osborne - these are just the rock t-shirts. I Love McClellan, The Year of the Lion, Rock the House - these are just school t-shirts. We haven't even mentioned t-shirts brought for Various clubs and organizations. These t-shirts are only good for one yearg a differently designed t-shirt can be purchased each year. Some students actually took the time to count the number of t-shirts in their closet. Some students gave us 50 as the number, some said 303 very few students said none. At an average cost of 351200, some students had spent approximate- ly 3400.00 on t-shirts. C-L.. Looking at his numerous t-shirts is senior Joe Hinson. Best Deal Anywhere! 229 3 ad Life Is Slow And ,..:,L le A Ponderous. Thlnk About fi Yo t- s vi , A :EQQ 5 ,,,,: h. , . , Q xl ZW ssss Lee Ann, It's going to be dull 8x boring while your at college. Let's face it, I need the rest. , Lgve, Congratulatlons, Mark MOM 8z BEN Love, MOM AND DAD Congratulations Marla! J D Senior 1984 as ss We're Proud g X5 I Of You! as MoM, DAD, MARTY, MISSY, MARJORIE, RUSS, AND MARCK . . . I Don't Think Happiness Is Necessarily The Reason We're Here. I Think We're Here To Learn And Evolve, And The Pursuit Of Knowledge Is What Alleviates The Pain Of Being Human. And Everybody Is In Pain, But If You're Learning Something, Your Mind Is Diverted Elsewhere. -Sting I 230fBest Deal Anywhere BEST DEAL ANYWHER Richard Styers Q A :if 6 1 . cocc Y Congratulations, You Have Made Your Twelve Years Special. We Know You Will Make Your Whole Life A Special Success . . . With God, Home, 8: Profession. We All Love You Very Much. Thank You, MOTHER, DADDY, MELVIN JR., TERESA, PAM, KENT, 8z LANDON Teresa Boydston MOTHER, DADDY You're A Wonderful Daughter, We Love You! Lous Martin 6501 Geyer Springs Rd. 562-2889 AND LARRY iii' iii! Congratulations Shelley! STEVE'S SPEED f - snow Cindy Blaylock Steves Speed 3 90I 0 Hilaro Springs Road LiH'le Rock, AR 72209 LIFE LINE BAPTIST CHURCH 7601 Baseline Road 565-3469 Congratulations Our Graduating Seniors Jana Brown Bret Carroll Chris Croney Mary Davis Brent Dickson Brenda Dorrell Holli Edwards Carol Evans ,lblvayne George Ricky Gough Phillip Grabher Mike House Richie King Michael Lawrence Joey Livingston Chuck Mathys Mark Milstead Doug Mize Karen Patterson Chris Porter David Pruden Robby Rayburn Jennifer Rogers l3.9.9.1S2'....51m9 Becky Slawson Andrea Westmoreland Kim Williams 232!Best Deal Anywhere L. - BEST DE L ANYWHERE Congratulation enior , S X--352 SK W? I Q. Front: Tammy Moody, Sheila Harrison, Brigette Johnson, Tracy Bryant, Shelley Miller, Stephanie Killian, and Donnae Cliff. Back: Shelley Ferguson, Jeana Crouch, Jennifer Linkous, Toni Taylor, Diane Reagan, Beth Lancaster, Terri Long, and Carol Roods. 1984 IOR LIO ETTE A' Best Deal Anywhere! 233 IIUNEFH LIL TIUNE 21g TUFM1.5HWUH5 it FP: UITI FEBLH U T U R E USINESS EADERS Mznlczx ff WM .w f- 1 W loucnrlou V!! , , ' 1. ,-,ff ' ' F t T y Bryant, Brenna Johnston, Marilyn Shelton, Letit' Hampt R g H y T y Stokes, Antoinette Greer, and Angie Carter. Row 2: B ' Cost H Ch H b W d ci M d S g 10124 Whispering Pines Mabelvale, Arkansas Weddings ' Portraits ' Commercial 0 Seniors FRANKLIN WASHBURN Photography 15015 562-7734 72103 234113 tDalA y h Love Your, Seniors May God Bless And Take Care Of You Both. Love, MR. 8z MRS. MARVIN RUSHING Sz PAULA RUSHING 1984 Congratulations Keith Foster! We Are Very Proud Of You! We Love You MOM 8: DAD BEST DEAL ANYWHERE Congratulations To Our Daughter Yvonne Marie Rushing Whom We Love With All Our Heart. We Pray God Will Watch Over And Take Care Of You. We Hope Your Life Is Filled With Happiness And Love. DAD, MOM, AND PAULA Good Luck! You Both Finally Made It! Love MR. 8z MRS. CURTIS FOSTER sy ff . I. H .... 5 an I 'H if X .L-,: , 'KM ffl -352 K Q .. . 55 A eff -fr 5 ' A rf S I I' R 0 b e rt S :LE ::,. 9 'Air i , N t, iw 'P -Q Egfffi A ' its was M F X X fs I Q K we as I A I2 . 0I'm3I SIIOPS 7223 Geyer Springs. 565-8434 3I I I JFK NLR 753-9400 Formal Wear for Day and KnigI-rl Fi'I for a King AI' Sir Rober'I's You Can Get , Z' Beautiful TuxecIo's for Weddings, fi Proms, etc. . 2, .gf ff, 4' All the best dressed aw, Lions go ro slr Roberts. Q .4 Iii ij at 1 Posing with the Klassic Kat, sophomore Jay Thompson, is J! sophomore Carolyn Anderson. Ongratufetfons, Lisa! Life Is Richer, Sweeter By Far. Because Of The Person That You Are. Love, MOTHER AND DAD, KAREN AND GRANDMA THELMA K, ,.,r W ll' .rev 5 at w '55 v-xxx e 'ff fmk.,g?s:' 5 at VWXS av-AQ 4, ,Nr pe' 1 ff I AgCQ2 '5 ,gf ,f A,., II ' ., A yfgei t:Qw'k,tk' Q -: - f Q, ii .1 fr , ei r ll? I 9508 Geyer Springs ' 552-1515 S9l4E2A5l3EE'ES OR WHOLE In .9n jim: H Ugfylr ,S,Ffl'll9J Majolrand Nlinor clothing ,,f',,,,,,,J,, Q fbq repairs, denim, leather, Cf ff suede and fine fabrics I h altgyatjgng and Full-Service dry-cleaning, laun- feweayjng, dry, and suede 81 leather cleaning 9508 GEYER SPRINGS ROAD LITTLE ROCK, ARKANSAS PHONE 562-5120 Open 7 - 6 Monday thru Friday and 7 - 2 Saturday 236!Best Deal Anywhere BEST DEAL ANYWHERE RRKRHSRS P,2gE'?iu5? E:2f5:i:fQf 5 XQi,dLU,fweFsellahnehtc Sh' IV A oor ac - p VAQQUHSK f Fl C. ,P ., . 'li XLVKOELMQXJ Janitorial Supplies E 'writ .f Sales-Parts-Repairs Lf? lm sea-4212 Congratulations, Jaci And Cammy! Bob Logan We're Proud Of Ca1'P2tS3rS11C11 You Both. Hooray For 843 Ca'Dza.z::,,::':,:a,::,Ox,:,a'm Love, S305w.65m0LmleRocKAR72209o562-0799 Sz MONDAY Uongzafufafioni, gfiiaf Elisa, We Love You And We're Very Proud Of Your Achievements. God Blessed Us When I You Entered Uur Lives. Love, DAD, MOM, 8: DAVID Chall gin Yes, Harding is challenging you to become all that you can be: to explore your mental skills and abilities, to grow so- cially and to develop your spiritual commitment to God. Challenge yourself to be your best. Harding University Call toll-free 1-800-643-3792 out of state in the mainland U.S. and 1-800-632-4751 in Arkansas. Alaska and Hawaii residents may call f501D 268-6161, ext. 407. Or write: Director of Admissions, Harding University, Searcy, Arkansas 72143. 238fBest Deal Anywhere BEST DE L ANYWHERE Special Thanks To the administration for continuing to be understanding. the ladies in the front office for continuing to be helpful. the teachers who allowed students out of class. Mr. Frank Washburn for taking many pictures. Mrs. Carolyn Friedl for having everything we needed for Shelleyls spread. Lynn Lile for drawing the school seal for our cover. Doug Vann for typing senior credits. Brady Massey and David Short for helping with copy. Han Choi for going after food and giving moral support. Greg Hardgrave for taking and developing pictures. Woody Simmons for walking us to our cars at night. Yearbook staff families for excusing missed meals, late hours, and sometimes screams and tears. LION LINES Gina and Paulg Gina and Robbin best friends. Congratulations senior Drafters- Deanna Daily. Thanks mom and dad for all the love and supportf Keith Foster. Not only a teacher but a tradition retires with Miss Susie West- Mrs. Beverly Billingsley. My Psychology students are the most generous people in the school- and they CAN prove it. Mr. Steve Guerin. Tripp Loves Natalie! Yea! I've banged my head in '84.- Lee Ann Red. Sweeeeetl I Love You Woody! Elisa. I Love You Shawn! Rhonda. Congratulations, J 8 'I n Il Il i k f 0 ll S 6 1' We Love You MOM, DAD, AND BETH ANN 4 ACC, ' s ,Li 'V' .-If Congratulations Jeff We Love You! MOM 8a DAD You've Come A Long Way Baby! Best Deal Anywhere! 239 Mark, You Make Us T Proud. Your Many Honors And Accomplishments Have Brought Joy To Our Lives. Congratulations, For Another Job Well Done. Love You, MOM, DAD, 8: GRANDMOTHER L Nothing Is Cheap Anymore During the high school years there is little financial income, if any, for high school students. So it is understandable that when a young man asks a girl for a date, he has to watch every cent he spends on her. This sometimes results in what is known as a cheap date. Although this is no reflection on the girl, it can create mixed emotions for the girl and boy. Traditionally, young men have been able to take a girl to a movie and to have dinner without spending an entire paycheck. However, with movie prices increasing to 34.00 per person and a trip to a nice restuarant being at least 32000, most students looked for a less expensive way to entertain a date. A putt-putt game was only 31.50. However, if these prices were multiplied by two and if several games were played, the evening could still be expensive. With these increasing prices, many couples chose to go dutch, allowing the girl and boy both to pay the expenses of a date. Some couples chose to stay home and enjoy cable T.V. or video games. Some would spend several hours at Wendy's, or Mr. Gatti's, enjoying an inexpensive meal. This allowed the couple to go more places. Even though these places were not fancy or expensive, students still managed to have a good time while spending a small amount of money. Taking advantage of cable T.V., seniors Shelley Miller and Steve Walton spend their Saturday night at home. 240!Best Deal Anywhere Shannon Hills Pharmacy 10400 High Road 455-1086 Free Delivery John Griffin P.D. J ERRY,S Congratulations, Little Bit! You Are The Joy Of 0ur Life. APPLIANCE SERVICE MOM AND DAD 35 17 East Broadway E North Little Rock, AR. 72114 - 9 N 1 Jumbo S Jewelryx GM I9 ' ' E' ro 0 0 i t Try OUP TEOPHIES - PLAOUES - AWARDS - GIFTS - slsr 4 :peg P d Megxingflgffggc h0NCggEVlNG 5 kg For all your fine iewelry needs 552 6804 Q also iewelry and watch repair. ff? fp 92222 JIM PERMENTER snoa Baseline Presideni' 568.4550 x 4 . 'D M h h more than a lighti g t e. Q11 A- M 'fl A 4 doodq uauma G COMPANY 5804 so. UNIVERSITY AVE. . uma Rock, ARK. 72209 . 562-1133 HOME MART B st Dea l Anywhere! 241 STUDENT COUNCIL Front: Jennifer Linkous, Karen Quinnn, Kim Lanier, Carol Eslick. Row 2: Keree Mura- dian, Tina Hill, Sheila Bland, Sandy Weisenfels, Kathy Gallagher, and Paula Shepherd. Row 3: Steve Buck, Jay Stanton, Lynn Lile, Brian Costa, Niesje Nelson. Row 4: Brian Powell. After 3 l0Ug Campalgll N311 Phillips WHS Student Council Wishes To Express A 9lf2Ct9fl Df9Slfl911t only to find Uut She t'Special Thanks To Junior Steve Buck, would h21VG to HIOVG to Afllima her Senior 1984 President. Steve Is The First Junior year. Even though she is no longer attend- President In McClellan History. ing McClellan our thoughts are with her and we wish her much continued success. The Student Council Wishes to Thank All Those Who Cooperated With Us To Make McClellan a Better School. 242!Best Deal Anywhere BEST DEAL ANYWHERE Congratulatlons Tracey We Love You MOM, DAD, AND SPOOK The Race Is Not To The Swift, Nor The Battle To The Strong, Neither Yet Bread To The Wise, Nor Yet Riches To Men Of Understanding, Nor Yet Favour To Men Of Skillg But Time And Chance Happeneth To Them All. Ecclesiastes 9:11 Congratulations g g SFC CARL THARP SSG DONALD GULLEDGE U.S. ARMY RESERVE U.S. ARMY 8501-C GEYER SPRING ROAD LITTLE ROCK, ARKANSAS 72209 OFFICE PHONE ACf501J 562-8191 GO FOR ITV, BE ALL YOU CAN BE . . , BE ARMY Congratulations David! G 81 M BEAUTY SALON This Is My Beloved 10310 Chicot Rd. Son, In Whom I Am Well L.R., AR. 72209 Pleased. Matthew 3:17 565-6576 Congratulations Love, MoM 8z DAD Seniors Of '84 Best Deal Anywh I IBonner's halmacg -f Baseline Thriftway 3600 Baseline Road 565'l59l We Deliver 565-1857 For the best dem meat in town SCREEN PRINTING - MONOGRAMING - C S 5 EMBROIDERY . I ,, ,Q FOR ATHLETIC UNIFORMS ftljv I ic 2 THE KuIIINo Room o GMP 5 6917 GEYER SPRINGS RD , 65 LITTLE ROCK. ARKANSAS 72209 565 5665 PH. 455-2034 565 5669 990 STAGECOACH ROAD LITTLE ROCK, AR 72204 Southwest IPHmrfIigH IHII5 Automobiles DAN RICHARDS, JR. Motorcycles General Manager Power Products Richards Honda 6600 S. University Phone 562-0910 'WJ Little Rock, Arkansas 72209 ,LS H7 pf: P 2 1 - - THE bg' 'tk 1 . fy If ' TRDPHY - X KARATE LESSONS A HOUSE PRIVATE LESSONS ' Instuctors D gflaff Jul P. Young - Off M. Young K- L63 - Bos s. MARV Hueams, o Ph 565-2935 D- Short Pomup 5126 Mabelvale Pike wnm Little Rock, Arlgfsas 12209 - 244fBest Deal Anywhere BEST DEAL ANYWHERE CONGRATULATIONS ELLY You Have Always Made Us So Proud Of You. May God Bless You At This Moment And Always As You Choose Your Path In Life. Love, MOM, DAD, DAWN And ALISDN ot Wired For Sound If you were to ask any student who had braces what one of the most exciting moments in their life was, it would be the day that their braces were removed. It hated them,', many people said when asked. There were different reasons for having to wear braces. Some students may have had an overbite, underbite, or their teeth may have been crooked. My teeth were extremely crooked. My parents said I was getting braces and I cried, Elisa Caplinger commented. Having braces meant having to worry about such unusual things as eating tiny bites of food so as not to get food stuck in the braces, setting off the metal detector at the airport or worrying about kissing another person with braces as being afraid of being permanently locked in an embrace. The pain and agony students went through was enough to make them pull their hair out. Wires would start poking and digging into the sides of their mouth, making it hard to eat salty foods. Some people dealt with the pain in drastic ways. I pulled my last six bottom braces off myself with the plyersf, Kim Jones said. In the end, when the wires and bands were gone and a row of shiny, white, straight teeth appeared, students could truly say having braces was really worth it! .Tammy Salmon, senior, passes the time by reading while waiting for her orthodontist appointment. Best Deal Anywhere!245 gpm Www 'Tj' X Dr. Terry W. Kuykendall, Opmmerrisr Kuykendall Optometric Clinic 8511 new springs Rd. - time Rock, Aim 72209 - 15011568-4218 -1 James The CAT Ballew B622 Cmcot Fld Little Rock, AR Telephone 562-7092 Damon Sralrer - 'Manager Whatever Happened To The Christmas Spirit? Remember the days when your eyes would light up everytime you saw a Christmas tree? Remember when you couldn't wait to have your picture taken on Santa's lap? Remember when you received gifts, but never had to give any? Now, after seventeen years of looking at Christmas tree lights, the thrill isn't completely gone, it's just not as exciting as it use to be. Growing older has also put an end, for some, to sitting on Santa's lap. It was not age, but our increasing sizes that kept many off Old Saint Nick's lap. Increasing prices were also a problem for students. One of the most popular Christmas crazes of the year was the Cabbage Patch dolls. Although many would have liked to give these dolls to their friends or sisters, they were terribly hard to find. If by chance one could be found, its price ranged from forty to fifty dollars. For some stu- dents Christmas shopping was only a hassle. After circling the parking lot twelve times in order to find a parking space, they entered the stores only to find that it was more crowded inside the stores than it was in the parking lot. Senior Trisha Frost voiced her opinion about Christmas shopping, saying, I hate it. Everyone is pushing you and shoving you. For others Christmas shopping really put them in the Christmas time mood. Senior Lee Ann Red said, I love all the decorations and Santa Claus. It all makes me go spas- tic! if Q' Although the weather is bad, Looking for a Christmas gift at shoppers continue to crowd the Target are sophomore Sheri John stores searching for the perfect gift. son and senior Lisa Bohn. 246!Best Deal Anywhere BEST DE L ANYWHERE ,...., fff 4, 'W fir W tam We X g N Af A M ,Vi nn,k ,, ,, . ji-' f 1- H f f 7? f f 42 5 , WW, 474' Q7 ef Wu v ,ff , W I iw W f f If K W f if , , WW Congratulations Keith Foster Since March 24, 1981, You Have Been A Special Part Of My Life. Work Hard For What You Want In Life And It Will Be Rewarding To You And Those Who Love You. May God Bless And Guide You Through Life's Journey. Love Always, YVONNE RUSHING TERRY AUTO CARE Complete Auto Sz Truck Repairs Niase Certified Mechanics Fleet Account Specialists! Preventive Maintenance 0 Engine Tune-up ' Electrical Alternator-Starter Repairs ' Brakes 0 Wheel Bearings 0 Front End Alignment 0 Muffler And Exhaust ' Air Conditioning Service f Engine Cooling Systems Service ' Shock Absorbers O Engine gl Transmission Overhauls ' Electronic Tune-ups ' House Calls 0 Towing Call Us-We Care 455-0591 10224 Sibley Hole Rd. South Of I-30, West Of Mabelvale Pike Specialist In Diesel Autos SL RV's IIIILE f -,.r,MM, xfxss.,fw .. femirwe-merwssrwigswffwfr ...Q-, CMM... ,,,.cW.. was ia. .1 1. ,.....,,,, 'ill 1 as .. -:. -- : . gg Q, gl : Q t if. J srco 'fff5'55i r as X 3-xk E L X yi 3--gwssgsgsggfgwgvf-fsegeigggl Q 5 . ,egg MAFIA: Paul Hannon, Treasurerg Jeff Haslauer, Treasurerg Steve Walton, Treasurerg Mike Pierce, Treasurerg Scott Allen, Treasurer, Casey Whitt, Treasurerg Mark Jackson, Tre 66 ' 9 Every Girl s Craz asurerg Mafia Apprentice, Mitch Mitchell. y About A Sharp Dressed Man. Best Deal Anywheref247 Congratulations, Todd cacanzica cvqu gun oflf . When Are You Moving :pangs gmmic Out? C Just Kidding! LRMEN ORM SEAN Congratulations, ... - . Katrina! Congratulations, Seniors I Love You And Am Proud Of You. God Bless You And R, F, GRAVES Be With You Throughout Your Life. May You Have 9100 G y Sp- g R d High Achievements And Ltd R k AR 72209 Much Success. Love, MCM CT+fsl4l -f.Qr3,5gi 1 ' ' F ' H woke s cur cushions , 552255 , Men, Women, 8: Children Hair Styling 8: Cutting Open Tues., Thur., Sat. Permenents - Henna - Frosting - Ear Piercing 562-074l 75 I 5 Geyer Springs Rd. 562-074l , stiff Qggsizjiylg Southpark Center 8!B lA 11 BEST DEAL ANYWHERE T' C Complete Commercial 8: Personal Ins. Services John R. Eggers 5612 Geyer Springs Road Hubert S. Puckett Off. C5015 568-2668 Little Rock, Arkansas Off. C5015 568-2668 Res. C5015 225-7674 72209 Res. C5015 227-4335 Life ' Health ' Group ' IRA 1- I E9 ' , .--i:f93.',1:ia H JOHN E. BUTLER, D.D.s., P.A. s5 I ' STEPHEN A. scofrfr, D.D.s. C aa gs HARVEY E. SMITH, JR., D.D.s. s J A Congratulations, ' Y Baseline At Chicot Jamle' Cloverdale Center We Love You! Little Rock, Arkansas 72209 gffige Hours Telephone I D AD, y ppolntment 562-8273 B f Deal Anywhei-sizzle CONQIUZUUQEAUIONS JQCHQNQA Keep God First In All You Do. Love - MOM, DAD, GINA, STEPHANIE, AND STONEY CHEROKEE CONSTRUCTION CO. P.O. Box 7213 Little Rock, Arkansas 72217 15015 945-9489 Jimmy L. Rowe Congratulations, Karen President We Love You YOUR FAMILY DEAL ANYWHERE HAN 'S SENIOR PAGE I Can't Get No Satisfaction Rolling Stones Qc Q, ' z A T96 , . Q z Q , , , ., M H l' is cs ll o 'Ye Q er 1 45 'Q '7 vffzzi W' . mrzafc ,f Z, :U Happiness Is A Warm Gun. 4'a,,,Q Beatles Pm In A State Of Confusion Kinks Because Life Is Rough And Things Don't Go Our Way, People Associate Misfortune As A Negative Experienceg But There are Lessons To Be Learned In Personal Misfortunes. So, Remember That There ls Always A Positive Side To Everything. Life May Be Difficult, But lt ls Also Challenging. HAN Qnuzw cum L 55 OF X84 Best Deal Anywheref25l K ff nav uus Congratulations Seniors Front: Karl Steinkraus, Lisa Hupp, Andrea Lanham, Brian Costa, Han Choi, Michelle James, Heidi Minick, and Rhonda Smart. Back: Jamie Johnson, Hob Wood, Olivia Garcia, Mark Milstead, Shaw Drummond, Lynn Lile, Dede Dunn, Clay Causey, Brett Carroll, and Tina Sanges. Loud And Clear On Friday night on Geyer Springs, you don't have to turn on the car radio or stereo. Just roll the windows down on your car, and you will have music from every direction. Whether it's Pioneer, Kraco, or Panasonic for the car or Sound Design, Sony, or Pioneer for the home, some stu- dents saw no limit to having the biggest and the most expensive stereo systems available. A basic sound system may cost from S5150-8400. Howev- er, most students insist on a system that produces LOUD music, so they add equalizers and boosters to make the music loud and clear. This addition may cost from S60- 5150. But to really maintain that loud volume, students search for speakers that can handle the wattage of their stereo systems. A good pair of speakers could cost up to 312.00 These speakers are quaranteed to create Crucial pain in the eardrum. No matter how large or expensive a system, there will always be one student who will claim that his is even larger and more expensive. Another type of stereo system displayed in a 1984 Corvette is a Delco - Bose GM. 252!Best Deal Anywhere DEAL COPY CHT Southwest Little Rock's OFFICE SUPPLY 81 PRINTING STORE OUICK COPY 0 QUALITY 0 COLOR THERMOGRAVING 0 OFFSET OFFICE SUPPLIES 5 4 fm. Congratulations N' 3-img? Seniors Ill Sv OFFICE SUPPLIES 81 PRINTING 8 g2Q'1f.QQl, QT' FRENCH CLUB 'IED' PIPES XEUBFGGUS WINDAMERE PLAZA 8211 GEYER SPRINGS ROAD LITTLE ROCK, AR 72209 C5011 562-5612 e YIV , A Y BDIA WARDEN MOTORS Volkswagon, and Subaru catch the attention of seniors Elisa Caplinger, Tracey nd Trisha Frost. BMW - Subaru - Volkswagon Whei' 1 b ih Y Sal S 8450N B t H Lttl R k 562 1161 WALTER WARDEN Res. Phone 225-179 NATIGNAL HONOR SUCIETV The National Honor Society Salutes The 1984 Graduating Senior Members I 9214 New Benton Hlghway May All Your EX1 130 130 Dreams Come True' 562 6191 Love, MGM 8z DAD llpen M-F 95 BO0K EXCHANGE used paperbacks for sale or trade 6622 Baseline Rd., LR. 72209 555 3583 4 WHEEL DREVE OF ARKANSAS 10308 U2 Chicot Road Little Rock, Arkansas 72209 568-0917 Owner - Kevin Pledger For Your On and Off Road Accessories gilnls Qamify dfaizcuffsms ll a z u r h a 1: ll - J- . ff fgbin Good Luck Semors of '84 , , 8 - ' from all the Stylists 5 QB' sesame. X 1 COLONY SOUTH,SHOPPING CENTER ER grqqigEG5OaC5figi,Nf T r a n sm ISS I a n Razorback Transmission Service MATLUCK RUBBER Exchanged 81 Repaired STAMP SERVICE . 7604 Geyer Springs Rd. LiHle Rock, AR 72209 All Marking Devices SANFCRD BOW Available On Order. 562-546 I We Make Good Rubber Stamp Fast. Western Sizzlin ie ,f ' E EZ' Q -:eg o o Congratulations nw y I Daryl. E L f 1 We Love You, 83I2GeyerSprings Rd. 565-5813 DAVID AND DENNIS 256fB tD lA h - '- BEST DEAL ANYWHERE Congratulations, Keree Muradian MURADIAN AND CO. I The Homestead Gift Shop 8z Tennis Center Specializing in Beautifully Q2 Handcrafted Gift Items 5 l Handmade Quilts ' Cera .V Macrame ' T y I 3926 B L' Rd ase me . , 582-2827 5 3 WEDDINGS NOTARY PUBLIC KRIS MURADIAN JUSTICE OF THE PEACE District 4 568 4600 6000 B 1 Rd OR 562 5774 L R1 R k AR 72209 Congratulations Class Of '84 MABELVALE YOUTH ASSOCIATION Little Oaks Park, Mabelvale, Ark. Ed Welsh, President B D Tvusf VDUP MemoPiQs To Usa, WQJJinqs SQNOP Dovfroifs Convcanfions Social Evcenfs Qufdoor D0PfPcJifuPQ o You R PH OTOGRAPHEQ4 P QGPHQM RC if ff' 4Wlg?Qf ' Jumolzs QQ up 5 5 ,DX My 1 ...a Y QflgXQzLQQ,0QQgy QQQNU k X6 N C,,xX,5-,ANXQK gkvj M I X N N fQbJ1U-Jf,g- N1xCA CFIQU MCH I fiv1 1 Qmb7 Q Sfm :wg if 'mwli atm JNllJ.,4 I QJUV N313 lm- L, f x A 5 J w1Qp,QmLw 5 S0 fi ww ,, K , V-1 ,- ' 03-111 x.. 'R k' ,fy K3 S 260!Best Deal Anywhere F WEE 7 'ZX f 'Q-QQ, XX if Jxwxx , : . 5 E Y E? seNloR5wVQMpS3iD m ' xg 3 ' . , W 0, A HM Q M yy yyy v Agmgziy 5 j fi gmt B,gfQwfl2i W W Mm My-K3 V WN? uv , X N : W A Wu okjxwoiyfl . x lfx iz wf i M Gigi W GJ W , N Q ,N A Ly gf Ufwiiiifgi M of 6 ' o5y15v5cQ5U5A'JA'J.PwJy ,CW U1 - U. JU L Qawpiyf ' ' M A J' ZLJQOLS cf ya, if MQW Sway i aww AAA Trophies 228 Abbott, Deanna 137, 126 Abrams, Virginia 207 Acre, Cheryl 188 Adams, Nancy 207 Adams, Terela 170 Adcock, William 170, 270 Adkins, Debbie 54, 188 Afterthoughts 79 Agnew, Kelli 40, 71, 170 Akins, Mark 68, 109, 137, 125 Akridge, Dawn 52, 53, 188 Akridge, Michael 76, 137 Al Ahamadi, Hani 188 Albritton, Carl 72, 91, 137, 139 Alewelt, Brian 76, 137, 77 Allen, Glenda 68, 170 Allen, Luther 188 Allen, Rodney 94, 188 Allen, Scott 42, 125, 137, 247 Alpha Beta Nutta 222 Als, Darrell 137 Alvarez, William 72, 188 Anderson, Charles Anderson, Christina 207 Anderson, Genia 188 Anderson, Mike 64, 207, 209 Anderson Nancy 188, 236 Anderson? Ricky 45 Archer, R Arendt, A Arkansas Arkansas obin 137 llyn Transit Homes 220 Vacuum 237 Armstead, Cheryl 188 Armstrong, Alice 170 Art Club Officers 72 Atkins, Charolette 205 Atkins, Debra 137 Atkins, Harold 170 Atkinson, Beth 1, 57, 68, 188, 44 Austin, Hope Ayers, Angela 188 Bagley, Darlene 68, 170 Bagwell, Laura 137 Baham, Raymond Bailey, Kelly 71, 137 Bailey, Paul 188 Bailey, Rebecca 137 Baker, Jody 188 Baker, Stephanie 54, 188 Baldwin, Ernest 188 Baldwin, Kirstie 72, 188 Ball, Kenneth 40, 170, 205 Ballard, April 170 Banks, Patrick 170 Banks, Tracey 188 Barbee, John 188 Bardouche, Joseph 170 Barnard, Kim 57, 188 Barnes, James Barnes, Patricia Barnett, Shelley 189 Barry, Donna 72, 170 Barry, Patrick 189 Baseball Team 110 Baseline Pharmacy 244 Bateman, Julie 137 Bates, Donna 189 Bates and Pearson 223 Battershell, Geroge 189 Baughman, Ricky 137 Baxter, James 41, 125, 170 Baxter, Troy 189 Beard, Mary 207, 209 Beard, Robert 170, 123 Bearden, Lesley 25, 71, 170, 44 Bearden, Pamela 71, 137 Beasley, Cassius 137 Beckner, James 189 Beckworth, Kay 71, 207 Beggs, Marla 84, 230, 48, 123, 167 Bell, Michelle 189 Bennet, Debra 189 Bennet, Holly 72, 189 Bennet, Kristi 57, 189 Benson, Brian Benson, Terry 189 Berry, Lavonne 72, 97, 207 Besancon, Richard 76, 125, 137 Bess, Angela 189 Bess, Lonnie 170 Bethea, Tommy 79, 93 Better Mouse Trap Candy 228 Betterton , Yvette 79, 170 Billingsley, Beverly 68, 72, 207 Billington, Jennifer 189 Bills, Cynthia 71, 137 Bisbee, Brett 21, 42, 137 Blackman, Ann 41, 189 Bland, Sheila 20, 57, 64, 170, 242 Blaydes, Brian Blood, Raymond 138 Blue, Monte 32, 42, 76, 110, 112, 170 Bob Logan's Carpet 8: Such 237 Bobo, Yolanda Bock, Teresa 87, 189 Bocksnick, Melissa 40 BOE 71 Bohn, Karen 138 Bolin, Lisa 68, 72, 138, 224, 246. 48, 123 Bonds, Lu Bondurant, Bryan 189 Bonner's Thrifway 244 Bonney, Marvin 67, 72, 170, 48 Boone, Desheral 189, 128 Book Exchange 255 Booth, David 109 Booth, Michelle 20, 57, 170, 181 Bowden, John 189 Bowerman, Angela 170 Bowie, Jacquelyn Bowlly, Sylvia 138 Bowman, Bob 109, 207, 123 Bowman, Kim 189, 51, 126 Bowman, Tabatha 41, 79, 190 Boyce, Boyd, Rebecca 71, 138 Johnnie 170 Boydston, Teresa 67, 71, 138 Boyle, Michael Boys' State Delegates 14 Bradford, Derrick 138 Bragg, Gary 190 Brandow, Carla 190 Branigan, Don 41, 170, 114 Brannon, Collin 125, 190 Brannon, Joey 60, 72, 170 Bransford, James 170 Branti Bratto gan, Laura 33, 138 n, Steven 170 Brauer, Kim 40, 190 B 8z R Breedi Auto Supplies 226 ng, Kevin 7, 38, 42, 43, 67, 170, 48, 45, 123 Breedi Breedl ng, Melanie 20, 57, 190 ove, Ezell 170 Brewer, John Brewer, Melvin 190 Bridge s, Mary 207 Brimer, Bobby Brimer, Ronald Briner, Michelle 190 Brink, Mona 71 Brister, Maurice 125, 190 Broadway, Danielle 71, 170 Brockway, Michael 190 Brooks, Bobbi 54, 61, 170 Brown, Barbara 138 Brown, Donaldson 190 Brown, John 190 Brown, Kathleen 170 Brown, Michael Brown, Michael Brown, Suzan 190 Brown, Tamara 90, 190 Brown, Torrae 79, 190 Brown ing, Jerry 170 Browning, Keith 109, 110, 111, 186 Bruce, Bruce, Patricia 138 Paula 138 Bruner, Lisa 43, 67, 190 Brunson, Shelly Bryan, Kelly 173 Bryant, Debra 190 Bryant, Tracy 57, 68, 71, 138, 233, 234 Buck, Stephen 40, 42, 64, 68, 173, 242, 45 Bull, Sonny 109, 110, 207 Bulla, Robbie 190 Bulla, Steve 190 Bullard, Anna 9, 138 Bullington, Ed 67, 207 Burch, Ronald 190 Burchfield, Greg 173 Burgess, Lisa 9, 42, 59, 138, 23, 45 Burke, Thomas Burnett, Pam 43, 190 Burnside, Richard 190 Burton, Audrey 43, 190 Burton, Michelle 42, 43, 68 138, 45 Butler, John E. 249 Butler, Phillip 190 Buxton, Chris 190 Bynum, George 40, 92, 138 Bynum, Keith 190 Caldwell Freda Calhoun, Andy 80, 190 Cameron, Bobby Cameron, Charles Cameron, Howard 173 Campbell, Chris 110, 173 Campbell, John 76 Campbell, Kathy 138 Campbell, William 173, 270 Cantwell, Kristi 173, 123, 127 Caplinger, Elisa 14, 15, 58, 138, 237, 254 Capoot, Jimmy 173 Carey, Alana 87, 190 ,86 Carey, Billy 79, 138 Carroll, Bret 67, 109, 139, 156, 252 Carroll, Misti 57, 190 Carter, Angie 134, 234 Carter, Bradley 139 Carter, Keith 125 Cartwright, Cynthia 139 Cartwright, Maburn Cash, Chris 125, 190 Cash, Joey Caster, Mark Caster, Ronnie 140 Caster, Stephen Castillo, Randy 76, 140 Cat Ballous 246 Cates, Anette 140 Cates, Kenneth Cathcart, Mary Cathcart, Steve 190 Cathey, Michael 140 Catlett, G. 190 Cato, Melanie 190 Causey, Clay 67, 140, 252 Cazer, Mark Cearley, Kerrie 71, 140 Chandler, Melanie 59, 60, 67, 168, 173, 181 Chapman, Haley 21, 68, 173, 102, 120, 121, 123 Chapman, Kim Chapman, Lonny 140 Charles, Steve 41, 173 Chartrand, Leslie 72, 124, 189, 191, 44 Chase, Preston Cheerleaders 54 Cherokee Construction 250 Childers, Wendy 57, 67, 68, 173 Chism, Donald 173 Choi, Angie 191, 44 Choi, Han 14, 33, 67, 68, 87, 109, 131, 140, 234, 251, 25 Clanton, Joey 26, 72, 173 Clark, Chris Clark, J. 171, 173 Clay, Jeffery 140 Cleveland, Sherry 92, 140 Clifft, Donnae 140, 233 Clifton, Todd 191 Cloud, Earl 207 Cloverdale, Florist 222 Clowney, Veronica 191 Coaching Staff 109 Cobb, Shannon Coca Cola 253, 255 Cochran, Joseph 140 Cochran, Patricia 173 COE 71 Coffee, Brent 31, 92, 173 Coffman, Pam 173 Coil, Darren 79, 191 Colbert, Rhonda 173 Cole, Jamie 30, 31 Coleman, Michelle 57, 68, 173 Collie, Vickie 71, 140 Collins, Dewain 68, 109, 140 Collins, June 5, 20, 21, 140 Comic, Kim 173 Conner, Jennifer 79, 140, 207 Conner, Judy Consept II 221 Conway, James Coon, Jon 173 Copy Cat 253 Corley, Greg 68, 173, 114 Costa, Brian 14, 34, 64, 67, 68, 140, 234, 242, 252 Cothren, Martha 68, 109, 207, 211, 120, 123 Covill, Cheryl 40, 191 Cowart, Danny 41, 42, 171, 173 Cox, Danny 135, 140 Cox, Kenneth 173 Cozart, Alan 40, 42, 47, 68, 140, 118, 115, 114 Craig, Kim 68, 141, 44, 123 Craig, Steven 191 Crawford, Gwen 191 Crawford, Laura 141 Crockett, Lisa 173 Crockett, Mark 76, 141 Croney, Chris 76, 141 Cross, Bob 35, 205 Crossland, Gail 142, 45 Crouch, Deana 191 Crouch, Jeana 13, 57, 89, 142, 233 Crowder, Lisa 123 Croy, Charles 191 Crump, Stacy 72, 139, 173 Cullins, Phillip 68, 142 Cummings, Laura 173 Cummings, Sue 71, 207 Cupps, Keefe 191 Curenton, Sandra Curenton, Tammy 76 Currier, Kim 173 Cushing, Melissa 72 Dacus, Gia 41, 142, 44 Daley, Deanna 142 Dancy, Tawana 72, 173 Daniel, Corena 173 Darnell, Serinda Flowers, Carla 192 Darra 72, Com, Debbie 58, eo, es, 173, 177 Davenport, Loretta Davidson, Sharon 173 Davis, Carla 57, 45 Davis, David Davis, Debra Davis Donna 40 59 68 Davisi James 142 i Davis, Kim 57, 169, 174 Davis, Leundra Davis Mary 142 Davisj sheua Davis, Tracie 41 Davis 143 , Valesa 10, 41, 42, , 45 Deases, Rebecca 71 Debusk, Kimberly 191 DECA 71 Deel, Sheryl 174 Degler, Johnnie 191 Delaware, Felicia 143 Dennis, Cynthia 71, 143 Dennis, Kim 54, 191 Dickerson, Terry 143 Dickey, Lynda 174 Dickinson, Anthony 191 Dickinson, Christine 143 Dickson, Byron 109, 143 183 Herbert, Rose 194, 185 Dickson, Paul 191 Diggs, Brady 171 Dillard, Betty 57, 174 Dillard, Reginald 3, 61, 109, 125, 143, 126, 114 Dilworth, Earl 207 Dixon, Chris 72, 191 Doles, Ricky 191 Doolittle, Brian 125, 191 Dorrell, Brenda 42, 143 Dotson, Vera 174 Douglas, Alan 125, 191 Dovers, Lorene 174 Dovers, Melissa Draper, Murray 42, 174, 45 Drummond, Shaw 144, 252 Duckett, Andrella Duff, Brian 76, 144 Dunbar, Tammy 174, 44 Duncan, Beth 191, 44 Duncan, Lisa 141 Dunkum, William 42, 174 Dunlap, Regina 40, 41, 174 Dunlap, Rhonda 72, 144, 250 Dunn, Donnah 144, 252 Dunn, Gary 174 Dunnahoo, James 191 Dupree, Ronda 42, 53, 174, 44 Durham, Michael 144, 248, 270 Durham, Sean 60, 67, 71, 72, 174 Durham, Vicki 174, 123 Dwyer, Jamie 192 Dyer, Daron 174 Dyer, Tonya 41, 192 Dykes, Crystal 184 Ealy, Dewayne East, Darla 174 East, Deronda 57, 72, 192 Ebsen, Tyron 192 Edgin, Donald 192 Edvgards, Melinda 57, 67, 68, 1 4 Ellington, James 192 Ellis, Brett 125, 192 Ellis, David 174 Ellis, Gregory 144 Elrod, Sherrie 71, 144 England, Wesley 192 Ennes, Ronald 192 Erickson, Edward Eslick, Carol 57, 64, 174, 242 Ester, Sharron 68, 174, 123 Etheridge, Dana 192 Evans, Carol 76, 144 Ewing, Tesha 144 4-Wheel Drive of Arkansas 255 Falls, Tom 3, 10, 42, 144 Favre, Cassandra 174 Favre, Jeremy 192 Favre, Katrina 71, 144, 248, 133 FBLA 71, 234 FCA 62, 68 Fellows, William 86, 95, 144 Fenton, Dawn 43, 192 Ferguson, Shelley 14, 15, 40, 57, 67, 68, 87, 131, 145, 232, 233 FHA 75 Fielder, Terri 55, 207 Fire Marshalls 40 Fisher, Cheryl 57, 67, 68, 72, 168, 174 Fisher, Joan 145 Fitz, Don 226 Fitzgerald, James 192 Flagline 53 Fleming, Ceclia 174 Fleming, Mary 42, 47, 71, 145, 45, 133 Fletcher, Sherri 20, 43, 54, 72, 192 Flowers, Rosalia 174 Floyd, Trilby 79, 192 Folsom, Kerrie 57, 174 Ford, Oliver 205 Ford, Ronnie 145 Foreman, Alvin 192 Foreman, James 174 Foster, Keith 145, 235, 247 Foster, Michael 145 Foster, Stephen 192 Four Seasons 226 Frazier, Trip 145 Fred's 220 Freeman, Ann 41 Friedl, Carolyn 207 French Club 72, 253 French, David French, Donna 42, 43, 125, 174, 45 Fritz, Richard 145 Frost, Jeff 174 Frost, Trisha 58, 68, 145, 225, 254, 133 Fuller, Jimmy 68, 72, 174 Fuller, Nattalie 41, 174 Fulmer, Keith 129, 145 Funches, Eric 192 G8zM 243 Gallagher, Kathy 9, 14, 30, 34, 42, 64, 68, 72, 145, 242, 45, 133 Galloway, Sean 61, 174, 45 Gamble, Elvin Gann, Dewane 174 Ganter, Beth 68, 207 Garcia, Olivia 67, 68, 145, 148, 252, 133 Garcia, Rolando 96, 193 Gardner, Mike 125, 193 Gardner, Mike Garrett, Robert 193 Garrett, Wesley 175, 77 Garrison, Tavia 174 Garvin,- Gina Gatliff, Samantha Gentles, David 76, 193 George, Phillip Geurin, Kelley 40, 76, 207 Geurin, Steve 207 Geyer Springs Baptist Church 227 Geyer Springs Business Machines 221 Gibson, Jill 67, 72, 174 Gideon, Karen 193 Girl's Chorus 43 Girls' State Delegates 14 Glover, Barry Goodson, Anna Gordon, Alfrida 174 Gordon, Antoine 109, 125 Gordon, Larry 193, 45 Grabher, Phillip 41 Grable, Christie 54, 193, 44 Grant, Norman Graves 248 Gray, Clardell Gray, Darlicia 193, 123 Gray, Gloria 174 Gray, Michael Greenwood, John 193, 44 Greer, Antonette 40, 71, 234 Gregg, Kimberly 72, 176, 45 Gresham, Martha 204 Griffin, Aleda Griffin, Dennis 41, 42, 110 Griffin, Michael Griffin, William 90, 193, 194 Grim, Penny Grose, Brian 193 Grounds, Lewis Grundy, Rafeal 193 Guess, Gina 68, 193, 123 Gun Exchange 222 Gunnels, Bridgette 40, 68, 193 Gunnels, Charles 125, 193 Hadley, Jimmie 193 Hairloom 223 Hall, Donovan Hall, Julius 193 Hall, Kelly 176 Hall, Sharon 193 Hall, William 72, 193 Hallford, Paige 2, 24, 57, 68, 176 Hallum, Kimberly 72, 194 Hambrick, Sylvia 41, 79, 176 Hamby, Bryan 194 Hampson Lanell 207 Hamilton, , James 172, 176, 114 Hampton Krstie 72, 207 Hampton Lisa 194 Hampton Letetia 41, 234, 133 Ham ton Warren 71 P y Hancock, Virginia 40, 194 4, q M 2' ,seniors Tri Elisa Caplinger at Shop. Hartwick, Timothy 32, 41, 194 Harvell, Bobby Haslauer, Jeff 18, 23, 42, 43, 63, 67, 129, 131, 239, 247 Hatcher, Marianne 71 Hatfield, Larry 176 Hawkins, Joyce 41, 207 Hawkins, Richard Hayes, Daren 194 Hayes, Kenneth 40, 76, 194 Hayman, Regina 68, 71, 234, 44 Hayman, Rhonda 40, 194, 127 Haynes, Gary 194 Heard, Reginald 194 Heatherly, Will 68, 72, 176 Heavrin, Tonya 194 Hefton, Chad 41, 176 Heifner, Cheryl 176 Henderson, Carlos 194 Henerson, Laureen 17, 57, 176, 181 Henderson, Sheila 176 Hendrickson, Kelly 79, 176 Henley, Cheryl 194 Henry, Adell Henry, Mike 129 Henson, Shelley 59, 68, 72, 176, Herndon, Jamie 76 Herndon, Jeannie 194 HERO 75 Herring, Paulette 208 Herring, Randy Herring, Robert 194 Hicks, Douglas 68, 79 Hicks, Gene Hicks, Gregory Hicks, Jeff 72, 125, 194 Higgins, James 14, 40, 67, 72, 76, 133 Hi hlander Choir 42 M... weary fa annual yeaari Acid their own steaks at Haney, Kenneth Hannon, Paul 63, 112, 226, 247 Hardeman, John Harding 238 Hardgrave, Greg 67 Harrell, Delores Harris, Anjolina 68, 194, 123 Harris, Kenneth Harris, Regina 194 Harris, Robert 129 Harrison, James Harrison, Jeffrey 41, 194 Harrison, Sheila 57, 233 Hart, Barbara 57, 68, 176 Hartness, Robert 194 Hartwick, Robert 40, 76, 176 Hartwick, Ruth 204 g Hill, Angela 176 Hill, Dwight Hill, Harold 14, 72, 109, 110 Hill, Patrick 27, 29, 67, 92, 99, 109 Hill, Reginald 194 Hill, Tena 64, 176, 242 Hilliard, Polly 17, 27, 72, 129 Hillman, Gerald Hinson, Joe 65, 71, 109, 229, 272 Hinson Keith 110, 168, 176 Hinson Keith 194 Hinson Robbin 194 Hinson Tina 17, 42, 72, 176 Y Hoeseh, Sonya 79, 176 Traditions Indexedf263 Holden, Keith 176 Holleman, Bobby 176 Holmes, Suzanne Holt, Goldie 194, 123 Honey, Rebecca 17 Hood, Kenneth 17 Hood, Mark 195 Horn, Eddie 110 Houck, Fred 208 House, Marcus 195 House, Mike 60, 136, 255, 44, 123 Houston, Bernadet Howard, Lisa 76 Howard, Nancy 205 Howell, Barbara 41 Howell, William 195 Hubbard, Mike 56, 176 Hudson, David 79, 125, 159, 42 Huff, Bryan 195 Huffman, Eddie 195 Huffman, Sue 176 Huggins, Charles 40, 71, 176 Huggins, Mary 40, 72, 195 Humbard, Martha 208 Hunecker, Lana 42, 43 Hupp, Lisa 40, 252 Hutchins, Richard 195 Hyatt, Kathy 195 Ingram, Charles Ingram, Stephen 76, 78, 79, 176 Irby, Boyd 195 Isbell, Paul 72, 176 Ishmael, Tamara 71 Isom, Anglea Johnston, Brenna 58, 191, 195, 208, 234 Johnston, Dana 71, 133 Johnston, Lisa Johnston, Lonnie 208 Johnston, Michael 195 Johnston, Phillip 177 Jolliff, Kara 4, 13, 14, 15, 42, 43, 68, 72, 45, 133 Jones, Ashley 196 Jones, Glorice 196 Jones, Hal Jones, James 177 Jones, Kathryn 40, 196 Jones, Kim 71 Jones, Kim 42, 72, 82 Jones, Nancy 208 Jones, Tiylous 172, 177, 114 Jones, Wa ne Jones, Y Carroll 196 Jordan, Debra 196 Junior Senators 64 Michael 177 Keith, Kelley, Carol 196 A Kelley, Gant Kelley, Lajuana 40, 71 Kelley, Malous 177 Kelley, Paul Kelley, Michael Kem Patricia 178 X .,,., Q 444,24 Seniors Reign became the slogan for the veteran competitors at Almost Anything Goes. Leatherwood Crafts 253 Ledford, Terry Lee, Terry 125 Leggett, Michelle 14, 67, 153, 164, 133 Lemons, Gregory Lesher, Jeffrey 196 Majors, Don 196 Majors, Jon 196 Mallory, James Malott, Denise 196 Malott, Richard 42, 153 Manees, Bobette 208 Manley, Jamie 178 Jackson, Betty 176 Jackson, Doris Jackson, Jeffrey 195 Jackson, Latresa 177, 51, 44 Jackson Lauren Jacksonl Leslie 43, 71 Jackson Mark 42, 43, 58, 72, 90, 91,, 131, 230, 247, 133 Jackson, Michael 40, 176 Jackson Timothy 195 James, Bobby 76 James, Michelle 65, 131, 252 James, Mitch 40, 67, 109, 272 Jarrett, Teresia 41, 176 Jarrett, Vickey 177 Jazz 43 Jefferson, Milton Jeffery, Kari 79, 195 Jenkins, Bobbie Jenkins, Jeffery Jenkins, Robert 79, 92, 144 Jerry's Appliance Service 241 Jester, Kim 195 Johnson, Anthony 195 Johnson, Bethany 68, 195 Johnson, Brigette 57, 229, 233 Johnson, Edith 195 Johnson, Estella Johnson, Gretta 195 Johnson, Jamie 58, 67, 72, 76, 131, 249, 252 Johnson, Jamye Johnson John 177 Johnson, Keith 177 Johnson Lynetta Johnson, Melanie 195 Johnson, Rodney 68, 98, 109, 125 Johnson, Sherie 24, 195 Johnson, Terri 40, 53, 195 Johnson, Thomas 67, 68, 109 Johnson, Tommy 177 Johnson, Tracy 43, 195 264fTraditions Indexed P, Kendrick, Derrick Kennedy, John 67, 178 Kerr, Colin 196 Kerr, Lisa 53, 178 Ketcham, Matthew 72, 169, 178 Ketcham, Scott 68, 72, 175, 178 Ketcham, William 68, 72, 84, 133 Key Club 67, 252 Kidd, Jason 125, 196, 201 Kidd, Vernita 196 Kight, Shelley 196, 48 Kilbury, Scott 196 Killian, Stephanie 57, 68, 233, 133 Killingsworth, Jennifer 40 Kimbrell, Karen 178 Kindervater, Gerhardt Kindy, Rhonda 57, 196 King, Anita King, Arnard 76, 178 King, Brooks King, Jerri Bob 208 Kirk, Karem 43, 178 Kirkpatrick, Kimberly 68, 196, 44 Kling, Timothy 42, 95, 112, 178, 45 Knight, Thomas 196 Kuhn, Todd Kuykendall, Dr. Terry 246 Kutting Room, The 244 Lamb, Greg 42, 68, 110, 178 Lancaster, Beth 1, 57, 157, 233, 44 Landrum, Anna 68, 178 Landrum, Stanley 76 Lane, Danny Lane, Ronald 196 Lanham, Andrea 40, 252, 272 Lanier, Kim 24, 60, 64, 67, 178, 242 La Provacateur 67 Larry Robinson Studios 258 Lauderdale, Paul 114 Lauderdale, Tollisa 178 Lavender, Lara 41, 71, 178 Lawrence, Christopher Lester, Archie 68, 178 Lewellen, Scott 27, 67, 72, 153 Lewis, Alencia Lewis, Debra 153 Lewis, Donald 42, 178 Lewis, Gregory 41, 196 Lewis, Hollie 196 Lewis, Mark 79, 196 Library Aides 41 Life Line Baptist Church 232 Lile, Keith 41, 196 Lile, Lynn 14, 64, 67, 68, 153, 242, Lindse Linkous, Jennifer 5, 9, 14, 20, 252, 133 y, Jo 42, 153 Manning, Demetria 153 Manning, Reginald Marbley, Canta 197 Markham, Kimberly Marsh, Robert 67, 68, 72, 178 Marshall, James 40, 178 Martin, Bernard Martin, Carlynn 53, 76, 197 Martin, Deidra 53, 72, 178, 48 Martin, Melissa 1, 57, 68, 197 Martin, Tommy 95, 110, 112, 178 Mason, Cynthia 178 Mason Monica 67, 178 v 21, 57, 64, 153, 233, 239, 242 Lionettes 57, 233 Lionette Drummers 56 Lion Lines 239 Little, Juanita 196 Livingston, Joey 76, 153 Lockert, Victor 153 Lody, Chuck 19, 178 Logan's Alignment Sr Brake 223 Lomazoff, Michael 178 Long, Floyd Long, Lloyd 196 Long, Sandra 196 Long, Terry 42, 57, 153, 233, 241 Longboat, Michelle 71, 153 Looper, Jamia 196 Los Amigos 72 Louks, Rebecca 196, 123 Lowry, Angela 41, 196 Luce, Kelly 42, 79, 153 Luster, Frank 196 Luster, Doyle 196 Luzader, Donald 194, 196, 44 Lyle, Steve Mabelvale Youth Association 257 Maddox, Cynthia 72, 178 Mafia 247 Magby, Scott 153 Maglione, Eduardo 196 Magness, Bonnie 41, 208 Magness, Melissa 54, 196, 44 Majorettes 53 Massey, Brady 42, 153, 48, 45 123 Mathis, Mark 196 Mathis, Michelle 41 43, 197 Mathis, Billy 16, 76, 153, 77 Matlock, Eddie 109, 125, 153 Matlock Rubber Stamp 256 Matthews, Julie 42, 53, 153 Mattingly, Don 197 Mattingly Furniture 220 Maulden, Elizabeth 178 Mauldin, Stephanie 154, 133 Mauldin, Wendell 71, 154 May, Stanley 72, 178 Mayes, Andy Mayes, Wendy 1, 57, 197 McAdory, Deanna 57, 72, 197 McAfee, Daron 26, 54, 197 McAvaney, Janine 154 McBride, Carl 125, 197 McBrier, Bobby 178 McCall, Missy 57, 197 McClain, Daron 197 McClain, Mark 154, 114 McClanahan, Bill 72, 208 McClellan Band 69 McClelland, Jeffery 14, 40, 68 110, 144, 154, 133 McClelland, Justin 109, 110, 154 McClendon, Reginald 197 McClendon, Terry McClure, PJ 76, 178, 270 McConnell, Tonya 179 McCoy, Cassandra 154 McCranie, Michael 154 McCullough Sheila 154 McDaniel Realty 255 McDermont, Sandy 57, 197 McDowell, Kelly 179 McElroy, Gary 179 McElroy, Lloyd 197, 114 McFadden, Andre 197 McDonald, Timothy 197, 51, 50 McFadden, Gary 68, 110, 179 McFarland, John 179 McGinness, John 40, 179 McGinness, Mark 197 McGuire, Deborah 68, 179 McKinney, Tom 109, 119, 118, 114, 117 McKenzie, Ellan McMahan, Jill 57, 68, 72, 197 McManigal, Jamie 68, 154, 134 McMillan, Fred 68, 125, 186, 197 McMillan, John 68, 110, 172, 179 McNabb, Michael 179 Meeckins, Adrian Meeks, Darrin 197 Melton, Paula 41, 102, 122, 123 Melton, Shari 28, 68, 72, 179 Melvon, Conlee 180 Meux, Tish 180 Meyer, Marcia 94, 198 Mezes, Michelle 67, 180, 44 Michael, Michelle 42, 154 Milburn, Ricky 154 Miller, Christopher 198, 45 Miller, Dana 54, 193, 198 Miller, James 198, 45 Miller, Janet Miller, Shelley 57, 155, 225, 233, 240 Miller, Thalia 42, 68, 155, 44 Milstead, Mark 14, 41, 67, 68, 141, 155, 216, 217, 240, 252, 154 Minick, Alisa 5, 11, 20, 21, 23, 42, 43, 72, 73, 155, 43 Minick, Chris 21, 42, 95, 180 Minick, Heidi 67, 68, 155, 252, 134 Mink, Rhonda 43, 72, 180 Mink, Tanya 40, 72, 198 Mitchell, Patrick 40, 68, 72, 101, 180 Mitchell, Rickey 180 Mitchell, William 30, 42, 180, 247 Mize, Gary 41, 155 Monk, Bill 10, 42, 47, 155, 45 Montes, John 198 Montegomery, Jacquelin 68, 198, 123 Montegomery, David Moody, Tammy 24, 57, 67, 68, 155, 233, 134 Mooney, Vickie 155 Moore, Douglas Moore, Greg 67, 68, 198 Moore, James 155 Moore, James 198 Moore, Jean 208 Moore, Lashon Moore, Marcus Moore, Michael 110, 155 Moore, Regina Mordecai, Paul 72, 180, 44 Morehead, Mark 31, 180 Morehead, Mike 180 Moretto, Anthony Morgan, James 71, 156 Morgan, Shannon 57, 67, 180 Moring, Greg 180, 182 Morris, Jerri 156 Morris, Tyrone Morrison, Greg 72, 206, 208 Morrison, Janis 58, 68, 208, 272 Mosby, Janice Mosby, Michael 198 Moseley, Richard 180 Moser, Juanita 198 Moshi, Valantina 72, 156 Mosley, Blenda 56 Mosley, Joanna 41, 208 Mote, Cindy 57, 68, 169, 180, 189, 44 Mozisek, Daryl 156, 256, 272 Mozisek, David 180 Mozisek, Dennis 76, 125, 198 Mudge, Cynthia 198, 44 Muguluma, Maxmillia 68, 180 Mullins, Donnie 198 Mullins, Ronnie 180 Mullins, Robyn 43, 198 Mullins, Sherri 72, 198 Mullis, Lisa 72, 198 Muradian, Keree 18, 34, 42, 64, 67, 58, 156, 242, 257 Muradian, Sona 43, 124, 125, 198, 203 Murray, Greg 42, 46, 207, 208 Nash, Billy 76, 156 Nash, Howard Nash, Richard 76 National Honor Society 68 Neal, Kimberly 180 Nearn, Laura 78, 79, 180 Neely, Sunda 123 Nelms, Danny 156 Nelms, Rickey 198 Nelson, Niesje 64, 67, 72, 96, 198, 242 Nelson, William 79, 180 Nesbitt, Allen 76, 109, 156 New Beginning 68 Newburn, Juan 156 Newman, Mark 198 Newton, James 180 Newton, Justin Nichols, David 198 Nichols, Mike 61, 150 Nong, Matthew 180 Nordman, Leighton 76, 110, 156 Norman, Teresa 156 Norton, Sherri 42, 180 Nowlin, Jimmy 198 O'Fallon, Sheila 40, 72, 79, 199 Obergfell, Tamela 198 Ockerman, David Octagon Club 79 Odell, Chris 156 Odom, Kim 13, 42, 72, 156, 199 Odom, Liota 72, 186 Odom, Tina 43, 54, 72, 199 Oehrlie, Mary Office Aides 40 Ogle, Cathy 156 Oholendt, Mark 199 Olive, Dana 156, 51 Olive, Shawn 41, 68, 180, 114 O'Neal, Walter Osborn, Sammie Osborn, Tammie 199 Otto, John 97, 156 Otto, Kurt 199 Overby, Robert 199 Owens, Beth 40, 52, 53, 143, 156 Owens, Ricky 156 Owens, Vicki 53, 180 Page Kevin 199 Page, Sherri 199 Palmer, Floyd 199 Parker, Deanna 54, 55, 197, 199 Parker, Franklin 76, 93, 156 Parrault, George 158 Patrick, Anthony Patterson, C 180 Patton, Angie 42, 72, 73. 90. 91. 158, 134 Paul, Jerry Payne, Mattie Peaster, Catherine Peaster, Helen 199 Peel, Nicole 40, 57, 192 Peerless Sz Engravers 229 Pemberton, Chris 89, 158 Pennington, Lana 199 Pennington, Lori 158, 242 Perciful, Cary 180 Perez, Cammy 41, 71, 72, 158, 237, 103 Perez, Jaci 79, 158, 237 Perkins, Kim 180 Person, Joyce 64, 208 Petty, Becca 42, 68, 71, 158 Pfeiffer, Bryan 199 Phelan, Richie 76, 93, 158 Phillips, Carl 180, 114 Phillips. Grant 14, 42, 43, 84. 142, 158, 48, 50, 49, 125, 134 Phillips, Janet Phillips, Kenneth 76, 158 Phillips, Lesha 71, 158 Phillips, Lisa 199, 44 Phillips, Ray 158 Pierce, Mike 159, 247, 134 Pieri, Mona 199 Piggott, Thomas 159 Pilkinton, Shannah 159 Pinkerton, Bryan 199 Pipkins, Donald 56, 159 Pleasants, Beverly 208 Polanski, Janean 41, 180 Traditions Indexedl265 Pool, Sandra Poole, Cindy Poole, Rickey 159 Porter, Bryon Porter, Chris 124, 146, 159 Porter, Franklin 125, 159 Porter, Jimmy 199 Porter, Thomas 159 Porter, Timmy 199 Post, Keith Post, Scott 199, 44 Powell, Brian 40, 64, 85, 159, 242 Powell, Christina 181 Powell, David 76, 79, 181 Powell, Jo 208 Pratte, Jeff 159 Presley, Tom 76, 208 Prewitt, Majorie Priest, Danny Priest, Rodney 199 Pruden, Cherri 199 Pruden, David 159 Pucek, Kelly 14, 109, 131, 159, 252, 134 Puckett, James 181 Puckett Ka Eggers 249 Purdy, Rhonda 44 Purkiss, Paul 160 Purkiss, Tonya Purtle, Catherine 160, 164 Purvis, Joyce 208 Pyle, Rebecca 67, 181 Quick, Anthony 200 Quick, Gina 199 Quick, Steven 160 Quinn, Karen 5, 14, 15, 21, 42, 43, 64, 68, 160, 242, 250, 45, 134 Railey James Rain, Charles 181 Rainey, Kimberly 160 Rainey, Michelle 126 Ramsey, Timothy 200 Randall, James 200 Raney, Jennifer 53, 200 Rathbone, Craig 200, 44 Ratliff, Karen 53, 181, 48, 123 Ray, Michael Rayburn, Robbie Reagan, Dianna 2, 9, 57, 160, 233 Reaves, Kerry 181, 123 Red, Lee Ann 83, 230 Red, Melissa 68, 72, 200 Red, Scott 200 Red, Terri 57, 67, 181 Redman, Lee Ann 71, 160 Reed, Cheryl Reed, Danita 182 Reed, Sheri 200 Reeves, Tina 41, 184 Reusser, Michael Reynolds, Laura 182 Rhodes, Max Rhodes, Michael 200 Rhodes, Robert 160 Richard's Honda 244 Richardson, Terry 160 Richardson, Wendell Rdge, Marietta 182 Ridge, Vicky 43, 200 Riley, Roger 160 Ritchie, Samuel Ritter, Laura 24, 182 Rives, Benjamin 200 Roachell, William 160 266!Traditions Indexed Robbins, Joseph 76 Roberts, Bertram Roberts, Erilc Roberts, Laura 161 Roberts, Susie 60, 208, 210 Roberts, Tammy 161 Robertson, Dustin 20 Robertson, Lisa Robertson, Tamara Robinson, Derrick 182 Robinson, Keith 200 Roddy, Sharon 200, 127 Rodgers, Kevin Rodgers, Susan 182 Roetzel, Michael 125, 200 Rogers, James 42, 125, 182 Rogers, Teresa 200 Roods, Carol 40, 57, 161, 233 Roper, Amy 57, 68, 169, 182 Rose, Brent 5, 11, 92, 43, 67, 105, 110, 182, 145 Ross, Todd 42, 43, 161, 45 Rottman, Daniel 200 Rountree, Jennifer 43, 200 Rufin, Nicholas 200 Rumbaugh, Paul 201 Rumbaugh, Randy 200 Rushing, Yvonne 161, 235 Russell, Jerald 182 Rutherford, Stephanie 16, 72, 200 Ryan, Eric 200 S 8: S Sparks 222 Sadler, Rene aa, ammy M Salmon, Tammy 71, 161 Samons, Daniel 200, 45 Sanchez, Rojelio 72, 125, 162 Sandage, Terry Sanges, Tina 67, 68, 252, 134, 162 Sansing, Shelley 42, 43, 45 Sarlo, Jayson 162 Savage, Mandara 95, 234, 162 Sawyer, Guy 105, 182 Saxton, Leonard 200 Sayles, Tammy 162 Schenck, James 182 Schrader, Robin 76, 200 Schultz, Tammy 134, 162 Scogins, Annette 31, 40, 172, 182,123,127 Scott, Robert 40, 200 Scott, Tabatha Screeton, Susan 67, 162 Scroggins, John Sefcik, Ladanna 57, 76, 200 Self, Rhonda 123, 162 Senior Football 109 Senior Senators 64 Sewell, Scott 162 Seymour, Miles 182 Shanley, Joy 52, 53, 182 Sharp, Carey 182 Sharp, Jeff 182, 185 Sharp, Kimberly 182 Shaw, Tammy 200 Sheh Jhn 42,182,45 Shells, Chiquitha 20, 62, 68, 200, 123, 127 Shelton, Marilyn 58, 182, 209, 234,44 Shepard, Kelly Shepherd, Paul 40, 200 Shepherd, Paula 34, 64, 72, 200, 242 Shipman, Kenny 42, 182 Shipman, Robert 40, 125, 43, 162 Shoptaw, William 200, 45 Short, David 40, 100, 101, 151, 243, 162 Simmons, Johnny 79 Sim's Bar-BQ 255 Sims, Charlotte 200 Sims, Becky 42, 48, 123, 162 Sinnett, Donna 68, 182, 123 Sipes, S Sir Roberts 236 Sisson, Sheila 53, 68, 182 Skarda, Martin 201, 44 Slack, Dianne 131, 162 Slawson, Becky 42, 53, 72, 139, 48,162 Slusher, Jason Smart, Christine 53, 67, 72, 125, 201,48 Smart, Jon 68, 201, 44 Smart, Rhonda 14, 53, 67, 68, 221,252,48,123,134,162 'HWY Smith, Ivan Smith, Janet 41, 57 Smith, Jeff 201 Smith, Jeff 201 Smith, Kevin 72, 79, 182 Smith, Kimberly 40, 201 Smith Kristen 201 Smith Michaela Smith Paula Smith Phyllis 208 Smith Rhonda Smith Smith Scott 201 l Thomas 76, 162 Smith, Tracy 68, 201, 123 Smith, Vincent 182 Smith, Wanda Smith Yolanda Smock, Ivan Smokey Joe's 228 Sonk, Glenn 182 Sophomore Senators 64 Sorrells, Karl 182 Sorrows, Travis 72, 83, 208 Southall, Harold 201 Southwest Martial Arts 244 Spanish Club 220 Spann, Greg 40, 41, 182 Sparks, Catritia 92, 162 Sparrow, Tonya 41, 76, 201 Spears, Steve Special Thanks 239 Speech and Drama Club 72 Speer, Alana 201 Speer, Doug 41, 109, 272, 162 Speer, Mary 201 Sport Graphics 244 -ina-cl: Spreads, Phillip Stackhouse, Kim 76, 201 Stafford, Dennis 182 Staggs, Dickey 109, 193, 162 Stalnaker, Kevin 201, 45 Standridge, Raymond Standridge, Ronald 60, 68, 72, 182 Stansell, Kristy Stanton, Jon 201 Stanton, William 18, 64, 68, 182,242 Starls, William Staton, Billy Stauber, Marty 125, 44 Stebbins, Rebecca 88, 201 Steele, Danny 208 Steele, Terri 163 Steinkraus, Karl 67, 208, 252 Stensland, Sharon 201 Stevens, Ky 72, 83, 182 Stevenson, Randal 201 Stewart, Charles 31, 68, 182, 45 Stewart, Charles Stewart, Christopher 201 Stewart, Pamela 201 Stimpson, Karen 40, 42, 45, 163 Stinson, Vicki Stitch in Time 236 Stokes, Terry 62, 234 Stone, Latonia 201 Stotts, Camra 79, 202 Stout, Jane 208 Strickland, Jerome 125, 201 Stringer, Christy 42, 163 Stringfellow, Jamie 201 Stringfellow, Stephanie 71, 163 Student Council 35, 242 Student Council Officers 64 Stueart, Sam 205 Styers, Richard 109, 231, 163 Suarez, Minerva 202 Suitor, Stacey 57, 68, 183 Summar, Tracey 15, 58, 60, 67, 243,254,163 Summerlin, Jay 29, 56, 68, 183 Summers, David 76, 183 Summers, Sharon 42, 72, 155, 164 Summons, Ronnie 164 Surles, Tommy Swaim, Curtis 183 Swaims, Karen 183 Sweeney, Beverly 164 Sweeney, Bruce 186, 202 Talley, Scott 3, 10, 42, 43, 96, 45, 44, 164 Tanner, John 202 Tarbell, Barbara 68, 71, 87, 44 Tart, Denise 164 Taylor, Danny 67 Taylor, Donald 202 Taylor, Kimberly 72, 202 Taylor, Lana 35, 183 Taylor, Nicholas 183 Taylor, Nigel Taylor, Robyn 1, 9, 43, 52, 202 Taylor, Ron 202 Taylor, Shakeena 57 Taylor, Teresa 164 Taylor, Toni 2, 9, 13, 27, 42, 57, 71, 233, 45, 164 Terrell, Jerrell 210 Terrey, Charles 68, 109, 210, 119, 114 Terry, Julie 183 Terry, Michael Terry, Otis 183 Terry's Auto Care 247 Thomas, Cynthia 41, 183 Thomas, Deborah Thomas, Debra 71, 184 Thomas, Denty Thomas, Michael 14, 125, 119, 114, 164 Thomas, Stuart 184 Thomason, Stacia 1, 54, 202 Thompson, Bridgette Thompson, Charles 210 Thompson, Darwin 125 Thompson, Dewayne Thompson, Douglas 40, 165 Thompson, Jay 202, 236, 44 Thompson, Keith 110, 169, 184 Thompson, Kendra 41, 68 Thompson Richard Thompson Shawn 59 71 Thomson, Christopher 202 Thornton, Bernard 202 Thornton, Chris 184 Thurman, Jerri 202 Tillman, Earnest 184 Tipton, Julie 184 Tipton, Mattie Ruth 204 Todd, Suzanne 165 Tolbert, John 165 Toler, Wendy 72, 202 Tollett, Paul 42, 43, 72, 165 Tran, Dihn 41 Tran, Haivan 125, 202, 124 Traveling Troupe 72 Travis, Jeff 184 Travis, Lisa 202 Travis, Tracie 184 Treat, Judy 165 Trevino, Julie Trophy House, The 244 Upper Crust 236 Vaden, Gary 68, 125, 165 Valli, Frank 202 Van Noy, Dale 72, 202, 48, 44 Vann, Doug 14, 68, 134, 165 Vaughn, Chris 201 Venable, Kathy 10, 42, 59, 184 Verver, April 57, 68, 72, 97, 175, 184 Vick, Cecilia Vick, Joe 210, 51 Vinson, John 184 Vint, Larry 184 Vitro, Kelly Vocque, Teddy Waddell, Amanda 79, 223, 184 Waddell, Michelle 71, 165 Wade, Gladys 165 Wade, Sandra 40, 57, 67 Wakefield, Rebecca Wakefield, Robin 202 Waldrop, William 40 Walker, Anthony 45 Walker, Cynthia 184 Walker, Jennifer 57, 184 Walker, Robin 184 Wall, Ruby 202 Walthers, Bobbi 15, 51, 165 Walthers, Kathy 78, 79, 45, 123 165 Walton, Jeffrey 202 Walton, Steve 76, 223, 240, 247, 165 Wampler, Brett 165 Ward, Sherri 42, 72, 91, 156, 165 Ward, Tracye 71, 184 Warden Motors 254 Warren, Patricia 20, 26, 54, 55, 67, 68, 184 Warwick, Gary 202 Washburn, Frank 234 Washington, Calvin Washington, Carl Washington, Yvonne Wasson, Joyce 41, 71, 86, 184, 166 Wasson, Sharon Wasson, Thomas 202 Watkins, Lea 202 Watson, David Wayson, Juanita Weatherly, James 41, 72 Weatherly, Jeff 184 Weaver, Michelle 202 Webb, Roger 14, 17, 166 Webb, Songina 166 Weisenfells, Sandy 64, 242, 166 Welch, John 109 Wells, Barry 26, 72, 202 Wells, Mitchell 202 Welsh, Michael 125, 202 Wendy's 226 West, Susie 210, 215, 214 Westbrook, Tonya 79, 184 Wilkerson, Carl P Wilkerson, Dewey 76, , 166 Wilkens, Brenda Willaims, Danna 72, 203 Willett, Troi 167 Wright, Thomas 184 Wright, Yvonne 177, 184 Wyse, Vickie 41, 167 Williams, Anthony 203 Williams, Barry 166 Williams, Cassandra Williams, Delena 167 Williams, Derrick 44, 184 Williams, Donyale 203 Williams, Eddie Williams, Frances Williams, Gary Williams, Gregory 203, 48, 123 Williams, Herman 203 Williams, Jimmy 76, 184 Williams, Kevin 203 Williams, Kevin 167 Williams, Laurie 42, 57, 65, 76, 184 Williams, Mark 161, 167 Williams, Michael 40, 203 Williams, Mike 76, 210 Williams, Robyn 167 Williams, Roma 66, 68, 76, 105, 108, 109, 125, 167 Williams, Terence 203 Willis, Ken Wilson, Brenda 71, 210 Wilson, Karen 76, 203, 44 Wilson, Pamela 71, 167 Winfrey, Joseph 82, 79, 167 Wise, Jeannie 184 Wise, Pam 167 Withers, Kenneth 184 Withers, Stephen 203, 45 Wittenburg, Donna 95 Wolfe, James 76, 184 Wood, Bill 210 Wood, Hob 14, 15, 40, 67, 234, 252, 134, 167 Woodall, Randy 167 Woodruff, Robert 203 Woods, Milgret 208, 210 Woodward, Dorothy 210 Wooley, Louis Wright, Dale 167 Wright, Mary 71 Wright, Napolean 76 Trotter, Charlene 210 Trotter, Jerry 41, 68, 109, 165 Tucker, Helen 210 Tucker, Jackie 35 Tuggle, Sandra 41, 53, 68, 184, 103 Turley, Robert 183 Turner, Teresa 71 Twidwell, Linda 72, 51, 50, 165 U.S. Army Recruiting Station 243 Wheeler, Teresa White Denise 202 White Dewayne 184 White Diane 210 White Lynda White, Melissa 43, 202 White, Michael 184 White, Pam 5, 20, 71, 184, 166 White, Paulette 166 White, Sandy 42, 71, 184, 166 Whitlow, Angela 71, 166 Whitt. Casev 247, 163, 134, 166 Yotter, Ted Young, Bettie 184 Young, Charles Young, Jack 167 Young, Rosalyn 68, 208, 121 126 Yount, Mark 28, 68, 184 Youth Sr Government 67 Zimmerebner, Marilyn 167 L Not only willing ale Traditions Indexedl267 .. ik. Guest emcee at Almost Anything Goes, Chuck Dovish, entertains the crowd before the annual event. 268lTraditions Indexed Lion Lines Romper Roomies-Elisa Caplinger, Trisha Frost, Jamie Johnson, Tracey Summar, and Kenny Lana, to one of the best friends I've ever had. Good Luck! Love, Kathy. Good Luck. to the dirty dozen -Mrs. Gresh- am 5 Kathy V.-You have been a great friend and always will be. Thanks for putting up with all my crazy ideas and temper tantrums. Try to control your burpees! I LOVE YA ALWAYS, Mare Lori P.-Good Luck. I hope all your dreams come true. Love, Lisa H. Congratulations Dana! I Love you!-Brenna Cheryl-Thanks for putting up with me. Your the bestest friend EVER! I love you! Mel Mel Andrea L.-To the best friend anyone could ever have. Thanks for being there. I Love You! Lisa H. Lisa, well babe, we made it! Thank you for being there. You mean everything to me. Friends always. I Love You!!-D. David, Hey Sweetie! I'm glad we're such good friends. I Love You!-Andrea All Annual Staff turkeys-Thanks for a great year! I learned a lot of things such as stay away from roof tops and don't go to the darkroom alone by yourself at night. The best to all of ya'll. I Love You, Marilyn. I love you Brent!-Love, Brigette Thanks for all the love and care, Mom and Dad.-Love, Yvonne Rushing. Keith, I love youl- Yvonne Andrea-I am so glad we got everything worked out! I hope nothing else ever happens like this again. I love ya-Jamie David-Sorry for everything! I hope we will always be close friends no matter what happens. Take care always, I love you!-Jamie Robbin and Andy, Hi Robert! Love, Robbing Robbin and DeAnn buddies. Doug Speer-Don't ever forget me! I love you! Kim Jones I love you Brian! You're the best there is!! Yours Always, Dana I would like to thank all my teachers and friends for making this year such a wonderful time of my lifeg I appreciate all the concern and encouragement that all of you have expressed to me throughout this year, and I wish you all the best in the future. Doug Vann Let's have a riot! . ,. THIA Mel loves Brady! Threatening to torch the Red Devils is ju- nior Brent Coffee, who is riding on the Machine Shop float. Performing Where Do We Go from Here? are sophomore Barry Wells, and senior Polly Hil- liard. ' vilidsw V Colophon The 1984 Lion was printed by Jostenis American Yearbook Company, Topeka, Kansas. lnplant consul- tant Ms. Judy Huffaker and sales representative Mr. Terry Zylman worked with our staff to create this pub- lication. All headlines are in Century Schoolbook Bold in 24 to 48 point with body copy in 10 point and captions in 8 point in Century Schoolbook. Cover design was created by Debbie Darracott. Lynn Lile drew the school seal which was silkscreened for the cover. The book was bound in Smoke Bound Fabric and lettering, Thompson Quill Script, were embossed and artlines were embossed in blue ink. Soft blue was select- ed for the endsheets. Maroon and percentages of blue were used in Student Life sections and the profile pages of the People section. Percentages of black were used throughout the book. Layout, design, photography, and artwork were un- der the supervision of Trisha Frost, Tracey Summar, and Elisa Caplinger, editors. Traditions Indexe is .135 l ,il , Q ,Q si fs it rs 6 X X 5 HN! The back ing during l Q. X Qi ,'. ,.... , 5 E A 4 515 il x 5 X M . ? r Q. fs S. .- fm .Qs - . for socializing and eat Drafting takes much concentration as shown by senior Todd Durham. The rain keeps students such as Juniors Scott Campbell, PJ- McClure, and Bill Adcock on campus during NAP. 270fClosing A Continuing Tradition No more homework, No more books, No more teachers, dirty looks. Remember this rhyme? Even if you never said it, at least you agreed with its message. As seniors packed away their graduation gowns and mailed the last thank-you note, they created a vari- ation of this rhyme: No more Shakespeare, No more grades, But no more summer holidays. if 2 1 ' ' if is ix :Ma - :Q . ' i .,,,' i 1 . M . ' 1 -,,,i-ti- 75 K .Q-'bfi '7l3jQ'x' w A calculator and textbooks aid students in last minute studying. Closingf271 Some call it a bittersweet experience-graduation. Yes, youire finally finished, but now it's welcome to the-real-world-of-work-or-more-school. No more chances to participate in traditional school activities- your last homecoming game, your last choir or band performance, your last sports competition, your last club activity, your last publication. K Yet because traditions do bind and insure a continu- ity, those who remain here will hopefully continue tra- ditions and they will hopefully see the need to again update these traditions. It's a traditional place for seniors such as Keree Muradian, Alisa Minick, and Karen Stimpson to gather. A traditional sign- the dogwood blooms - is a reminder that another school year is almost over. Certainly an untraditional birthday sur- prise in the form of belly dancer Randy McCain is the yearbook staffs present to Mrs. Janis Morrison, yearbook adviser. 272fClosing As if it were a trophy, junior aides Barbara Tarbell, Charles Huggins, Kelli Agnew, princi- pal Mr. Bob Cross, junior Michael Jackson, Michelle Tucker, junior April Ballard and Senior Jeff McClelland circle their most dar- ing move in the one-upmanship game with registrar Mrs. Mattie Ruth Tiupton. But will she have the final move? i lb f 'Mrs E511 U1 ? 1 as 55636 1 Q dw fO 7 VQQQD QL 3050 j KHZZ, YQ fi QED? SEQ 'QJYTSYVJW Aww - F WTW9 WCW? MQfIiQ5j2dQ3i QmM+?fw?iQf+m bbvcfbwfnmffid fm mqm Mmm XQUAQLW' WD Qxpgq N Oxrfb GCP-wvvds QQ ' wk wwf? pqgwxgqkklngumww -POW Ydogwli mxpfdpqd H1 PM gm 133 -wfvyykq K7 Q QUQfQWd'E-TI YD so fda -FO WEE? MWWJQW 3132 Ewimavqfiwf CWQSIQWYOW VOTWTU Lxf?51 0XM g45,,yU0Q wcmwu rfb I BYYW m,fJOkJU CD 'qxnpgxdfx Umm BMWQ Mfg? JF-95? AQUCQO N1 il +905 TWU- 9- NYQYCYZVQ +v'OU 3:1 CHHUQQ wwe lf9QwZ5U 999, Wffxfv WKQGWUQCZL