Gonzales High School - Lexington Yearbook (Gonzales, TX)

 - Class of 1926

Page 1 of 136

 

Gonzales High School - Lexington Yearbook (Gonzales, TX) online collection, 1926 Edition, Cover
Cover



Page 6, 1926 Edition, Gonzales High School - Lexington Yearbook (Gonzales, TX) online collectionPage 7, 1926 Edition, Gonzales High School - Lexington Yearbook (Gonzales, TX) online collection
Pages 6 - 7

Page 10, 1926 Edition, Gonzales High School - Lexington Yearbook (Gonzales, TX) online collectionPage 11, 1926 Edition, Gonzales High School - Lexington Yearbook (Gonzales, TX) online collection
Pages 10 - 11

Page 14, 1926 Edition, Gonzales High School - Lexington Yearbook (Gonzales, TX) online collectionPage 15, 1926 Edition, Gonzales High School - Lexington Yearbook (Gonzales, TX) online collection
Pages 14 - 15

Page 8, 1926 Edition, Gonzales High School - Lexington Yearbook (Gonzales, TX) online collectionPage 9, 1926 Edition, Gonzales High School - Lexington Yearbook (Gonzales, TX) online collection
Pages 8 - 9
Page 12, 1926 Edition, Gonzales High School - Lexington Yearbook (Gonzales, TX) online collectionPage 13, 1926 Edition, Gonzales High School - Lexington Yearbook (Gonzales, TX) online collection
Pages 12 - 13
Page 16, 1926 Edition, Gonzales High School - Lexington Yearbook (Gonzales, TX) online collectionPage 17, 1926 Edition, Gonzales High School - Lexington Yearbook (Gonzales, TX) online collection
Pages 16 - 17

Text from Pages 1 - 136 of the 1926 volume:

I p C 'I In I mum I1 1926 0 4 Ln oy 74 cm cw O wf A Lxzgxyfx Q 'NLG THE I EXINGTON GONYALES HIGH SCI-IOOI 1 9 2 6 X wg x p ulyfp kJk3'X3 fx P J -' -' I -UI jim , xi- ,,,,-, Lfijif I nf if If ii go Ei Ei gg il e gf 3 sg' Q ' gg' 3, 5145 I -15521 1-wiv zffif. img NSS :emi :X-QQ Palm' 1-151 XaG:I.x, 12?f W fx' A fqgu . gg QF QM wzfffi f ' LM-I' I , 4 -' fw- J VFW mm IK' '2 . v . , . , X Ol, . llu . IINI, 1217 M4 , . 95' ,QQ 1 UIIIIJIIOII by 5227 mg: Hfff' GJ HL. T E s 0 C Ass I n ,Of :NSI I-I EN I R L W :mm QW 4 ul 1,'l0- F3515 YA-I' -OM :WV 'bfi 1 -f 550 w 'I Tri 015: FXXC H223 I lg? 014 mug P215 .- I, I ,. K , X ,I - I Wjfff J 1 Q-511 v -CH Vf 25.15 A ,La-.1 Miva I: A QSQ if fi -S753 F30 UNSW ffflif-122 is A,-SIE? Q? F3112 555952 fflswf i?13X'f 5 yQL:1.fg Qi! ' I A . I . ' ' l'tu'LrxmL1iux1 1926 ' IW' ,,,,.--- sfw' M,f,wg.4a? ' If.. A-L W 5 3 . W, jpg? , 3, ,Q-145' . - , 'mgvfv f hi y,..,!-. rv. 1 ' ' 1 -ff .,..f - fu., A . ' f , Thr I,L'XiIIQiL1II A L 33.5. -., ,,., 7,1 .,.. , I I - 1926 - ' -I 1 K5 FGREWORD N l mmlt L IIN tm Lili IC Xltllx cf tlu studcnt N x X 1 L x N an w fm L s If lsucu x C m XXI HE ff? X..f i,1 ' .fgf .X swnvra-aan unfanvv-nun: ff T ' ' ' A V' -'EQ if Wu, 1110 1mfmbm'.' of 11111 S1z i'i', sul ' I ' f ninth Volume of Uw l,c-xizlgtmu to you as il rx' rd of U14- wti n' Q' A lwdjoffl. Ii. S. 1 m1' tiw Xml' 925-6. VD virnh io cXgP1'u.'s our tl: lks lu 021011 cmv who has Cfn111'ilv11tod to - thnx I uilrling' f Ahlfl wok. 12:1 X gllj T10 wo thzmk Mrs. Lucilv Ii hwls for V lll'l' 'u'k. xo O f N., X- -'K - -fi m :fQf,,f'A'?T:t1 f -? Q7'f'f Tiff' u pn, . A A -,Mu M.. ' ' zz-' ..f- ' Y , ,.,,,,, 1 ,..,,., ,,,,, 7 ., l ,... .,,,,,r,,, ,,! ,.v. , M E Ll: n u H ',.,.. ,Q ,,,,,,,. , :,::,,,: ,'., ,f ,,,, ,,,,,, ,,,,, 3 ,,,,,,,,,, . ,T ,,., Lb ,,,,,,. I '.-M - .,,, llil W In W FOUR ffl Q --v,,,f , J' ' f ' - f' 'v ' ' V, H 'w'f:,gem' xi 1' - ' ' 'f - ' 1 '-,' I TlI1'I-UIIIIIIIIII 1' ,, , .' 'L' - '. '-f' ' ii.....,. ,,.,,, I X IIXI THE STAFF . -I I.-Xf QIJIIIISUI' I I ID-X IIONIQ SX rn mcw X III XXX XI IJ !I XIX NX H-XI -XI' IILNXINC fl x fl S putx I IIIIOI II-XXI II-XXX X-Xtmtllfirm NAI tIf1I X IO XXXI-XXIIx IXI I XIII ION XII NIxI'NI -M rm X Iu 111 fg X.l'5 'X!X..J ..f' XIII I XX SI IIII II , NI! I XIII-IX' I , 'I I .' INS ILICOIIGIC .XIVIII I'II'1,m' Ilus' .Is 211,41 'I I ', C. ,IIN IlI I'II .'.II'I'II I, f. ,' Art IC lim' Asst. AVI ICI'ln1' fo I j C ' ' FAI,I,II-I I-'I.Y XX'II .,.. . '.'I'IS Clirll' . hl' 'C C It 1' Iloyl' . I1Iv ic 4II'tf1' I..-XX 'IZICNCIC I , YI? II. Il ' . , , 'Ig' ,lnlw lllditm' Iioclak Iiclilm' LOU .' -I B ILI,I'II1 I .' I ' fl . ssl. If I'tm' .-Xsxt. I sinvss 3121 ZQIUI' Nl -i In I,-fxmmml w 1926 w 4 I 1 w i r 1 N x 192m DEDICATICN I I 1 L I - I'.uf,L'x:1uq11z11 I This lnmk in 4lwlic:LIw1 In XIV. ,l XX 5llIX1'1'l2lll4X, wlm 11:15 givin lliw Xllilvilllfilll1lllQ'hlSIUXX'2ll'flHlllliillylll Wlfi l.m'xir1glw11 El N wc' -ww. XX lzxlu .N waxy' wt' slum imp Hlll' :1pp1'wc'iz1liw11 L XIIU 1926 GRDFR OF BOOKS IIIIII Il Actux Itlk N ALI1 I ICN I IIumm ' '-i'l1' I,1:-1 Ituu K in?'iii 'W' fi' f 2 if J Q I A111 A 'stwtion II. Classes III. . IV. . III' x V. I.It'I'2II'j' VI. ' 'E',,,,-,-, I i I , J ADMINISTRATION X Nw xx wk ,vm wxxrxm wx vvxnevsx mm vz-zvmxmws-X , W W ff www ff 1 0 V W wi W4 fn fmawfnfw ff fy ffffywfwmfwfffffr MMM WWW! f V ' l I L Yin X ?7m'W lfWMi'WW W 'f X M' f 1 HV U, .f4x.!,w:+-'fx-x.?f?J fa I1 ' G ff? V ' mf 1926 ew, ,ff 'NIM z n Q 'ly ' s ' ' 4 ' A ' 0 ' 0 ' z 'IMF 'Zw 'Q .2-f'SNxflf INafa uf' 6 P mpgs? 'O fmvwwmwwnfnr :ffl -14 f wfmfmxwzw wwmuvvfwmwwezrwyffmzw wwf vw' W vffww' Q na N, .ww M H xlxx A kx Q h ,F J Q W x N, X . Vvxxm X , ,. ,N , . . in Qi ,Wi ::N+r'r:N X 1 . 2 , X, W.m,.N,Q,. GNN X N. T if X - 'N 'jf f., 'If ' 'A 'Q.I.f ..,, 1 ,Q ,N ,N Q U N, ,- N i y X i Q ,. a Q - -MX X - NN - ,Q ,N - ,- - X wg Nfl' N3 ..,., 1 pg .... 'rl ..., -. gm N it 4 N N w 4 , A I.. .Q ijt 'Y 1f :QN .figs :.:t1:i':11:411111:,::::,T:..11,1,,-,.,.,..,i.. ....W..-,..M..W,M ,.,,,.,.,.,... .-.. i N X W5 1 X ss 1 X X E 5 F X- J 5 :EQ S if! , 1 1 ' 'u 11 l 5 , 1 Eg -0 ' w is gg s N X 2 Q E SQ - E22 - 5 . Qi' 1' u .' , 5 ' X., 1 X l , i XA . . ' 5 s - Qi I f X , , . 5 A i 1 1 I i r' l - 4 ' 51 T J X : ' v .F ! ' ii N L - . is 2 1 ' il I 1 ' 1 2 1 I E i I , X Y? K 2 i 5 , a k , X2 X , E f' -fs ' ex W al. ,N S 5 , ,, XX X M iraq! 'gf ' -3 i i Q W A SE V' egfw, 2 1 . 55 5' si 3. , X Q 1 if ' If , I I f I p 1 Ng . I1 1: f . S! . If , i 4' 1 1 ,S N ix !l ,i ' il HE ' , Q Ekgx 5 , 53 X fx av 42 - -A Q2 Rf S Q 3 if b 'S W , ,s Xi E : .Q u f G ' 7-5 Q Q A ' ' - ' I A b k ' gf1f 1 i'fi PfS:QgL1p1f 'gQ f 1+ ' ff - Q- , 1 , , - , A , ,N NN., '-Qq39::s.w,m::u1W rxxmaxy .X A , . N i N, X, N . Wx X , N x X NM, X XX ,A . N , W .xx mmm xx um W xwxwmw Q xp v :Q W1 xwxx vm uw X wx xxx N 'i,1I,'X!1L,nKl 1926 -5 1 -LI1111x1,,,1.'X1111111.111 1 1926 A '-+....-,, 1 flm-1 L-SLE' 'N BOARD OF TRUSTEFS 1 11 N UU 1 ce 1111 N 1NC11 N X 1111 1 216-2 ' WS1 J- 1 ,1 . 111-1 1 11 Vw,w 1l111 'fx--fK.IA...f-1 . 5' ff' fr .1 1111-211111 Q' 1111111 11-1't 111 1'ig111D 1 31. 1711 11111'z1c1- 1111152111 M113 8111- 111111511111 Kl1's.W. 11. 11 1111 l .1. 51.1111151111 1111 XY. '1'. 1 z1x1'1- 11111 1'- '1111 71111111l'111L'1111J1'1'S111.11115 501111111 131121111 111111 11z11'1- xx'111'111-11 Q11 S11-2111111 211111 Q -111i11u.'1,' 1'111' 1111- :111x':1111',- 1-111 111. 11111' S111111111, W1- 11X11'1'SS 11111' 111-1-1 1ll1J1'1'C1211011. Tg,..... '?iiz,'.'i.J:1.,:.ii:.LQi.g4ii1Z,.Q, ' , 1 ,. ..-.....,... , ,, .... Y -.-iq , ' . L. f ff.: Wmwwhiywv , , x Lvxiu t U H ,,.. i, ...., ., Y ,. . N. g W l 2, Q -I lu jgvrilyxf 1926 . ,, f ,W w .., , -ff r' 1 -.1 . .,.,-V -1' s, .ev JU: -me S mx, Am -ss Q 1 L 3-M F AGULTY .X x 1. f ,fu f, 'fw',,..?,f7, 4- f 'f3f fSwf'X ffi My f www vwfnwwffnywfmmfmmwfrmawmfffmfw ffwffw fwmWWfWuwuffvfmnmwvf 1 ' ' . ' ' ' 1 z Q a1:1-fi- w A X f .4 , V ' v gwlv , A if. ' r wwf ' ' lf , ,. , ffW ffl Q' ' . , QL w Y, V-ZZ? qi, Q I , , My N 5 N Q 1' E 1 ! ' - f P , f 98 . ' 9 Q- f 5 ,. , . I ' .- ,. E ' V ' J i L Q ' A A l N i - . , Ni E : N-, 7 Q 1 Q xi ' ' ' Y: ' E , g 5 . X S-3 NS 1:5 J, , aj il L. Q 'si , .. 155 A 2 5 ' if X 155 V N :fs ii F! ' is . Xu . W , N N N' 1 'f ' ' sl f ' X ' 1 , 4 :g ' Q ' -. be 1 - ,J 1 . H xg , ' F ' N ' 1 .. 1- ..Av:., 4 T v h Egg 5- Q N . I gui? x P 'X , X x F A ' .' ' . ,-A . i ' N ig -- ' F ff , 5 .X Rise A ' 1 Y R 3 5.552 ,-N' ' q Q, A A f- ' gi? ,.. A , , I Eg M 4 . , . gig 1' ,I .. f 5.-ngxs ' .4 . ' P 3 ' Nm 45 ., ' '. 'X 1 WJ- ' 9 ,. , .M , .. - ,, ,,,M,,-,,.,,,. , ,W-, ,,-, A im, vm- M., M-NM, ff 5 3' S? E. Q iii A L ,,. ,..,,,W,, ,N,., ,, ,, W, 4AA,,,, A ... A,,Ak.x. ..,,...,., X - , x .m.r,Q+Xf,,,m,N n,,.5Xx!, .. Q. Q xxx ' 'QLfgf'igLQjjg,1'1Q:gj,Q4 iggfhjj f,1j'fg',32,13'3g:QQ'1.ljg,,iiQ5355.Qigjgrzzg5 igjwgy fg:,X , -Nwsxwvmwefffpfwwxxfvixx , , W , Q , t , h V Www K: N 'N ,iw L 3, ,,N, ,, N M i A N ,N,, 4 Til N Nw. ,X , , . ff - ' x'IIII1'I,L'X'lI1III.UII 'I 1926 A x S1111 IH ml S xr NNI S NN I OI NN I I X xx XI xx I IN lIl gfxl' :mix x XIII M. IV IZIXIQICII MII. If. XY. I'ICIC MII Il. II. SAVNIJICI N I'1'im'ipz1I H1 -1'I111v1x1II-111 fri' Sclf IIs I'1'ix1c'ipz1I 01' fic-ivrlw I-Ic'fv11f mics IIITIIIIIIIZLI' fclu 4 I VII iw 'IIPIPIIC l,2I'.-XI,I.S MIL' II. II. SAINIPICIIS I.zI1I11 amd .'XILl'1'IJI'21 I'Img'IisI1 XIIQQ I US IiIiI,I.AM MI.'.' fI,I-IXUIL IZIIILXHI I Ililvlugy' :mel Ilisluly' I,iIvl':11'i:111 :UNI ,XIQI-Iwzx MII. J. XY. SI I'IIICIlI.., XII Mz1II1 ami fIlbIIIIIIl'I'L'I2lI I,:m' ' IIIIINIA IJ,-XY MICH I,OI,A IiIf. XC'II MISS JANIIC IIAI2 C I IIisLu1'y Sp: ISI1 ICNQIISII :UNI Ilislrnjx' 3' f ' , '73 Z . ,,,. .f,,,,,,, ,,,,, Z5,4..:,,,,Wf,.,,,,Kl, qw! L, Ljgxriu U It I I ,. . H .fi -:mr -fff A ff 744' I -1. Vg, f 1 9 2 6 fwiif f M, 'h--R-WW .,Mff ry VOl'lZ'VliliN Y W M I V 1 ff ,WWI JW 1 ff OflffWf WXWWW 5, i vi X f. rf v fa WW if 4 ,R , I W if f Z 2, ' S, , 1- i ' Z ' i ' ? fi f Q gf, L1 1 , 9 fl, , I' ,, ., , if ' 3 1 Eff , s' , 1 ir , ii , IH f Qi I 5 , , Him x A Q , i 5 , i , , , , 2 5 ' 1 5 1 If 1 ' H42 X ,, , , , 2 ? if ,.,,,.,,.,.,,,.,,,,.,U,,,,,,,.,,.,,fW..,.........-.......,,,..,.,.,,,,,,.,,,,,,, .,,,..,, f fly Z, LZ, A A , , . .M ,effqn . ,, ,, , ,,f4:,f.71:,,f JH ,ff 4 f 4 , , , f W f. Q. . A , CLASSES If TT ff 1' 17 'Q,f'f4 ' , 5l'l11'l,11x1u11t1111 ' .- ......,., ,..... i K . ' XSS II K lf X lf 1 l 1 f c 7 xll x xx x lg Q hmux IH x i N lil N X N H x 1 I Xl x KV Q x W Nl ' Lfx' .Xiu iff' Qtivuvznfalsawvmil illurwx-1 fl, ' HCM l'l'f11l11111111-11l l'l1:11i'1'1'1e1i11 l':11'1.1'7 i':11l11-111111 l:l'lll3L'lll'l l'1j+: XYl l2ll'1' lllk' 11111111 111-1i1l1111f lillll .Xll Slillllllllp' 111 :1 Ifixxlhf lli1'ls:XXX-'1'1-1l11S1'111f11'y'11'ls11l'1l.ll.N .X11 l 11'l1f1:11'111'f111 AX'l!lll1Q' Q'11111l1 1111 ll 'l'l1z11 XY1 l'1'SHQl'lfl If l' cm' limp:XX'11'1'1111111111l1111's11l'1l11-l'lz1..''1l1z11 lqtl XX'l 's1l11. 1l1z11 111- ll2lX't' lll'l'l' S1 l'11ll ul' lhllll z111rl C'llt'lll'.., Ylbll z1ll l11111x1' il is ll11' .lvlll 1'.' Sul' l1:1x'11 1l11-5' gui tlw Sllllhlllf Y1-3, 111111 l 111111111 Slll'k' 1-111111gl1. 'l'l11'S1-111 12' 11111. ll. S. l.111s uf 1x'411'l1. lots 111' 1 lz1f.' Y1-1 ww l1z11'11 111 1111111 1 l'fY111'5' 111: c'l1e11'. Nw ' -1' l'11 1 '11 111l111lz1I11 XY -'1'11 Zlll .'lll'L 141 Q17 llillt' llvllk' Sv111111'w ol' ll. ll. S. ,21'lII'I,,I'xIuIItIIII 1' ' 'I ' - I ' ' 1926 N ' NI NIORI I N Q L I 1 I N xx IUII IIII lm IIN I Nlcmtlw N I or IHNX N I I l XIII mx IIII M X Im IIXLIIII S III I I III X IIA I I IIL IIIXCIII I I INN N II,I,x 'LXR' I'I'UsIIIa'III- IIIIIRII' IIIQYI' YI 'II-III'w.+IIII'III WVQIIIIII Ifly Sw 'IIIIIIQI-'I'I'II:If1III'I-Iv I'II:II'IiI- IiI'ip:'IIII b4II ,Q'IIzIIII-:II-.XI'IIIs--IIQII' 'IEILII IIIINI--II:IIIII'I'.I. III' III'!II.4l'IIIII IIIfIIII'i:III IIIIIIIIIIK' I-'III'pIIIsIfIII i'I1Iss XXIII --XIIIIIIIIII IIQILI, I I-S I'I'IIIIIII-I I':II'IqI' I IIIII:I IIIIqIIiIIs IIIII .'.' IlI'IIIIgyII f I'IIIIIIIII IIIIQIIII SI ,XIII11-.XII's. Il. II. Sill II'I's IlII'IIII'IzIII Il:Ij.' VIIZIIL' If II-I' 'I'I 'rtlws C' IIIII' I,:Ix'I-IIIIIII' ZIYIII YI-IIIIII' I iII1I :I XY21.X'UI'IIIElIiI' IL C'I.AS.' IIUI,I, I mx' 3 Itlx' .IIIZIIIIIZI C'III'IstI:III I II II'IIII I3I'Ig'III IJ:III:Is I 'III I IIx'III IJICIQIIISIIII IIIIIIIIIQI I7I'IIIIII.x' I IwI'I-IIQII IVIIIIII NI ':III IIIIIIJIIIQ' XX IIIIZIIII IIzIlx'IIIIs l':IIIII- IIIIISIIIII-III VII IIIIILII IIIIU' IIQIIIIIIIII I IIIQQfII.NII II I IIII'g'II Q' ILII AIQIIIIIII IJI'iI'I'iII OT III-I' f'zII'Iyx' IfII-IIII IIII,-I'III.' XI II I -I IUIIII BIzII'I'I:I I IIwjvrI Im 'I'. A-XIII tt III ICIIII-I lfIfIycI I I II -I2 IIII 3I2lI X' .II Im XI IIIVIIII- . vwrs I'I2Il'I'II' IQIIIIIII UIIII' I.I- I I-tim' IIIQI Hsu' IAIIIIIIIIIIIII IIIIIII 'II If J III: IIII 'QI KIQIMIII IrII:I Nt'lIIJ2lIIl'I' fI2IIIIf'I'.K'III' IW .VIII-I I,I Iflys fIfJI'I'l'IS I.III.' VIIZIII' I' II' rII2I,I.l,' XYIVQIIIIZI XYZICIQZII' I IfII'I-IICII XYIIMIII Wm, - 'f wffwwmzmffwffff'sfmwmvmwwmvuymfwfwwzmamfmsfvwwwg I E ff , 'yyWWWgWWwgWW,Wyf.ffffqWW- fffgmw f nf 'ff swf MQW 'fa Z f w.sf.ffa f f f A 0, -1., sw, M.. fs M - . vc - fx f , -sw, 1' , 1- ,af 1 .ff , -,-f z 1 , f'!1'ffZil?111JIl171.152'TilZ14 55U2l'1,fm 'limifligiziiilfiiii'' ?e Wfggrgrxxzntf1z:::i:x::::::::g.11,1::::':g1::::5:.2:f:1::,,,:,J,:LL:,tj:1::::gg.. Q 1926 f g f f ' , mm I ,, Q ,wwfff fi srivrsw mg PAVLINE FORGOTSTON - Skinny Historian '26, Pauline is a jolly Companion and to know he-r is to love- hear. He-1' dark curls make- heir a fitting twin t'o1' Surah. H08 ll HPXF' Hoytef Hlc-les Football 94 1 N109 President 25 Pwslelent 'Pt Lfoeel looolelng and good natuie-el no wonder heh is Class Pmsielent It you eww want h1n1 you might Call the F119 House- Ol the P1etu1e- Qhoxx SXRXH III NNINL qalah N ne- P1e-s dent Z5 fylfllf-'btld Soc 1e-ty IKIIIOI l iles lei litte Flappoi xx io nmiees elm all tall sooneai 01 lateu 1 h he1 mnele- Klll s el 1 snappy l1'1e NX 1- can easily see- lou s 1 eloe-s 1 -.9 f 'fu wf X1!7'N,fZQX'f H .7 G11 'Lf' 6' 'S 's ,r'.1 bl 'W I J! if Mfllum 114. F41 +W 'Wf! W,fA+45- i?'41i-WKr 2459'1' ll .. ,WMS , as g 4 ,xg 1 ,. fu vi M RQ! X, 1 il , ie fl ,ly L . . H .'2' '- -'21 ' - ' 112.2 . , .- . . ,ll f ' , .1 L 1 X ', E 1, , w , , - , , l 'f 1 ,E - ' . . . ' ' , V . ' . . - , ' . . 9 sg L '. It-'ti f fl , 1 ? 1 iff 1 ' V, 2 Ji . rl 3 ' 5 A ' V , A, , i l . . . . , .. , .1 ? A 1 1 1 - 1 ru- . - 5 Z C -I ' ' '2 5. . 1 1 , 1 H1 tl ' 11 - - -1 3. 1 XVI 1' ble ' 'lr 'nel lim' I 1 . ? 9 ,:l1 - .- I. 5 I V v , 1 ' it ' 5 1 , 4 fe :T4 f L- 'M fQff335'Z J9?? I il'TXl':Q91f57f2f7S5fff,7g1'ffm7-ffMQ7 'Ziff Q'f 'T1fg F .25 Ziff' -ffif 125' ,Ef.Ef47f 2 '- Wwlffffffe 4 ' . . ua MW . ' wwf:-.. fafwn. .Mr ,, 'L' V' f-'L-:gs'efv 4v-'ff ' . ..'w wx.-1 . wzzzf sf. qv.. s 22 :Y EIGIVTIYEN Thr Igxiugtuu 1926 1 1 f 1 VIRGINIA VACKAR4 ingern Treasurer '23, When Mr. Kee wants a capable young lady for a substitute he calls for Virginia. She is also a rising singer and Kazooker. LAWRENCE FLOYD Berry Football 24 25 Joke Editor 26 Berry loves his Ford and well he spends the greater part of his time on the hill' MAYME GRIFFIN Mame Mavme IS the most popular girl in the Class Just stay around her a few minutes and you can easily s e vshy ff! .1 H r , ' f 1 I ' . . .4 1, ,, , .W ., .,,. ,. ,,,, .... ,.., . , W ,, ,.,,,.,.,,.,.,.,,,,, ,,..,,, , ,.,., ,,.,,,,.,,,,, - . W .,,, i......... ...............h...,,m, ,,,.,,.,., ....., ,,,,,. , .,,,,.,, ,,.W....,......,M,,.W.- ,,,,. .,.,,,,,.,,,, . .. ,, ,,.,, f ' ' ' p ' ' ' f' ffi' ' f- ,T:,ff 'g f Xflf Qjg fj 5 A ,V A f 3,7 ,,,53g,f I , A , , . ,, V, I ,W ,I '40 -2 f,'zfaaczmL4w,gf.fwwW1,1 ' ' ,, ,, W -, ,miapngcfwfzf Wx Wfmw WMM 4 Thx I wcmqlun , ff Wf 'VINE1 EEN MARCIA HOSKINS Mushy This is the girl who makes such a charming young She 1k Her motto is Entreat me not to leave thee Rhea and Eral LEO T ALLBRITTON Preacher This preacher doesnt preach he practices mstead He has a good voice and he is noted for his ablllty to do anything and do it well FLORENCE WILSON- Boots Boots isthe life of the party wherever she goes. Our class st-sms to be made up of triangles and she belongs to the one with Mayme and Virginia. f MM f 'f . ,,im8i1w'n2m'wm:'a ilnmurzniwm am ' 4' ' K Xml' f f 'iwmwffww W ' W' 'W W' Y, V ' 5 f 4 jQfW,'f1m'WmW .wmwfnwwff'ffffwfffz'2','ff v H.. h e fe . ff' 'V . 1 ff fps.. , ,. ,,,, ,. , H , ffZ: f-f-4 fn ff fa wife wffv. 7 4 ,, I E -7 A Q' if W'-.tcffrw-..pff,, ,.:ffff,,v ,f , -, , , ,pf .2 f .. ...., ,. . , ,. ,, -.V WW ' ,,,,,,f,,Wf,,,ff if n A i A 44 -, . . . ' ll ' ll - U n , ., . 4 ll ,! ' r ' I 'K . . . Y ,1 ,V ,,,,, :rut Xin gin N If ,,., , ,fi ,,V, X , ,, ,. ,, .......L , IXNI' 1 f Z2 , f' If j .,., ,. - , , 1926 A I N nf V In lwfw W1-HWY ,WW-4 RAY 'l'A'l'I'Z 'A'l'1llf'l ' S?l'Lf1-H111-HI-Al'lllS 2213. Gifto1'ia11 '2li. Ray ge-ts th1- g1'z1111-s. She- is the- wirtie-sl girl ill sf-hool for llvl' SPIISP of humox' is l1Il4'f1l12'lllPll. And Ihal's 11111 all. Vs'h1-11 it 1-111111-s 111 y1-ll I1-a1li11g 211111 11lz11111i11g 'l'1'ips 111 lllf' Mn1111 she- is right tl11-1'1,-! I I URQ l QVIIIH lu-.1ts1P Ifootbfxll Pb IX.-151-bfxll 25 P he-.xtsw 111.11119 a sple-nslnl Bum ness 'vlanagf-1 but 111- hlw h1n1 b1-,t out of school l,1l1e II1 SIlPlrll1 An1 bxose thmgs aw Much too 1.11111 I-110111111 ln-19 101 hmm 1 X IllI1XllUSlx 1511 1 111 1.115 T11 1w11111 Sl I l1t01 Laney F11-da IN om ut 1111 1111- 1 .1111 ll H ll lt des S11 s ec-111121-. 111 1l.1-.s 1.11111 1 111-5 and Llllllf., 111l11C1 to l1n111xl11l 1 s1el1e-1s 1111 sc lll llx 1 XX 'ff VW ff fwf nf ff fwwf xwff 1 1 . 1 . . . -f . . ' ' 'L ', '.' ' ' ., 1.6. , . 1 . . 1 ' . ' , . . 1 ' . , 1 .. . . ' 1 . H . 1 , 2 - . ' - ' ' , C'.XI'l-T ' 1' . C . .' 'INS - -PLT: - Flt'4'll1lu sb 1 - 1- --1 .- '21, P1-1-111111-111 .I i As: . -11' ' '25, Editol' '26. s ' - 1 - 1 ' 1 A11 V V4'l'S'l ' ' I-Z' 'l.' '1 tl - Cl' Sl' -' - sp' 'z ' ' - ' l-- ral Ep, 11 ,1- 'rv' 4 y' v' y 1 v' v l 1 1 A X W J - - ' By -' xy -1 ' y1- ::l.::ll . l':1u ' lll'l'.u - 1 ' ' ' ' 'W ' ' ' '''' TTIf'fffffff1f'ffff'ffffffffff.'ffffffTf'Zf'Tff TfZTf'fTff7' T 'f l Tf ' 'fffjf'ff ' 'f','ffff,f'ff'ffff' , V' ' ' QF Q ' ' N ,, 6 . . . , M ,1,,11 fffl , ,. f,,f, , ,,,11.f f,,,, 1 , , V , , ,,1,,,,,.,,,M,M,, ,W ,. , , ,,. ,. 1,,,,. 1, lffv MVA! ff Thy, I ,. 'I 1 ,, ,, , , . 'v:' 5 2, ,m,,fZ1wg9,f,5h..o rgegfg-t,2,fv,gx:,ffz'N.,,,,,wg ,-41-5-e:.f:e,,:,,fg,'x,fgf: 51431525 .' .vllfivzj I Z WW mmm 'xwfhW''7m:LW.WM-vmwhmumumwwnilimwzzixxx:::7:1::::::::::' ' 'W fqfv- ,,,,,, :'1T:'?f- N7?Wr':::Tf '1'f1ff:.1:::: :f':':f f SM ,,.,, 1125212 Ayigw ,,,, ,W hr tw Xi-'f 15 Xxf 1'xvf:x'1'yi1xAu , 'xxx 62,42 1 we OLLIF LI' FBFFFER 01119 Vle 11111 alvtavs xemembex 0ll1e as one of the Duetero She an Ruth make a good team so we feel Just1f1e1l 1n p1ed1ct1ng g1eat thmgq 101 t lt Ill 1 VKILLIXNI HAXNIFS RAZOI Football 24 2 Basketball 24 25 26 Baseball 24 25 26 Frack 2 Fenms 25 Boys, Athletlc Ldltor 26 Class V! 111 2b Best All around Boy 6 Razor 15 a bplendul athlete and he IS nexex at .1 losb 101 .1 Lorne back Ill 5110115 OI 111 co11vt1s.at1on 9 X xxx m DXLLAQ DOVK1Nb D11 Basketball '76 kt. wt .wt 11115 moved heleelt .1 dandy captam fox 0111 basketball team Hex only fault 15 that she llkes to play 111th R.1zo1 2 x yf 'J fo .JT- '!N X' 'ff r2..f.f'i' nf-fi 4NMG' 'I wwihvawuvffxfmmfwmmtwwr 441 2 fffwmfmvmzfwmf :'1 sv wmv, Num , Xfevsmvaaerfv.. .xmmssxem I-.iv-1w4.,m 5. :1:f.s:x21:1af:ttsswemxmexwxmimxwsm.+ma::::ax:1xXgwe-w- -1 '111 wwwfwvfNwW'wufemvww'-mxwwzvex-xvwwvfw-Wwww.---weY A - 1- :w::t-.mx . YQ , ---- X.,,3.X,5 11 SQ fg 3--.,i,- 31x3.-'ted f?XL'.-Fwff 3. 111- 1 N X -f . -yi, - N -X if X arse-, A,,1, M ,.,.,.,. ,,1,,..,,,.,,,1.,,,.,,... , zvif ff? 1 1 111444. ,- 1 1.51 S NC E 215 e 1 I Q 1 1 Q' . 1 3 , - 1 ,t iv! E 11 S M 5 ' 2 f' 5 I . 1 - 1 1 if'- 11 i .- W i 1 V A . . , . ji-,f 3- . ' N ' . az f , -, , , . - 1 . . . - Q 1' ' 'J , E '- - f 1, - -, .l 7, . , . . A .. ' M 111 1 l I . - 1 . '- ' 1 , 1 ' 1 ' , . , 1 1 - - . . - ,' . . 1- , I 1. . - ' , 2 : , , , I 1 . . . . , , . - - '- ' to .. -v, ' . Q ' 3 WJ - . ' 1 .. , 1, l ' '1 -1 1 . . , . ,N 1 A - . . , 1 ' 1 ' ' . 1 1 -- - . ' f 1 '-10 I . ' V 1 11.3131 ' : : - 'I ' ' : 111? - ' - . ' - 1 . , . . ' l , , f ' . . . ' ' C. E .1 . . 15 .1'--w----------- 2-.- .-. ...........-..-..MM....W--.a..,..,,..1..,,M A M, M 4444 ,AA A A A A ,L,,,, ,L ,.....M,e,,,, ,, V 41 'V'- 1N' 1 X' ... ..,. t Yvkfiiilks. e.t:1,v t 1 ,ti,Xxxxw.',1.Sei2.x. lb :mauve 1. 'SANSVXI:-it'.C5Qe,Q.KXe 'Q.'wYMbw!SxNX 'SERYNXQXN NX W KZ . ffl' 51 V.,.,,W,1,:,1.,,W,,,,,,,q,4,,,,,1,,,,r,.,,.,,,,,w,,1,,,.,,f11,mm4w'w,m W,T,2?,,?gf qxl Ig , .t H. j vw,,, ,,., , jV,,,,,,,,,f, N cy , .,,,.,, ..,,,,m,,..i ,.,. ,UVM Af, , F, 1 , ,, ll' L-7511111 UH y 1 ' 'W 19 26 , f 1, . Wg 1 , 111,,,,1,,, W1 MW1 ,Q ,,,,,,,1q 4. - 2, fu 1 ,. , , . .,,, ,V Q- 72, Z ,f1,:,:,i:,,:'f',:f.xxgifzzirfigkfizpfJ,5::i:::L::1::3x:Z:7,Z:x:,Lx1LxLZ:::1::iZ::f1:zgixrzzzzzf 7144135:,,:::'1:,:.:::::,:g':: 1p,:1:1:'i:1,::'t1, ,,,..,., ,,.,,,.::1L, ff: '.:::z1:1:::::i.1::::1:tg.:f:z',:'f': ,': ff' 1 J N '-H-f.N,,,1w .11f ' Q 5 X YN f l'Xx 1,5.yQ4r Q cv - mv W MMM rg l 5 y ,, l 5 IDA MAF LINDEMAN Ida Mae Jolly and smart Theres a fine ccmbmatlon Lost plays an lmpor tant part here the same as wlth all other valuable thmgs EMMA DROUPY Emma Emma doesnt llve up to her name at all for shes full of pep and fun We llke her better thxs way LOIS TATE Lols sw xxx eyes make us wonder lf she comes from Vnkmg ancestry X f, bf '1 110 111 11, W 1f, 'UQ 'ff ,,, '11 W1 1, '16 1,111 M19 f pf' ' 1 x W xxx x x 4 fr 0 6 affwrwzww 11 1 11 111 1 1 1 m1W1w1 1111 11 1 1 1 1 1wW1WWW1w1111 11m WW f1w1111 1 f11f f w1z1W1W fWl?Wf ,W 1 ,A , ,, 1 ' I I , 1 I 4 .. ,. if - . 5: f 1 5 1 i . , ' ,,,,g 2, 1 ' ' W ' 5 , , g, 5' 15 5 f fl 52133 fl Q :mi 125 l Z 'fi ff W 2: 1. li f 42 w nl 2 5, u 11 ian: ilv 5 - 3, 5. 1 I . 1 ' 31 Q iz? 5 1 42311 1 1 ' lftx 1 ffh 3 -, 2 2 li . ,, , f 5 L 1 25615 1 3 2: ll 1- gm! I7 Q3 ,gf l , ,E If X , M l , . ' Z ffl 1 aa if K. ff f fi l ,. L4 U23 f Y' 1 1. l 25 1 ' 1, .. . ,, gill 5 1' lf Q 21 iz Q gl if . ,i Lols' blonde curls and her blue gg if ' fi 5 Q ' w l v ' 20' 12' fi lg IE A 1 . A .5 2 1 3 1 - 5 1 E Z 5 1 lg 52 lf if ' ' z Kwik , Z gi fi X lr ,, 4 2 Htl' I ft ff 7 1 5, lf Q wi me ' f ii 1 2 1' 3 fs if f ff h: 1 , if ra 3 1 , :gl - g ,' ig N ' 1 ' EY, f X ig 1 i J if fig an I :E .Al U ZAQIIZIIIZIIZLZTZIIZ111111fTfffiiffffffffliffffffffifffflfiflfffiffffffifi'flIffiifffgflfIfffffff?fIf5ff2ffffffZ71f1iffiiiifif?,1ZL323,,.,,i.,,,,,,Z,,,,W,,....,,.,,,,,,Z.,,.,,,1,,,..ZZ,Z,.,,f.ZEfiffTfZffffZQfLfffiff2,ZZ,l,,,,,L,,,,QQ,,,g,.,.,:..2..3,7,,...,ZZ.,,,,,,f,,,'ffffTfffffffffffffffffflffl2LLLf1.ffff,g,'fZl,Qfff,LQLf,.f.f,lf1,,M 1 ,,,, , 1 5,1 1 1 ,fs-IW, , 7, 1 ,TV 51,3 71, ff 7'4U,f6'C'7f' C 1' .f V ZJV1 KM' X XV? fQ7'6V ,f 410 QVOW' ,f , 1' ,, 1142117 17 ' X . . . ,'1V !,'W 'W'fff'1,ff2Z6 4451 lr, , A J1 A ww WWI mrff 1 W 1926 Q!!! '--.. ,WW Q TWENTY THREF CALLIF FLY Callle Alley CutestG1rl 25 Tennls 24 26 Basketball 25 26 VICE Presldent 26 Latln Tournament 25 26 Guls Athletlc Edltor 26 Callle IS perhaps the best all round glrl 1n the Class She IS a Jolly companion and everybody knows her Smlle The questlon IS sw hy does she smlle at the teachers so often INRX JAMEQ Glrl Kodak Edltor 26 Marv IS a dear gurl but one IS kept busy keepmg up wlth her changmg moods Nevertheless we love hex Just the same CATI-IERYNE REMSCHEL - Katrina President '24, Class Poet '26, Catheryne is one of the most charming girls in school. As a drametist, poet, reader, singer or dancer she is always at her best. fr . 'xJ NYf:Xj'K ,ff-5, ff!:'ffZQ2s..a,fe:f'Z??'? 'ukfflfivl 1 f ' ' f' n'Vf WfM fW ' Znfmgywa X I I Iglf X I II U II Wh ffwmwvwwzwfmymwfwwwmfwfeffzfwmfwmww'www fmvfff f aff 4- f , x Z Q 2 M V--H215--.fffgu -'..,:3ff,g-Q Jfff' . 6, 4 , 0 W 5312:11:::::1::::::x:77:z::::i::::::::::::::g:::1p,,1::gg1:p::7x::::::1g:g::,:gf:,.::::g , ff -4 H - H J , - , , - 1 , . , , 1 1 v 7 . ' ' ! ! - 7 . ' Y Y Q v y 1 . ' , . . , N ' H - U gl I A k '-. - , 9 f WKW Wil 4H i4Wf if' 720: z'7WW'5f7?Z1f470Y'y V' G44 10561 'V 73' 5'0'fi f?5r'? V 1 ' Gq9wwww4wm2ZZQZfQZ7ZZZZ Lf7Z3If3M4ZQf2 Q'??m1zwaw'f'fAvw4sf2www:,' ',..1ZLLL,,,W,7: M T B Y u 2 yywwflfffwwmfyfnwffjgvfy-ff fffff -f -w1ZffMfaW'f A' ' -f ZS M., 4 I f ,.,,,f ',, wf..Uffff,, f ,V,m...,..,,,,,, V was WW ilgim '1'xvl3NTY-r'Qg'lg fu, v, 97 2 'zzme1:::px::zgf:::g,rz:z.:f:L:1'5'I 571: X 'M V7 V! I ! 1926 ,fn 51 f 34' W iw, of ff 4 1-f zwfm ee an A-1 2 I, KW, f4'4'fff-A 'Lf 4 ..,cff,, -W1 awuzff .s '-f.,,fpy -f-,,,M 'Z ff'..,L,W'1p - - ,, W ,..,:,fff v ff ..,, .,,,,,,W.N,.,, ,,,,,,,,WW , 2, 'W V uv WV' , 4 C 57,15 ,IW 3425, 24775 W 2.59 l 221' ,fl QV? www--X ,fn bzmz fw- rf, as f 2 Zflg 91 :gil wx, 'Z 1 U55 9 153 lf 4 . , 1' 0 f 7 is gg 5 f v Ll'ClLl'I NIGIGIIIRORSV llit'li Ilivk says shv could listen 10 ll saxophonv or clarinet for hours. VV1- NV0llllt'l' why '? QIIJNPX O LONNOR S11 Sld Snr Sld IS a lvgulal Hmkxrnex s Handlbook of IINIPSIJPIISIDIP Info: mauon If lhnes fmythmg he doesnt knovs somethmg about 1ts because It hasnt been lIlVli'1llt FAI' RIE KI LLIIN Fam-ule FAPIIP IS undmmously mlevlaleml to bfi the mwvtest gul ln the Class A IHIL wnlpllxm-111 If jf bW4f0 fff 4,10 ff' fffv IT f fa 6 'ff 2 'Wa ffl Affff iff, 'ff 'ffff 'W ff wiwff 'M 4 f Az!aiMwM ffwfmwwl Mwwwf ff 4fif1WlWf1fW4fWM4m1 mf wmv ff ff fm Wx fwfwffff fn f f ff MW W 4WW L4 'iff J :H My a 5 , xl 2,9 ews in ,Z 1 ZW? S ., , N ,Z 1 X Q2 H gg jgfgil Q if , . if Q 1 CN ll ,f ,M X, 1? xx 11 l E 7 5 ww lwx if ,ls 1: 1 'fa ze fn ll N l ig' gy! 1 V 1 , 5: ! k If vw Fvnw-, S- U wwf? bil 5 fl Q7 . .. . . gm qi ' . h 1 . M , lf M ' -' -' '- I l ,i Y' . . 5 73, lf 1 1 - ' 1 - I 2 1 ll uf W - . . ,M ? , 'e 2 1 v . ' . ' P . ' 4 af l . . , . 1,015 42 fi ' 5'Q'l1f ln fp - , - I 1 A 1 l-- .- -.- -d. sw Z 3 2 5 9 at , , , Z all 2 all Z 1 ' I 15 g ,, sz M 2 fi Z . , -x I 4 zl is q 5 'P' si li Q , . K ll 'I .4 Q Wig f ,lg QQ , 31 Q 1' , I - x lf g 'wi PQ mf . , Q bw JW Rl fab' Q2 la gm? w Y , v 1. . .' H 6 Q 2 'f ' if Z 2 2 1: f f 4 235 . .- - . ' - . 52 E61 , , ' , Zijfr 9, . . . , 5 fl , gm? - - A - ' 5 K ll ' ' f 5 34 5 Sail 2 if? E 5 ll 1 M l Z5 li . ll Z gil f Z4 ag - , Z X Hy.: a , f F 3 Elf ,Z Z ff l ??f Z V55 l :lin SE f QM? f 1 , . L' Z 9 Q5 2 uf fl V Q f M, 42 fy ii ' z Z 2 A si , , Q 1- ez rw 7 1,1 , ,Md H 7 J In :Ji::::::::::rf::r:::::::x:::::,,, ,.., ::f:::t':::1t:,::1':::::,.n ,.., , ,.,, ii::i::::f::t:::i:iff:::,, ,,,,,,., M.. ,,.,, -,.,,V......N.,..,,,.,,N ,,,.,,.. . ,.,:,,,'z,Q:z,:f7fi5:Z::f::i1Zf:f7Zi,,,,.,Q ,,,,,,, ,,,, , ,,.,,frffmi'fir::'f':f'7::fJ:f7::777'717:77::':::::7:7Z7I77:1::5:2:5::,f,4 .Laffffz ffi' ..,, , ' f- 0 WJ C' ' ,UW J ' ff4'4'7'7' 1' X , bfi W ,741 WQVX ,V 'f HVWV, ', 7 f ,QW2iV J fl' , 'L' W 'VV' 77 '0 1 ' ' 'Vf'fn7 7 7fUW '5iZ'7H'W' My 4 ff f , W' W, ,a,T,Mij,.,,??,,?,Mi,f i P I E x nuttin I ,,,,,,.,, ,,.,.,.,,, , ,Z ,,,,,, , W., ,,,,,, .. , ,W 4 fn , , ,.,, . i ,, , ,,, , , .,A. ,, , X X ., fff, ,,,,, , , ,,,,,,,., ,.,,,., , 1, , ., , ,,.,, vw f ,.,,,,,, ,,,, , W .,.,,, - ,,,,,,. U. ,W,..,.,.,,,,,,,,,,,M,., ,, .,, ,,,,,, Q 1 9 2 6 Z! ! ,,,, , ,,.,,,.,,,,,,,.,,,,,,,,., W, .,,,, - ,,,..,, ,, ..,.., ,, ,.,,,,.,,,..,,,,...,, we-, , . .,,,,, WM 'V TWCNTN'-lllX'l'i .II'ANl'l'A CHRISTIAN- Juanita Juanita. as you know, has two talents. Ona is hm' ability to smilo, the other is hm' ability to work math. MARION JOQI' PH 9 I' XHL W on iw thinl of school .incl studies we think of Nlaiion Joae ph ant s oaiml ull c LFNX NFI IEXLR Patsy altvspoalz says X sott it is an e-xcvllent quality in .1 ix om in 1 haps that is ly us admin Lena N0 much u 2fN4 f' . mins -uuzfvv fa A www? MM . . . . . I h ' ' i .' , ' l hi: ' t' mt' Ns. 44 I A 4 I i p Sh' ' : ' -1 'U : ' 'mim- ',. . 1 . . ' V ' . - 2 mer ' Q ' A xv 1 ' 1 - ' -v '3T :2 '1'- ff,'Tl ..'aQ.'f,5l'ffl34'77 'f7Q'?fifQfl y3'fE?'ffg-771'Q7 '.,5jf4'?5:'ZQif:: 5 , gr ' 'vi ' ' fi' v M ' ' Wi 4 ' WN? Z ZW ffffv T '.5+L'-' '-kv fz' ' 'Q L4 'YW 'l'z i v, - - .Q . 2 A1 NVS L' Lvxtnt 1926 It un ll'Si U Flon nc v lf wou ndnt Nontehotlv who ls tie Nl lblt ll I 4 alxx ws p l l H1-lsvball 7 6 VM fur an unusually lutltv tltw Pwachex but ft wal hu Suntl 15 buhool Fedclwn 'N 1 I RINI JUVSI RS 'Nl lllllllt 'Vldullnvs pep 1-. the only lhllli, that Can lawn up wxltll hex tongue She showed hm School -,pmt tux mg the SUDSCIIIJIIOH tontvst intl the Ifootbxll games Fl,UlilCNtTl'I I, Mil pct 1 - j s vall on l+'lor+1m'v. Sh- is A 'ug' rt-ally for work 01' lay. Cllfltllitlli WCC NNUR Fatty 2.5, 2 '. for wt-A can not only boast ol' at MIX' 'C .' 'Hz ' ,,,Z.,,,,N,,m.,,,,, ,, Z ,,,V,.,.,,:L .,,,, .1 ,Q fr mf ,, - , 4 , .. ,, ,V Lt Lxvxin gin U if .,,,,,,, WL ,,,,, 7, ,,,. , ,,,, l926 , J y 5, H,f,,! U ,,Y S-........ .,,.,, f-f if 'lvvv-nv tt W F tmxixarixllx GLAIJYS SUIIRELS A GlzuIyS Girls arv madv of sugar and spivv and everything that's nina This applie-s tn Gladys. x KIND. IJILKINSUN latin ntbill Ihwltttba e .11 not sun vlhethei Ldv 4-1 a. n b we 0 ms thlt ue Iron ing, him IHPL FLUX IJ I e Pthel was 4 new nwmbe-1 ot oui Clfu-. this yawn but she showed het school Sllllll by coming out tt basketball Fo 4 125: as ' - 'll '26. W- ' 1- .- '- ' 1' l 'in will b ' puvt or ot ut ' ri lm ' 2 '- f'zm't ke-vp I lik- , . Y . li I ' - ith tl 4 A-K1 '81 1 1 ln L K- ' 1 - . ' .' 1 ' ' H- w?T5:,h?,,',Zl:Z?.,:. . V , . , ,. K Y V Q A. -J 2 f wifi ,ziij ra in,,,,Z,M7,yW,,,i,,i,..,,,,,N?,4,,,,,,,,:W,,i ,,,, qwh Lx Iqcxill utu ll ,,,, .,.,,.,.,,,, , ,,,, I., ,,,.,.,,,., I ,V,, ,V f ,, , f f fr .. f, 2 -f,,, ,yy Q . I - Q My f fy f 4 -W , ,f f ' 1: ff W1 :-an X KY ,.,,,.,, ,,', 1':z::,,.,,,tg,:,:g,gpfi,,1x:gg,, 5 ,.,, x:z,::g1Z' iigyilll ,,,, ,'.f,:Lg,,'.:,gz.':,,g::,,rg . M ., ,- 19 2 6 f Q 1 ' Q ji , .1 'M --., N.,,, .. ,.,,, , ..,. f 'f vm' If QMIENWNQ-lf1f111'l' yy yy I yy I XX wa I I N 'VI XQUN R103 CHIP'-.tG1lI 24 -. rutv a gnl fu ilu-.1 ls Iflll 0 beat But uv Imou Somebody Ilan who II'llDIxS R0 too C H XRI II' RHIC H'I Lhllv hw P1f1s1df-nt Qvc-1Ptf11y l1w1su1e1 Zh Cass GIOUCII 21 Most Populfu Boy 2.6 Lhalllv IS Llaqs Cnouvh mm but don t f0Ig9t that he was Hqun Shlllk' the Jocky, ID the U111st111.1-1 pl ogx am x.. WNXWX 1+RAL JAHN 'Johnny Flal IQ oux Llaqs Beauty Iool at hel blg blown vyvs and you mul we Thmes a mason XX NNN X QNX XXX KX fl -'34 ,f,, f fp fw ff Muff 'buf Q! f WW, ,J fww W ff wfwfw W mmfwlff ffmffwfw uf f ff f 1 zmzffmwffmwwff W A I fi Ll y 111 Q, . 1. 1' 1 2 I 2: 1 ei A I I I I 3 . . . 1 ' . 1413 2 J in gl ii 4 , ' Mali ' ' M217 1' I 1 if 1, 3 f MG-I z. X 5 ., ' Ze ' ,, f . -'pm 1. f 'ik 12 I 1 ,' 2 Egwgiv 3 ,ef 12 7 V ' H3411 , ' 1,a A , ' 1 - v 1 1. w 1 H 12131 . 3 , 1 A I 1 -f Him? e I 5 1 ii Qi,-5 . . ' 124 . . .V 3' I , - . , , K . ' 5-If' Emi? 1 , v - . . . . . 1 - . . . 1 . . 1 ' 2 ei 52,1 A , 1 , I ,, , 1. Z 1 'f iii: Q Ef . 1 1: f, fi V ' i ,K img 2. 'Xi + - - - M. 'gi 2, H3135 7' I Y . . ' ' V Y . . 1 . 1 - 'F 5 , . . . , , Ifgg 1 3 1 . . ,. , If ' W ' ' ' 1 , - 1, , - 1 . L. f 3 ' ' EMI y - -1 5 7 1 ' n 2 - Liflli , .2 E Jil Ii x : . , , , 11 i f,? ' H 'I , , f 1 1, ' f 2 , 11 1 1 ' Li II' 2 ' V I IM ' 1 ,, iv I ,I , WW ig ig 15222 1 I If . 4' 2 ,Hi N Ii 5, 'Q 3? 7223 fl, I ,Ca-I Z ' -' ' his A ,, X11 L Kiwi? ,' ', ' I '..' ' . I I jgy' xml H, ' ff,,,s . , .- , f F' 5 ig ' ' ' S ' gi .L jg , , ,, . . gf, 5 Ox I t ' 7' 2 '31 L 1i Q , ,Z ii 3' 0 1 'I 1? ?,, 2 ,' 4 fi 5 ig I 1' , Ifl' f 11 Q if I , V Iii' I: ' 11 51 Wi f 1 ., , . ., - .. .. ..- , W1 . 1' 2' f--' f f-'-' f 1'7'771ffiti5f'ff:f:ff'f1tffIfIi1'iC'i ff1fftfiffi!fiifrftfffff, ,,,, ...,,,,,,, .,.,., ,.,,.,,,,.,,f7t751fF'fZ2,ifftiifffffiffffffffiu ,,,,,,,, .,,,. N ,,.,, fifffiffifii373:70fi37fTff7Zif73Z::.:ff'7J.,,, ,,., 9. ,,,,, ,,.,..,,,,.,,,,,,.,,,,,,, ,,...,. , I ,,,, ,,,, , ,T ,,,. ,, I H f 'V W V 0 a I I llrl V 7 l44'4v Q X Vf-VV if fllry W Q ,I M M l My ft l X if ,fy 4 ,gr vfY,,fg gf ,f ' f, ,fig ,7 ff, , ,fm 4, ,,,:,f if Q ff, -Y--fmw v-,Hfff 4, WMf,,,W W ff, .,,.,fffw Q 11,11 Q v ww! Q fm, , iff , 111, , .f ,W WW, ,, f , If ,gfwffq-wff ,QW W1 ,yy f A , .',e?efW' , ft Aff , 44 ,4wzzv'wf.fw'fWff'a'f ff? 4.1 mmfwwff ww, f' X-:4:w.l2f 52355 ,. 3314 ,. WJ 2 45 2 2 , Z ,W ,.,,.,, ,W..........,.......,,,..,,,,.,,...,,............,.,,,v,,,,W Wwwmwwffff nfw wryfawwrymfvvh ff!! . ' M ,, Q WQ K2 Q :qw ., ' ., mf,,t,,w,,x ,f,,x.,,ff7,y- f,, 4' ,gi 1926 WWW-'-WWW M 'M X W Q A. A .,. . , .t M 1.1 A Th 0'm HfU f11A f'fN N4 LLL 'ffffvlifiifrffll' '--z'1 fl?77f'71f5-lllllfffgy 70' qxwf ,.' ' 'F '1'W''Z3Z'7''17N'''ij2Jf7 1jI1J1IIZ.C1C,'1,'1l1.'IZ N1lZ11ZZ1ZjZZZlTf?f7I' ,K 1: f 72 .1 5, W TMQENTY-Nnxrg ,f', f zz, n 1 FPVK BOOTS Booty 1enn1s,26 Base Ball 25 26 ,, If you wx ant to soo one love game xxhew thole axe no trlangleo Just match Fen play tennis SQIVICP IS hm motto x Q f f 2 wt 1 I fp 1 ali? 4 . fjjiw f+N'f.cf 'fix' .X . . 1:-afzxzfz-cf: .ffm-fiN-f 'f 'nf 'wwf 4 x riff av I4'ZW'431'?W1Www W M 11 l dWQ Y f 44 1 2-,gf 1 I :F 4 524127 , iifg V 2 t 53114 4 zgv '- y mu. ' I ti 2 ,fl y ' i glib V ima , kg 0 H Vi s 2 , 5 ,, Yi' f ' f 12 'E 1 32? f 2 'it ill? 1 i I 1 fi :Q 1935 5 M? if ' if 'we I , V ' u rr 7' ' 5 A -L 3 ! . 1 WZ f 'a HX J f- - -. , , 5423? y 4 , - li X 1,1 U yt - I 'ivy 'p 3 ,fi . . , , - - wt Q, ,, , , . ,, fan! . . 'f 0 gzgz : , . . Ha ff? W fl! tb 2' rj, 12? 612 In rt - by xx 'Q ig 14? fu? txt fy '25 '21 W 9325 ff! 15? Lf' -WV? iz? fi? my s,:f X43 12 'xi 5:35 iraq Y H W - -' ifyt .I ,! it ., 'iii iii Y 7 iff' W if ,Ci eg 1, Q3 M Z, 422, ' 5? 4 1 it 4456 ' 32 . wg 524. ml A Xl? , wzl , J 1, 7 ,. fin! ' N fa, ggi jfg I i . 'J' gg-,H ir? fel aiu? 5 ,U :wg er, it EE 51,4 , , . ,, wi: mg? ffff ff.g1'ffr:::L7::::3g3,, --H W ---- -Y --L if W 'LV W-Y - A -- - - - --,- A - -- - V f, ....N.....-A. .U ,, - V, ,,:,,..,, W... W -VYV , , ,--W . ,, ,,,,,,.,.,...-,...M...-,.,.,-....., t-M : . - .-W - J' .sfxaf-X: ,- --- ' ..., at-N, 54 5 '-4' - ' , W ,, .f , , ,W .r f , . mv: W vu 5' 'Y W, 1926 lllll3l'X Xlls XX ll lll 1111, lIH .11 X .11 11- . NN 1 11 . 1 11 llllll N 1 1 -, l 4 4 4 N tx s , t x 1 N1 1 N 1 N N ll Ill 1 1 .111 x 1 1. S l11111l ll 1 N 1 N '11 N 0 . Nc . . N . 11111111111 1 . X ll 11 11111 X . N . . 1111 1 1 11 . 1 N 111111112 1 . . 1.1 1 11101 l 2 Silt . is N lst l Ill 1111 1.1111Nl1 S 111 . N 1 1 . . 11 N 1 1ttl1 1.111g 1111 1111111tl1N 611111 11111111 ls 1 . N . 1 N 1 111 N N . .11111 l'111 th N N 1 1 1 11s1 . .11 . . 1 s. 1 . 1 . 1 . 1 Il shn lt 1 1. t1111b1-L1111x11.11 ll 1 ll - ll11111 .1 1 - A N .1 1NL111 181111111 1b111, 1 1111 1 '11111 .1 Illlll 111 1 1l1g.,111 1 x 111111 f 11 it 10111 .11 xiwul 1 11111111 .1111x 1 111 Ill 1111 1 1 11111 11111 1 1 111. 1l1 you 1lo11 1111-11 s11 mu1h 114111111 xx 11l1 1- .11 1- . 1e1t11111 11 .1111 . 1 111 1 s ' 1 1 . . 1. 1 I121 h .11lx.1111 QR . 1 x . 1 1 111.11 is ut N111111 1 . 1 N 1 1 1 Il . llt 1 s N t1 1.11 1 111 tie N1-1111111 11.11 with High N1l1110 xxl111l1 the x xx 0ul1l tight lll the- q1111l101111111 ilmlw 1111 gl 11l+111b11 1 7 1 1 1 s . I lf it 1111 1 11111 1 N xx . 11tl111 11 1 N .1 11 Xl 1t111111111w 1 nu nxt 1 1 11tl1-1x f 1 1 - Sllltle Ills s se 1-o111l we ai 1l he x. s . N 1 11 . 1 11111 ls 0111- bu 11 1lI'IlTIll1Illll0Il S11-1116-11 112111111 to n1.111111ulat1- N 11 1 tl11 le H tl l . l lt . 1 . . 1 D4 1 5 s es 1 1 111111111 ll 1.11111 11 1 . 1 . 1 1 +1 u 1 ll It 111- 1- qu 1 111 11 31111 the J11111111 111l1sl1111 1 was 1u1111g ll 111111 ll 11111 11 11- pl 11.111 11f 1111111111x 1 1N1L1 11 the- PHIII my 1s1a111-1l ul sonic- had to xi age 11111 11t 1 s 1 1 L n 1,1111 u b ll y 1.111 1 111 11-11 1-11 'fi fl Ill 1 ll ll ll Illll10lS 111.11 1- 15111111 wiy sum-1 sslul Canipaigns lh111- was 11111 11.11l11'ula11ly biaxs Jllllllll Calliv Fly xx 10 was note-11 lm hex 5.,'1ll111l 111-1-1ls 111 lf 11 Olllfl .11111 1 ll 1.11 '11 ll .1111tw 1 1 1 1 11 lll, 11 this 1 1 111 . 1 .nv X11t111 'ff 'f fu . F1ll'Ii YI-I. .' 'Ali l'z1 l' 1- If' 1 .'t1111 XX 'f X 'f 'l'l Cl'1,',' 11l' '26 lap 111-1-lz11'1-1l w'11' 1111 th1- High S 'l 1111! Xvlll -1-Vs llt'1'll!'lli This l'I'X' tvis 111'111'l'1i1111-1l llll'llllf'lllll1l th- 1111111 Ill' 1211111111-s 'lllll '1.' il 1' -:ull 1-ve-ry able--b111li+-11 l 1'1-sl1111z111 1-11li:I1-1l ill the- 'll'lllX' 111' Stud -11l.', 1-itl11-1' 111 l11-lp tl11- 1-1 Ili -, 111 11l1-'1s1- hi: 11-111111: 111' l1i111.'1-lf. 111' 111 kill 4IIll'. .Xll 111'g:1i'.z1ti1111 l'IlllXXll as thf- l'11' 'l 11l' 'l,I'l1.'ll'l'S 1-1111l1'11ll1-1l tl1- ll'-'l1 S1- 2 'lll,' llllll 1li1'--1-11-11 it: alla i1'.'. 'l'l11- higl -at t'l'i1'i'1l ol' this . 1i1l 'll'IllX' 111' l 11-ulty. 21: it was 111111-+- - 11ly 1'z1ll -1l, 1.x'1,' S 1 -1'i11l1-11111-111 K. .X. .I v. l111 l1'11l T111' l1i.' '1i1l-1l1--1':l11111, l'1'i111'ig1-1l F1 klin. I,z1.'t, lut lj 1111 Ill! lIlS l1-'1.'l, Q , Ih -r'1- UI'l'll'tll'S, X11-rv the- ll ll'llt'l'S 11l111 h'11l 1-l'1'u1- Ill' 1-1-l'- t:1i11 XX'l'2lIUIlh 1 '1l'11 I0 the-i1' 1'1-,i -'tivv l llll',' 111' l-Inglifh. lI'.'t11'y. Mall -11: Sl' . I.z1ti11 111' .'1-' -10+-. Ill Zl t'1-w tl'lX'.' ll11- Ill' -11111'-1ti1111.4 111-iw 1-111111111-I1-1l '1111l tl11- XX'lI' l -- 111. 'l'l11- 1li1 11l' hz - 1 ' ls. 'l'l1- I1-'11'l1+-11' 1'-1n1+- l'111'tl1 b1 1111li.'l1i11g the-ii' XX'l lf 11: ill all .'l1'1111-s ' '111s 11l X121 . lli.'t111'y. l':lll.Zll,'ll, I.z1ti11, -l11'111isl1. 'lllll S1-i1-111-1-. 'l'l1 who l1'11l l11-1-11 ill tl11- - Illy l'111' lll'lllX' y1-'us 11l'l'e-1'1-1 , 1g1- zulvic' -. '111l XX ll'Il -1l the- l lX' I'Q'l'l'llilS 11l' F'-.' 11-11 11111 I11 I'll2ll'IlLf' tl'1t l zt' '-'11111. Y11 vi 1111-111111t1-1' l'Al-ISAR .XNIW HIS ll.XI.I,Ii' XXZXRS l11-l'111'1- y1111'1'1- ' lgilll '111 1, b -lie-vw 1111, it is 1111 1-' sy '.'l111t', s'1il 1 xl 1 l -tt ol' lh- ,' il 11111'- 'z11l1-. Oh, Latin is11't l1'11'1l t11 1l1-al with, il' ,' 1 1.11-t z 1. l 'i111, 1'1- ' 'l' -l z 'Y 'f'1-1l .'1- ' '. 'l 1l' - ' l 111+-, ' l - 2 J ' '. S11' '.'l 'S '- will le-ly ,' 'l'1- ,'Olll' .l,,' , 'I , K- . ' LZ. .Xl-ll'l' 1lu1- 111-libs-1'z1li1111 s111111- 11111l1-1't1111l1 t11 1-11111l1z1t S1'i1-111-1-, 211111 s111111- Spziiiish, 'l' - th bi '1-st ol' ll1 b1 1v1- u11i-' l' l l1' ll1- ll1'1t l1z11'1l1-st l'llt', L: l' . 'l'l1- st111l1-nt: 1l1'ill1-1l night '1111l 1l'1y ill 1l11- he-'1t, 1'11l1l '1111l 1i11. 'l'l1- - 1- 1-rs - -1-1l. shot quizz 'il th- SIllllt'Ill.' '1111l XX'UllIllll'll Ill'llly with 1-1-l ' ll .' , 1111- 111-1'i111i 11l' tl11- w-11 XX l,' UX't'l'I '111l th- '1111- 1-'11 - 11 l1 'll tl11- slu1l1-11l.' Illllfl 1'1-st 1 be- 1'-'lgt' ' l-:- ' F- l,i11 ' ' . '- XX'l - F- - -' tl' 'L3 01111 -, llllfl Ill' llll' st111l1-11ls XX'l'l't' 1-1-'11ly to 1'1-111-w 111-ii' st1 l'- bl so '- vitl --V t11 join l'111'1r1-,' 'ith '111 -' 1- llllil'yI 1111- l'1-ll ill tl11- '11-' l' . : :ml 1 .' l 1'l1il- 1 1,1 -W 1lisl1-z11't1-111-11 z1111l b11l1lly 1l1-s1-1't1-1l ll11 This j- ' 1' t - war 1 1.' not '13 'i le-nt is lhe- 1l ' 1: . t Ile - ' ' ' -' ' ' . X1 -'-' - wi 1 l'll'l XX'0I . 1--11'-ful '12111. 'llll Il -1 t ' of :uppli th- S111 h '- l 'i - l' ugll l11 11' -ly: 'llll ill S1-1111-111111-1' 11l' '2l, t':'-lblh2Iiy.ll'y 11' al'f'-lt 'i - - -it. It '-.' l tl - Ju' '1- l ll'lI, tl 1 1- 5' - 11. M1 ' , b .' ' ' - - ' tle- rw -ll -s yf-t mst 1 l' l z1ttl1-S tl -' l' -'-' b- ,sq g-l ' . llut zl'l the-111u11111s w1-1'1- wiy -1l 11uI, tl -. ' ' l 'l -' f. -, tl-Cl lI1' --z111 1.,tl-V' F'1i1' il 111 Ile- Until - l' Lati wl1 h ,' li -ll ' tl1'1l l'111'1-ig11 1'il,y 1l' S' 1 li0. 5 L , 4' A '.,,Q' fini I, !l' 1'YA ,I 'f U ', ,,,, 3 ',', T WW W fw ufmwwzrvffavfm my if f l4'l HIWU44 'Vf97ff,0fMM'ZYO' 7 JM: VM! Q! Q 'Flu 1111111111511 W 2 fwmfmwf ,Wm,,., 1,2 , 0 I pw fu wx' 1926 1 '?4m UNI 1 ' ' .11 .11 1111: ll 1 2 . . 1 . 11N 1 . lllf 11111 1-1111 1111111 1 1111111 1 llN . 1 '111111 1 1 I1 ll 1 111. 1 ll1 1 ' HI 1 1 . . QN .1 18 111.1111 . 11111 1 N 11 S 1 11 1111111 13111. 11 I 1 1 4 '. Il 11111 .1 1 1 1 1 - 1.11. X1 111 1111 . 1 S 1 . 1 . tl 1 - NN 1 . 1 1 . 11.11111 2 . 2 2 IN I S.1u111111- llllj., 1 . .11 . N . 1 1 1 1 1 3 1 -1 1 111 1 1 ' 1.111 111 . . 2 N .1111 11 1 11-111111 P11111 V11ll1. 1 . s . H 111 11 ll ' 1 .1-.1 1-111u1 151111111 I-1111101111111 H11 1111.-111 11 J tl 1.1 . S 1 '1111 1 COllli0S11 11 .111 11 1 111 1111 1 51111 11 1111s 111 xx Nlllldgt 1 1 11 fl 1 1 1 5.-ll 111 11111111111 f Sl 1- 1 ll I 11 11 1 1 . . . 1 I 1 1 111 1111 111 1 2 S 111 111 1 N 21111 lrl'lll1lAlflllS xu1 1 .11 111 111111.11111 .llll fllll ll X1 Xllll . - N . NX p,1- Nl 1 .11 rg N 111111 NN -.11 1 1 11 .1 1 1 1 111 1. 1. 1 1111111 1 . 1 11 111111 s 111 I1 11111-11 1 lf ll 111 11111.21 111 1114 11111111.11 1111 ll 211s 1 lk 1 1 . 1 111.1 . 1111111 11 11- 1 11115 111ou 1 If 1211.1 1011 11 1 1111 5111111 I1 1111111 2 .1111111 P011 11111 .1 1 Q11111 1111 1.18 s 1185 1 1- Ng ll 1. 1 1 . 1 .111 1111111. n1 Ill If b1 1.11 1 1111111111 1.11 1 111.1 1 111111111 111 1l10ug1 -1 11 1011- 211111 Z1 - 1 111 1 . 11 11 - 1 l1l 1 . -111.1 1111 11. - 1 11110116 111111 11.111 11111 b1-1-11 1.1111112111 11 1111 1111- .11 . 11 1 11 1111 21 C11 1111 .1 11111 11111111 811111111111 111111 11 .11 1 1.111118 1 fll 18 Fllll ' 1 N V119 fi 1 1-1 .1 - 1-1 11011 11.11 .111111111.11 111111 11' 1111.1 . Nlll1fI1l1t 111111 11 11 lr 11-11- 1.1s A I1 1 11-1 1111011 .1111 ll 111v111 211110111 1 1.11 Ll.1Qs Ix1gl11 1111 1u11 1 1 '-111m1111 11111 11.111 131.11 11111 .1b1111 111 111.11 G1.111u.1111111 N1L11 11l11n 1:11 1111111 11-6111111 11N 1111111121 1111111 Hlgll 81111101 .11 .1 111-.110 11a 1 111 211112111 NI.-mil Uu 111 IS 1111 11 1111 11.11 111111 1111 H1g:l1 S1 1 GHKE' 11 1 1111 11011z.1l1-1 H11.:l1 School 11.11 1111-1.111-11 1112111 111 11 111 112111 111 1 ll Rs 1.111 N 1 HUN- .,- Q . My nx!5 X:f5so,x'f 4,2 'I 1, fu 1z4,3xZl, 4,177 11,4 :fu U 'M' MW awww! M1 1 aww wawfnw 1 rug eww. mmm 'W' ' I 1f'wn,f4-'W' 2 , , zz, ,r 4f vf' f' 1 1 ' V ' ' . ,JIQZQ-,fymff 1 1. X ,W .,., W., N,,.,,,. V, lf ' ' f,i'1'?Vi.f771?i 'ffifrff-.171'-'fp' : .,,,,. .,,,.,,., M ..,, - W ,,,, MW... ,,,,,. ,..,...,,., , ,,... ,,...,,,.,,,,,,,,, , .,,,.,..,,,.,. ,...,.,w..,..,,. 5 ' - ,,,,, ,W-f f'f' W Q2 ,nn , , , YY Y WWW WVYQWY Yil'l1lI1'l'N'- -.V V1 A 1 - . I 'l 111s 1'1-'11- 111- l111:11'11 111 'l'I'll,'l1'f'S 1-11-1-11-11 S11111-1'i1111-11111-111 1-I. M. Irj, ' 1 -xt 1.1111-i'1l,'11111 l'1'i111-i11'1l 1-I. VV. K1- -, '1s 1 2111-111--1-111111. S11 - - ' 1-2 -1 -rs 11'1-1'1- 2 i111 -11 111 1'i1l 1111- 1211-21111-i1-s. .1111 'l l': 'll'l11y 111111111 vig. ' 1.'l,', 11 - Stu l -111.3 lll'X'l'l' -1-sg, 11'1-1-1- :11111- 111 1-1111111211 1 -111. lll 1111- 1'11ll1111'i111.q S -1111-111111-1', 1l1i1'1y-11i111- s11111 -111s 1-111is11-11 ill 1111- S1-11i111' 'l1.Z'i1l1'. 11 11'-1s 111 11111' 1:1-1-211 s'111111-ss 111211 11111- 111' b1 11' -:1 '1111 b-:1 ' '1'.'111'111, . 11 M -- 1'11Il111111l1, ll'2lll.'lll'l'l't'll 111 1111- 1Xl'll1y 111' 'l'2.'l111'. 'l'l1i.' 111-2111 -111-11 11 - S- ' ' 'z11l1-. 111 Illis .-'111 1- y1-'11', 1111- l111'11'1 111' 'l'1'us11-1-s 21141111 1-11-1-11-11 1-11' 1111 --'.', '1111 his 1i1111- N111 I-I. W. K1-- 11-15 111111111111-11 SllIl1'l'll1l1'Illll'I1l 111 fill 1111 -'1111-y 111' Mr, 112151 'l 112111 s1-1- --11 Z1 l1-'11'1- 111' 2b:1-111--. Mr. 31. P, 13-111-1' 11'-15 1111111111111-11 111'i111'i1121l '1111 111- ! 1 1'11ll1111i111: 11'1s 11112 li111--1111 111' l1'Ell'1ll'l'SI A1i.'.'Q'.' l-I1111i1- Qll'111.', 1,1112 H1-211-11, .I'111i1- - ':1111, I I-211-11111- 111-1'i11g1-1', lJ111'is K1-1l'1111, Vi1'11i11i'1 l1'1y 211111 Mr. '1I11l M 1. H. I 1111' ' 111- 1'i1's1 Il'l1'T 111' 1111- y1-' ', 1111- S1-11i111' l11'i1:'11l1- 1-11-1-11-11 111'1'i1-ials 111 21111-1111 3 111 11: -11-1i1 1i1-s, 'l'l1 -y 11'1-1-1-1 l-l11yl1- H1-y-, 11-1-S111 'I1lQ Clflllit' Fly, x'i1'1'-1l .'i11'lllQ ' 21'li - 111-1 1 , S1--'-1'11'y3 11-11 'l'2111-, S1-1'g1-'1111-211-A1'111.'1 1 Fl-12 H .'l ' 111-11 111 11-11111-.'. Cl'1.'s 1Vill: 1'l2 'l'- 11 1.l1. Cl' -113 ' 1' - ' .' , '.'1 3 R2,' 'Z 'l'2111-. 11i1'1111'i2111. 211111 1'211l11-1'y111- R1-111s1-111-1, 1111-1. f 'l'l1-1'- 1 1,' '1l.'11 il L-xi111,1 S1211 ' 1 Q -1 ft C- --y F'l1'll2l H sl'i11s, ':1'10I'I 1 11- 11- 1' '1 , si . 2 ' 31211 J21111 K11211' 112111 11: F' '2 ' 1, F11-'111' l-I11'1111'g 111- y fl y11, .I11l'- I-2l'1111'3 1Y21lli1- Fly '11111 V1'illi'1111 11'1y111-s, pxlhlqil' -I1'1 's. 5 11'l1 .' - 111 j il 1 1: 111 1-111-111 ' -11- 1111- - ' 11115 111' 1111- Vlf'll'. 11- j -- -' .' -1 P12 l 1 .' ' 1 V' 'ly 1-'21' 11'1-1'1- '21g1-11 1111' 1111- 111-111-1'i1 111' 1111- .1 1l'll. 1211-11 1111311211 this y1211' 1111- S1-11i111'.' 11111 l1'11'1- 111 '21' .' 1111- l1'1'l 1 111.1 -'-'1l11-- I1-.'.-, 1111-1' 11'1-1-1- 1-11g:21g1-11 ill Q Illf' 1' -13' 1-li1:l111'ul '111 su -1- -:.'1'ul -'11111 '1i1:11.'. Ill ll1-1-1- 'I 111-1111' 111-1'11-1- 11 - SI 1- 1: 1 -' ' 1' 'l ls1' ' 1 C1 1' 1 11111 1111 El 1'1-1'y 1-1111111-211 111'11g1'21111 ill 11'l1i1-11 1-211-11 S1-11i111' 111111' 1111- 1111-1 111' 11111- 111' 111- ' 'lull'- l1'l'S f1'11m 1111- 1' ,' 121 1':. ' 1:11 '- ' 1' 1 211 - .' - ts. A 1 ,-X11 -' 1-21111112111111 11 1s 1111- i111'- u1 - '1 -1 1112115 11'1'i111-11 by Ill' . - '11's, - 1-,'l1'- 1'- 5 1'1-ry 3111- - -.'.'1'ul 1'1'1m 1,11 .'t'1111111i111 of f'l1 tIlI' -, 111 -1 1I111'- ' 11 - -' '1111- , P h 111 '1- '1' 'y. 111' . ' 11-- '1.- 11l,' ' - ltp f ' .1'1 H 1111- S1-11i111',' ll 111-li1.:1111'11l V21l1-111i111- I2 '1,'. 11111 1111-11 1111 11 -1' 1-11i1l1-111i1- s1iz1-11 1-v1-11' sol 1' 'l'l1i.' 1i1111- il 11 1s 1111- s 'll-1 ,' .' ll'f. ' ' - 1 will' l' .'1 se-1'1-11 y1-211's l1'111 1 b1- .'l1 1 11'i1l' -'12' 11' 11- 111' ' 1 b1- 11i.'- ' ' - 1 Il - ' 'l1ly. 111 1111- l1'111l1- 111' 1-I 1111 11- '11 -Q1 1 l:1s1 b2111l1- 1111 1'l'1s.- 01' '26 .' 'Ill - 1 1 111-11 1 111 11--11:-, 1111 11'1,l S-1 l b' 115 1-1'-21-1 F11 1 f '--1 ll ,'i1.11 - 1 --11-- 11-1--111' 1 111' .' -1' il 111111 2 1 11 - -l'1ss. 1 'l'l - sz'-21 el-b--1' - 1'1j 1I' 1-211. 'l'l' .111211 -.' 112-112 . 2 ' '-2. ' ' ' 1'h . l'.fi'Il -'- ' -- l'11.'. 'll' 1 v , 1111 -1I'.-1 1' - '- - - ' .' -111111. P---. '-211--Z -' ' x ' S --- 1 I - ' ' 'JST 'l'l1- IV1 111111 p 1- '- 11111-11 .'u1'1'1-1111-1-1-111 'lllf - 'T '1' . -,. . , ,M-1-M-,ff-fm, lam- ,,.,,, Jw J 1, ff ,W ,JI-4, 1,,1.:,. f Q:---f 1 ,,, M, ,W A, i I xml 1926 -..-- Q 1 fxx N p I mx fl Winn N N N . N M X 1 Nl! 4 N l 1 1 N iiiclmiix N X Axim .N sm f 1 . ln 4 P 6 Q Il 1 N , N . N N 1 , 1 N 1 vc Xa ll cm N Q f 1 I 1 1 K Q llll 1 C 4 1 HL 4 . Q 4 . Ill N Y 1 Q I N 1 N0 x 1 x I 4 l N D , s 4 1 s Nt N ll io in + il . N J N mx 4 Q U 0 1 Ng N 4 VN lll S mplmr 41 1 o 1 N tx llll x . lun . - . . X ill U mu 1 e 1 i N . .u ew x 4 If N Q 1 X 1 IQN llllfk ' in r ll e we . 1 4 i iu li xi - ll ii NN pl Ns X i 1 1 is itx Q, flws NN lie ,im iii l mimi N lllllllNl . 1 vw N I mx X L iii . . Illll 1 4 A ' Tlii Niluu ' ,,, f ,A Alll M- I H l'llllClN lu-+ VIUXSS XX'll.l. XY-, ilu' 'l'1 ,1.' ul' l!02lS, in lllirig '-.' ix iiiilixilluul zilnl mlisliiiri Ir1lI'lS. be-iii: zibiii mn lvziw- lllis spliviw- ul' lm l-luv null 1-mliivziliuii, in full masse -.'. lil' ll l'I'2llllllll'll miiill xx:-ll lrzmiiiwl Illl'lll4ll'j',1lIlll :almost Slll 'Vlllllllilll llIl1ll'l'Sl2llllllll!.ill! mzilu- lliix, mil' lzixl will riiul Il'r1lZllllt'lll, liviw-lay ri-xuliim: :iiul nrikiiigl xuiml :ill l'Ul'lll!'l' xxills :mil lll'Ullli.'1'S by Us il :lily Illllf' liv1'vI0l'ol'v mails-. ui' iiiziyllzlp 1'2lI'f'll' .'.' ly spulw-ii um- to 'lllfblllvl' zis lliuiiulilli' N xxixl -s ul' 'iii illlf' iimiiie-iii. lfirsl, xii- ilu lliiw-1-I llizil our ll1ll0'l'2ll ,'v-:Wim-5 slizll ba- l'Hll1lll4'l4'll by our ll'li'l Liiil in-llfuiplie-1's, mir 5llIIQ'l'illll'Il1l!'Ill :mil VXl'l l'UIllIN'lf'lll ldwiilty mlm limi- ln-1-ii Ulll uuv' .A so lung, uiilj Q, :is Ilie- l-ixl :Wim-st ul' Ili- lying, rlril iliv lui -1 il si-i'x'ic'r-s bf- 4'u1'i'i+-ul cm Milli ull plump -mul lliuliily ilizil our in 1'Il1, nur iii 'I'lI. our illlillll in 'IlIS, :mil lllll' pusiliun :is Se-iiims ul uLiI'2lX4' :mil iw-xi-iwlilml mio-li ilsl vi-1'i:iiilly liziu liaise-IW:-el, .Ks lu :ur-li 4-srzilv 'ix it lrif plf-use-ll Iliw' lfzilvs 'xml nur SIITIIXK liuiuls 'xml l!l'2llIlS In xiii fm' uf, xxx- lisi is - ul' ilu- sauna- :is I' ll xxx: XY- giv- :mul lH'lll1l'2llll In um' bvluu-ll SllIll'I'lIll0'llll4'lll. l-I. XY. Ke--. mi' siiiwie 2lY'I't't'll0Il. lll1l'lll l1'liQ'Sl :iz liiu iv. Quill Ilia- uliul - lllllllllllvll ixvzillli Ul'HLll'f'Il'I'Il1ll im-iiiuix Aga' , we- :ini 'ml be-qui-zilli Io our bvlme-ll I u'ulIy :ill lliv ziiirizi 4' lmmxle-lu lllill Ili:-y may lriu- gzillie-iw-ll liniii our vxzmliiizilimm pziin-rs. XY- lmllllj' rvzilize- Iliul Illlllll ul' this lIIl4lll'IllilllOIl must lriu- bw-ii sl'ii'Ilil1uly -W. Nlzil' il bv gin-ii lu Ilie- xiurlrl IN Ili- I iL'ulIy sr-vs fi! In rr-wlzil il. XV- 'also liogn- Il1'1I Ili:-5' will fm-l I'i'w-n- In us- aill sill li bils ut' llllAlll'IlliiIlUIl :mil xxiselom lui' lli+- viilizlitviiiiiw-iii ul' Ilif- vlzissi-s In mriiie- illllvl' ii 'l'lii.', lll,1'llll'S!', ip lf-I'l 4'lllll'0'ly up In Ilwii' UXXII IN'I'SllIl'll mlisc'l'+'Iiui1 ziilnl szili-ly. 'l'lii- lollmxiiiu may sv-in but Irifliiiu bi-qiin-.'ls, but uw lnpl- Ill'1I Ili.-5 will In 2ll'l'Q'IlI!'ll, nur as xiorrlile-ss things lzixislily Ilirmxn 'iw'iy. but up vziluzible- :iss -lp In ll i wl nr Q i'e-ve-ixw Ili -ni. 'ml 'is ai ruliliiiilzil rn-miiimlvi' nl' Ilia- ue-ii:-iwmsiiy ul' lim-url ilisplzlye ll 1 in our t'i'+-+- :mil lull le-pl 'zilt l. 'l'n Ilia- I'u'iil1y, Ilif Ill' I' mul zilliilimlioii 'xml r'X'f'I'-1'lllllll'lIlfI I'1'ie-iillsliip ul' Ili. 1-lzi .',' ul' 'QOL in iiillivimluzil :is we-ll ai: r-ollw'liu- iiviiiil' -JI: lm, 2. To Iliv S4 ii 1'-s, all Ili- iiiI'ui'ii1nlim1 illzil iq iilsciiln-il ml ilu- ml -:ks in Ilia s lj li'ill, llbl'2ll'j'. :mil vlziss ' ms, 22. 'l'u lliv l4'1'e-sliiiie-ii r'l'ls,- Il1'iI is In bv, 'lllv' mo-i'luulu-ml 1 ills ul' .Num wo- mix l' 'X le-ll mi Ilie- l1lll S'tlPS ol' mls-slip, libi':ii'y lsible-s, or in 'my nllie-r Iilu-ly ui' unliln lx Ill' 'ea l, 'Vu Nl- ,'.' rs. Vs--, llzilu-V. :mil Sllllllllllllll, ull lmqiie-ls ut' -n,--5 111111 xx - mix lf-'1 '+A on oi V licks. 'l'u Blu liwing. I.:-0 .XlbI'illf'Il'S zibil' Q fur lqw-pin: lui.-I ziiul lm' In-lliiv llie- I'llll, Ili- wh l- Iriitli, 'ml imtliinf but Ili- I' Ili. li. 'Vu XYil 's l' -y l'lii'i.'Iizii1, IW-xx mxly's ability lu play lv iris. T, To Mia: 'IR-iiiiiv lh-llv l1ul'i.'-, .liii'ii1- .lm 'rs' abil' j lu izilk in l'l1ysir 'l' ,','. x. 'l'u Nli .',' XX'il'- V1 'l l-Viulil. Vziiw-y I-'li-:lu ll .'l ii. zibility to iiiiilzliv- 1 iv, To Ali: H+'ni'm- f7'f'0llll0l', I.2lXXl'Plll'1' l4'luy4l's ability In f ll'l'y mi r-r11'i'+-spmiilw-iif1 will ilu- llilll' .' lil. 'l'u Nlixs N:-l Vmiiplllii, Rl quirk! :mil l','lll'l1l uirl. Lois 'l':1I1-'s lmbil ul' zllxxzix l:ill'il1u mit nt' I lI'Il. ll. 'l'u -xl yi-'i1 s 'iii il slzlfl. Ilia- ability ol' Ibis yi-zii s stall' In lu-1-in Ilia- l'J1lll 'upivla 'mal spain, M '11111 111111111111 1926 x L 1 1 X I 1 1 11 N . 11111 1 1 11 RN 1 N 111 N 1 111 1 1 1111 x , x 1 1 l I INXX1 IN 11 Nl 1 N 1 N 111 11 X ,N N x 4 x X 1 1 1 IH N x 1 N N ,ly , 1 N 1x I QNNI1 41 11 x UUI x 11 N U N Nfl Q N N 1 x X1 11 11 1 N X 1 1 l NN1 xfX2!2'X512Q.fa L13 1 1. 3-n1114-4--u-11+-1 x f,,t',:,,,., J, ,Z 6 ,J ,,1 . ,,.y M - ' 1 1 1 ' fo' V xl.-3,5 , , V - V 1 11111111-:111111.1 13. 'l'11 N111 1':11'Il111' 111-1'111,'1-1', :111 l'111l1-p:1- llll11l111'S, 'I'1'111- Sllllj' X1:1u:1'.1111-f, 1-111, 111:11 111- Illilf' 211'1'11l1'1l1lj 11-'11'1- 111 1111' 11111 11111' 111-slw. 121. 'I'11 N11.'s l':111l1111- 111-1-s1-, S:1':111 I1111111i11u's 1111-:1f 1111 11 11-. 111 :1111111 1'1111u1- :11111 1111s111-11. 11. 'I'11 N111 l'Zl11N11l 11:11'11111'111, lll1' 1-51-1-as :1111 1- 511 11-1-1 111 111-iu111 111 1'11:1111-1 l11'1u111. 13. 'l'11 N111 .1111111 Sl'lllll1Z. N11' - 111'11'1111's :11111 X'i1'u111i:1 Y1l1'11lll'.?- 111:11-11 1111 11.-i11:1:11111, 111, '1'11 :1s111'i11g 111'111-1's 111 1111- .1111 '111' l'l:1 .'.'. 11111' :1l111i11' :1s 11111-ls, 11111-lislq 111:1111:111f1f,1-11'. IT. 'l'l1 'Ill1'1'1 1,1-31111111. :111 111' .'i1 -1' 11'1'111111111 s M11--1'I'l11111r lilll 1-11:1- 111 111:-11111 :11111 rl'11'll1'1', 11. '1'11 Nlisg f'111'lllll1' 111-111s1'111-1, l11:1 N1'l1' l,111111-111:111'f 111-11. 1-1111111-1111112 V1111111, 111. 'l'11 3111 XK'illi'1111 3111111111 111-111'u1- S1111111's :1111111 111 11111'11':1y 1111- 1-11:11:11-11-1 111 :1 111 1111-1'11 11111111-11. 211. vllll Xlisw l':11'lj'll 111-11-. 1':1l111- 1-'11 s :11111111 111 pn-1 111.. 111111 1111- 11-1111111-1m 21. 'I'11 A111 111.' -ll l':1111-11111. N1:1'1111 .111.'-1111 S1:111 .11'.'s :1l11l11y :1s :1 1111111l1 -111 :1l11-11 32. 'l'11N1isf.1:111i1-11:11'1'l.'111.:1l1 1111- 11-:1l1s 111 1111- 1'11111' 111 1111- 111:11r11111111 1l11I11'f1p: 332. '1'11 Miss 111-1'11Q1-.- F1115 11. l':1A' 'I'z111-'s s1-11f1- 111 ll1111l1L1'. 'l'l11- bllll.1ll1l11'11 1i.'1 11111 111- 1-1-1-11u11iz1-11 '1,- 1-111:1111-11 1-.'1:111- 111 X'-1l11ll 111- 111-1-l:111- 1111 1-l:1.s 111 1112T 1111- 1'1-:1l '11111 1'i1:11I111l :111-1-1-ss111'sI 1. .111 111111-3 'll'l1 111:11 111- 111111111 111 1111- 111-slas. 1111 1111- l'll1l11', 111 11-x111111111f. 411' :1111 111111-1' 11I-11-1- 111 1-1111111-:1l1111-111 111' 111111-1-11111-1-:111111-111. 2. 11111' S1-111111' 11ig11i11' :11111 11111111 111-l1:11'i111'. 31:11 1ll1'j' 11111111111 11 11111-11-13 1-11111-:11111- 111! 111 1'1-:111:c1- ilw 1:1s1 1111,1111'1:11.1-1-. 111 w11111- 1.1 1ll1':1' 11:11111':11 1iu111111i11111-11111-sf :11111 i1'1'1-- --1111:gs111Q11ly. ZZ. .1 A' rlllllr 111' 111-111-ils, 1'I'2l51'l'S. :11111 ,'1-1':111s 111 11:1111-1' lllill 111- Illily l1-:11'1- l11'l111l11 1l.'. 11 - :1l.'11 111-11111-11111 111 1111- 1-1:1s,' Ill' 'QTZ 111' j 1lll'j' l,1'1'l 1'1'1-1- 111 11s1- 1111-111 '111 1. 111 :111111 1111'.-1'1- 11:11. lllilj 1111-1' 11111:1111 l'l'UIlI 1l11'1ll s111111-111 lllll' 111111111111111-11 1111111111-11:1-, 1 111-S111 1111-sv 1111-1-1-11 :111s, 111- l1-:111- 11111 111 I11'l'1'SS1lj, 11111 Ill' 11111- 111111 l-l'l'f' 11111 :1111 :11-1-11111 11111' 111- .',' 1 xs, 11-11111-1' 1111'11l111'11'5. 'llll il 1111-11:1- 111' 11'i1-1111s11i11 1111-1-11-1' :111 l,lll'1'X1'l'. .111 1111- 1'1-st :11111 1'1-.'111111- 111' 11111' l1I'U1l1'I'1y. 11111 111-1-1-111 111s1111s1-11 111' :1111-1' 11:1yi11p 1l1111s :11111 111111-1':1l !'Xl11'll,'1'F, 111- Hixvl' :11111 111-11111-11111 111 11111' 111-11111-11 1'1'i111-111:11 1111' 11if 1 111 ll-'I' :11111 l11'1ll'l'1l 11115 11111-ly. :11111 111 111- 11is1111.'1-11 111 1'111' 1111- 2111111 111' 1111- 1-11111111g 1-1:1rf1-s :1- 1-1 lllilj' s1-1- 1'i1, .1l.' , KK - 1111 ll1'1'1'l1j' 1-1111.'1i11111- :11111 :11111111111 s:1i1l 1'1'1111-111:11 s1111- 1-11-1-111111' 111 1111. 11111'1:1s1 111I1:1111 11-,'1:11111-111. lll 1111111-fs l11'l'l'11l', 1 11:111- llI'I'1'11111l1 s1-1 1115 l1:11111 :11111 S1-:11 1111s :51ll 11:11 111 .X11l'1l .X, 11, 1111111, XYi1':1111 111,'11'S 1'1:1ss .111111111-1' 812111114 s1-:111-11. :11111 111-11:11'1-11 :1: :11111 lhlll' 1111- 1:1s1 1111 :-1111 11-s1:r1111-111 111' 1111- S1-1 1111 1'l:1-'H 111' 111 - :111 11.- 11-s1:11111'. 111 11111' 111'1'h1'l11'!'. 11111 11:111-, :11 1115 1'1-1111111 211111 ill llif 1-V f-1'l-1'- '1111 111 111- 111' :1-111-1- 111' 1-:11-11 11111111 si:111-11 11111' 1.::1111-:- :1s 1111111 -.'.' -f 1111-1-1-111: 1':11'1-1' 1-'11-11:1 1111s11i11f S1l'21ll ll11111l11l! l14'1'1'j' 19111111 1':11l11- 1-'11 .L -:VA K. u 1 4 I -uw, U . - 1, - -, qw..-' 7 . THll2TY'FOl 'R Thr I,,v:ci11giu11 1926 -..-.. ,.., f' 1 7 -'ffff A 4 51'11111,11x1111111111 ... .. 1 ' 'Y . 1, ' s 4 ll ll 'Nl0R1l S 111 1 X 1 C111 1 1111w11 N 111111 111x1 31111111 X 1111 S111 1 1111 1 1 1 101 111 11x 11111111 111N111 1 X 111 11111 7 1111 1 11 N X 1 11N 11 11 111111011 11 S1111 1111 5111 11! 11111 1 1 ASS PAN1 1 1111111 111111 1 1111 1111 fl111I11 1 1 1111111111 11 1111 311 1 ,.x X ,,f -ill! 1111111 117111 11111 L11 1111 111111111111 111 11 1 11111 11 11111111 1111 111111111 S 11111 1 1 1 11 11 1 11 C1 3 1 1 111 XIX 1 1 1111111 3 111 1 111111 111 31111111 '311C1 S1111111 111111 111 11111 1111 nlkxl 1111 1 1111111 1 1 31131 1 -X11C1 X1111111 N111 L111111111111 11l111I11lX1v 1l1I. '.AS.' 1'1' wi 1 'I1111.11111.'1' .1i11111' VIC 1,1'1'51111'1111'1111.1.' 3v1'1'II11l' 511- '- 11111'-'1'1'1121s1111-1'--O1 :11 1.1121 5L'l'g'1'21I11-211-,X1'111S- --331111111111 3111111111 1 511 .'1'f311.'1: 1 1111111121 11211 If ,V 1' 111111115 .1 11 -.' Tico 1 V 1'1111 111111 Y11111- I 1, 1. 1121 '1'111'.'1JI1 2 1 1',1' Q111l111 ' 11111 'l'111 '9 111 1111s1 A11 1 1 1 11f121'111 C1 ' '1 T111111 1'1f1'i1 11z1g'1111 1' 1j 1 z 1119143111 1111111 11i111'111- ' '11s 11211 ' - 1111111 ' 11111 1'I1'11 1421111 '1'11'12111 111 11'211'11 3121 '11 1111131121111 31211111 1121ig'11-1' 111f1:1j '111,'1f 1111211 1,1121 1-111111 1,1 111 1l2ll'Q'2l1'1'1 312l112l1'1'3' 1'11l111 1i111111ss 111-1111111 311-11111 112111 31131111 11111 31111111119 ' 1111121111 31111 'L Q' 1,11111.'1'311111'1' 11f12111.3!11':.1- 1'211'13'11' . '1111'11111'1'1' 115 A. -H1111 '1'11'1-11111 112 11 111111 3 112111121 1,1L 'C'1' 111'111'Q'.2 ' 111118 '2 11 1' 1 1 1'111'1'1111' 1'1 ,' 1 11 -12 U li WV? 1111121312 n'12 111111 11 1101'- 1'11-1 2 1' 1111 A 1- in '11j 3v1'1'11111' 312 ' 2 1: 1C1111'211' '.1' 1111 1l'1'111' 12111 111113111111i1'1' 1, 1 . ' 11' 1 .' 11' ' 1151211 1.1-11 iillf A ' '12 1,21l111111' 11111-S11 -I ': ' 11 A ' 1 -' 2 'z ' '1 1111111 31111 . 'I111111,1' ' it .,., .- 7,1 Y. ,, .. -H ., , I... .1 . . 15.1 - ' 37'-'rr-'fffve-.,L.av,'1Zr'Q1,Qe,. .. '- . . ' , -, i I 1 Q I ,,, ,S v A f I, , , ,,,,..,,,.,,,. ,.,., ,,,, . , ,, . i qihr ' ,M Q . , . . . , 1,,. -MA ,. , , , ,,,A, ,, ,,,,, ,, , ,..,, 1926 Q ,A ,, ., fw, I ,W V. 3.1 --I--. ,,,M-1 M. ug ,- I !U lL'.Li !N -- - 4- -A .M - 1 ff, ,M . 4 aff W f 1 1.' 2 V1 Emi , ji if any KWWWWWK W e , 1, , if- ' ffl . W 4 ' . law 1- f er'-1 f 2 .1 W , W - 3 it E55 ft ! I 9 15:2 l . V42 Q E f V ' We f 1E ug g ,f .i Lk! 7 ', N 'fl gin! E1 ,i V : iff , g'I ff 5151 nl' I ,'- QA f L Q V, I 5- 41 mg 2 -3 2 , , 1 5' 4 1 'Y 1 yij Q ,I . X. Q1 1 Na ff 1,11 qw 1 . ' ,4 S, ,' I 3 Q , L' fu : 5' f M 3? f , Q 2 . fz 'H V 4 , . A ,l Q J, . h z Q3 7.7, 1 ff fb. -1 -A - 'Hz i ,f 1 1 ' p ' ' V if , . ,y Ss. T ' iii . 4 .., , ii sf - ag: fghs Im? , , .,., ,,,.,,, ...,., .,,,,., .. ..., .,,,,..,, ,.,,, ,, .,., ,,,, ,,,,, ., ,,.,,,. , ,,,, , W X Wir, ,f f, , ,Z I t v v x -'f f ,WLM . QQZZJ ff 4 ff fl ff fyz f 'ff ' 'WQWQX f,f',M',,7V'f'Qf.W'f '4T41V'Vf ZXVWWK '?f'Y :, M 4' ' 47 ,2Wf'Wf' ' YV' '5 ' f ' 'I+' ' . ,W'fQff ' I IL -winner: l1LXIIll 1926 1 1 I 1 1 1 1 1 ll 1 1 1 I 1 I Nl 1 11 1 N 111 1111 N L111 1111 1 1 N 1 1 I X 1. 1 N N 111 N 11 1 1 1 111 N1 W 1 x I I I N 11111 11 1L 1 N ll 11 Y 1 1 111 11111 11 N Ldll. 11 W N N 1 1 1 N1 lf 1 1 5 l , 111, 1111111 1111111 1111111111 N11 I, as x r 1 '- ' -- '111 -- 111111 11111111-111111 'I'11I-I.ll'NI111'121188 1111111 1111111211-s 111 I,1111u11-1111111 N1-11 V111111111111 1.1s11-11 111111111 S1-1111111, 111111 51111 5112111 11 Z11'. 'I'111- 111111111 111 11111' 111:11 S1-1111111 1-111'--1-13 'I'111- 1-11'Fl 111 S1-1111-111111-1' 111 1111- 11-'11' '31, S11 111' 111- 1-111111- 111 1111- 111211 Sl'1l1lll1 11111111 11111111'111u .11 1I1s1111'11-5:11111 1,111i11s 111111 11-111-3 1-'111' 11 - 11111-11 111-1-1111' 11l1lll'S 111111 s1111l11-s XN1'l'1' 111-:111 H111- 111111111 1 1l!'1ll'1' 511111. I1' 11111 1'xl'l'F1l1ll1'11 1-111111-. 1111111111 111 s111111' 2111-1 1111111 1111' 1111111-. 1'111111f1- I1 11i1-1- 111.1111 111 11113 111- 11111111u 111 11-11111 1-'111' 5111111 11111 11l11Sl. 11 21 l'1'1'l111 11111 l'il1'11. 111-1-1-'S il S1112ll'1 111111- 1'112l1I, 111111 11111 1-1111111 11 111-'f .X 1'xI'l'r1l1llilI1'.' U11-111l1'S1-f Y11 '1'1- f1ll114' S1l141111lS. 1 S1-1-. 51211, 1111 111 1111- l11,11l'0' 111111 S111-1--111 1111- 111111-111: 111-1'1-R 1111-1-1 I1ll11'l' 111-11 11111115 111 211 1111111-1 111111' 2l1'Il1. 111 11 1111111-1111 1111111 -11s111'1-11 111- 1-1-r1s11-1-1-11 s11'111u1111 .X1111 111-11 111111 111 1-1-11111-1 1'X1'I'y 1I1f1l'11111Lf 111 1-iu111. A11 1111111 11111' 5111111-S 111- 11111-11 111111 21 ,'g113 111-11 111115 11 -1'1- s11 11111-11 'IXX2lr 1111 1151- 111 l'1'y, '1'11 1111- 1111i1-1- 111- 11'1-111, 1-x11111111111: fllll' 11111-, 11111 1111-1 111111 11s 111 s 1115 11NN21s111-11-1'1111l12l1 . .X111 11 1111- 11111111- .'111 S 111- 1111111-11 111 1111111111 111- 11ll1r1 1111111 1-1'1-11 11111111-1' 111' 1-'1'1-f111111-11 1'1-11111111. .11 1111' 1-1111 111' 1111- 11-1113 111 1'1111111 1111111111-1' six. N1211lj 111-1'1- 1111111111 111 Il I0'1'1'1111l' tix. 1 XY1' - J111111- 111-1'1- S111'. U 215 .1 ,' 111s 115 1-1111111 111- XY1 11 ll 1'2l1'11 11111 111 .XR 111' 111-1'111111s 11 11: 11111211 1111.1 1111 111 11111' .1111 1-'1'1-5111111111 1111ys. XY1- 1111111-11 !I'l 11 111211115 111 S1111111111111- 1111s. S11 1111' 11-1-111111 1l'1'111 1111ss1-11 111111 111111 1111111111-11u1- J1' -11 112111112 11'111' 111- :111111 11-111111-11 111 2l1l.'NW'I1 111 1111- 51112111 .1111 ' 11' 11111111-, S11 111111111111 1111-1-1- 1-1-111's 111- 111111 11111-111-11 111111 il s111111- '1111 111-111' 1111- 1-1'111111 112l1111' 111' .'1- 1111's 21 1111111-, l'1s 2111 111111111' 111-11 11111' Rl 11-11 11111 - 11111111111-11 1 111' 1111111211 111 11111 1-11 . .'1-s. ,'11111-S1l1111'111S 111111- 1-1-111111111-11. .1 1111111,:111 111 1111' 1111111-1-, 1111' 11111'11S 111-1-11 111' 1111111 Is 111-1-1111111111: 111' 1111 '1111 11111' SI'1ll1l11 11111s s11111 -11111 1111' 1'0'2ll111l! 1111- 111,-1111-1' 111' 1111-11 111 1111- 111151 SI 115 1111 1111- 1-','111s 111211 111- 11111111 11111 1-151. 1'1-1-111111s 1111- 1111-111111-1' 111 11111- 1111 u1'1111111111- 11111, XY111 11111111- 115 Slll-1' 111 21 1111111111 1-1111111f11 11151 1'l11 11 5112111 1112l1'11 1 ' ilu in '1'1' -' '-ur XY1 1 1111- 11111112111 111 Sf'11ll111 111111 1-111-11 Il21.'.'111U j'1'111'. .11'.'1111i f'1..1SS 1'.1.'1-11. N 1:1111-1 N1111111115' XY1 111-1' 11t'1'.'U11 1'1l1'l'iI11- 1111115 '1 1,151 U3 ,pu 1'11'1'1y11 111-11- 1:1-1-1111-.1 Snyilh x11l'X111 1111111111-1: 1-111111 N1ii' .'11211111l11 V1 1'11'11- N1- ' 1-111' 1 .' N 1 111-11111-11 X11-12111 1'11'u111111 1'11-1'1-1- 112111114 1 J11Il A ,,,..,, .,,, W ..........,-.., I , , . 51,1 , .,. ..,.,, , ,, . , , N . .,,,,,, 5. 5 g. 5. XXN :N I l?? 'l VZ ' TT '.'7fSF,7'f 7 w 77?-2 ff' ,. ,2,,,,Z,Kf,,,.,,,it,, ,,,, , ?V,.,,7,,,,i,,,, -W 7 qqh Y Iac II qt U n 6. ,,,, WS, ,.,. , -i ,,.. ?,i,,.,,,,,,,.,..,,,, , U., 4 ' :fff,vqf , -, f '.f wwgf'3. 3 --ff f ' X - ,i ' T2 ' ' H' , , 1 ..,,,,.,, ,,,..,.,-.. ,,., ,. ,,,, .,., V ,,,, . ,,,. M. .,,, ,.,,,, W, ,,,,,,,,,.,, ,,,,, N ,.,, g:::z,N,z'4 , 'Q 4 'f'f ,-fb r f ff f H , r ' 1926 . f,,,,wV-YNMW. Pfrld, ,,, THIN VY-ffI13Il'l' fi! Ay , f ri .H 'I E f L ,2 Z - 2' 2 5 W? , ,X af, , QQ: 4,6 ,ft Wlfl 4,6 I ,U 0 fx, 41,16 ff fc, ,fb uf, , 6 fmw aff 0 , M f wwf, 4 ,fy U , fwmwywwff mfwfwfwwmvfmvmnwwwfw, W1 J wmfmwffxwrmwlwf f l fl 5 2 V 5 1 ' 5 Z? S 2 5 G W i 1 X ' I J. 4 :U I , 1 f 5 . V 3 ,. Z 4 V f 2 4' . , gg , M! 4 Zta 47 X, M t X I' x Q 5 Hy V If if im 31 X Q 1' ff 12 Va, fi? 54 ,f RH 5, , N 2Q , , 4 S A x 'f 5 A H fn , f H ' 9: I S' Q 5, 55 X, 'x as P ,f 5 755 1 A f' M 4 2' 1? Q 4 MM ad ME 3 1' 9 2 Y ? 1251 eg 3 ff. gg ,F .1 1 ? 4 'Z 11 4 ' ,Q f 'f ti w 1 5 if ' q w L q 3 I JI 5 ,V 2 --- - - ' - z: 2' . um, f Qf f, , jg m ii ' ,W ,,,,.,,.,M,..,,g-- V YW.-..,N,,,,,,,,,.,,,,,N,,,..,.,- .,......,..,., ,,,,N...,,,Wz . Q f -' 7' , ,, mfg, ,,,H,xr, C, ,V ,, ,,.,, ,, A ,, WZ, ,W A 4 I ,f A Q , A Aw, f ,fc ff A , , , f - 17 . f1,gj5j'jA,,jj ',A',:!ff'f 1, T111 1,,l2X1II111L'IlI 1' . . A 1 . , . 1926 113, ' ' ,,,,,,,,, w' 11111-?1'1 'N1N1 1111 N01 HUVIURI 1'1 SS 11 1 1 4111 1 1 N 1 X 11 X N11111N111 N 111 .1111 11 I 111 1111 1 1111 11 ll 1111 XSS -X L1 A11111 1 -X 11 1X11111 111 Nl 111111 1111 1 11 11 1 11 111111 1 x11 1111111 N 1111111 1 1 1 NN11 UN 1 1 K 11 If 11111 1 1 1 X N 11x 1 11 lx 1 N NX11 111Q11 1 1111 S1 111, X 111111 11 N111l . 1111111 511111111 11111 N l 11111 1 1 1 iN 1 1 M 1 I 111'x ' N ' N.2,f NxM,f XN.u'ZN-.,l .f N 0 ' arur1-vu:-vm aulnvvewum '1 .' ' . 'I 1'1'1's1111-111,--111111111 1.1'1' 111' 1.111'1'S V101--1'1'11si1111111 --1 1'111111 1 15' S111' '1-1111jx -'1'1'1111s1111111'---1i11 1 1'1111--.-1111 5l'1'11'1'21111-111-:X '111.v -1111'11 5111111 -113' I1 1 2-M11 .11111 -'1- 1 1911 1'1-1' 111 islv C' 111'S NY1 ' -:11111 1211111 1 1111 H1111 '1 '11 is 11111' A' 1 1 1'1.f 11111,1, 1 .1i'-.' 11 -11'-'A 312111 Y11'g'i11111 11 111' 1111.4 111 ' 1 K11' -'11 11111 -1'1 1.1111 1111 111-1's 1,1111 C11111-5' 1,11v.'11g1 11111111 1'11f' 11z Wi11's 1' 1- C111'1t111l11 1,111'111'iZ1111 .1111'11 . 1 1 1111 Virgil 1' 11111 '1'111i11 M '11111 f 1 115'1- 111 vis 1'1n 1 31 .X111,j111'111 1 111111 11i1111'11' N119111 1111 111 1111 1' 111' Y111'111111 11'1 111'1'111 V111-11111 1111111 111-1'11'11111- 1111'1- 111-11111' IC111-1 11511111 1'111.'1-1 C1 :1'111' 1C111'1g 1,11111111 1-I 11115 1'11'Il111i 1111 1111 J 11 111'.'111 1 11111111 .'1'11w1111 111','. 1 111 ' 1'1' 1 1'I11' .' -1 '111 1 111111111 112 ' 111 3 111111111 112111 1.1101 - 111x K11'1'11' 11'11'1 - 11' '- 1,11111'11 112 ' 12111 111'111' H11-1111111 i l11'Yf111 Sll111X'2l11 A111 1 V111'1i:11' 111111111 Y1'1x111 1111'112 XY 1:1 1'1,.XSS1.XN1'f1, 1111 'l'1 1,1-1' 111111111-Vs .111s111111i111- K11111111111 1 1'111111 11'1y 512l.111I'11' 11:1111- Xlli1- lim.. 11213-1 1111xis Y1'1'111111 11'1-'111'1'111 1.1115 1'I1111'y 1 mlm , 1111111111 1'I11111s 1.yl112l 1'11u111 K1 1'1111111+1111 1111111111 XX' -S1 I 111111121 111' l'11i111111' .1411111 .'11l111Z N1:11111- Y1'11Q:1-1 11l'1'11'11111'11111l L XIXIL 1926 ANS C r xx ll 1 x N N 1 lll r N U Il: Q 4 1 l 1 X N 1 N 1 xl1 Q lNl . N X too llll space U 1 1 H u lflllt to uu N 1 .gy Tu ' Lv- -llllll 'l'lIlC SOIWIOMOIIIC C'l,. Lilly' Ffrllvy l,2lXYlk'j' XX'V1'c f+11't.v Soplls in ll. ll. S., Aul ' at xx- lczlru is uumyl El ig -ss: llut il' tlmonl' SUITll'llllIl5' iu El -uuv, W 1 suv ou tlul cow-tl-ll ro-ul to l'-uuv. Ou ' Cl-ws is upt lu stzuul illll' Lust, XYitl1 llzwtmuu and lfly among' tluf lu-st: 'ut lm' tlw flllllllf, -ls ull ot' you l' ow, l'l1 'A' curl- VUl'.X' littlv for Hlillilllg' 2 .'l mv . l'o u-muy us all would l'U1Llll'U lclw 5 - ' No l xvmft Vlllhllll' youl' ,mul Q ucv: l'vm- givefu tlw tl ought l x X- A litv, T: l'm't5' F-uplms 'uw ull just riglll. I '1llllLXIIIl In 1926 -Q-......N x l x X PII x x I N 1 N l I N N N x Q N X lx I 1 N UU 1 1 I 1 W5 QU '.f 'X .fix .f 'v4 1 '84 f -ndbiklff 1 ' ' ' H fu Al 'l'lll-I XI l'II,'l'IN4L l'U'l' 'l'Iwlfw5I1n1:l1zK'I:1.fA211111-llirrpyyml. 'l'llv1'v if lmmlrlityx' xxl-l1:1x'v1mI: W - sm- llill21lSHlll1', lwzlllliful. rIllill'l :mfl Q'l'i'C'll, ' .klmw:1p11l'up1'i:1l1' l l.'l1 lmw ll4'X'l'l' lM'4'll Sl'l'll. rirwuw ul' up Slll1l.X'2ll1fl Sllllltxlblhllrflllllll. Sn 1- nl' up lwlru:m1lsfm1v1+l'11.' xw11'1,. llul vsilll:lllwl'm11'l':111l1s wv'1'vs111'lgw11'll lim l .X xffrulm-1'I'1?li'l'1wsilmlm-1ll,x+11lw'. ' YU- 2lI'n' ilu- l2ll'lLl'k'Nl vlzxsx. s1x'm'l1lAx'-Ixxw in :llll 'l'ug'w1l1m-1' xml slzmcl. lllxlflvcl uw lull. XX' -'aw Imul ul' w111wg11m,m', Mi . .' ll2ll'l'lSHll lu-1' :wmv l'xw1q I'u1'11m:11c' lm' Us XYlll'll lu lli Sc-l1cmlsl1vc':11m XX '1'l- l1m+,'tv1'sz111rl lf-,ull Tgnrmlfl ll. ll. S. 'l'lli,', will mu' lll'2ll'ls ml will :1lw:1,xs slr Wl Ull XE1l'i1llUll C'4llllPS21llfl ww ll-'xxx' Ilwxm- cl Vs. ' XY ' ll'llSl xw will :1ll ln- Vl'is - Suplm11m1'vs. -'l'Ilw:1r1fw1' ,lmws 'mll Willlv Yillljllll Ilriglll 4 X ' If Wi::A31'gi3:l,???gQ.:-3 V,.l, ,,,, I l Al ., . V. f v 1 U: Lpxin qtuu M' I ,T ,.., , ,,.,.,,,., ,.,,-.,,,,.,A.., ,, , , ., ,,,, , ,, ,A,, .,,,,,,., A,,,,, , vi ,,..,,,. ,, .,,,,,AA,, W ,,,. , ,,,. ,.,.,. h,..,N: . , .A , -H fw FORTY-TVVO in ' - ,ijfffil , , , + , 4 ' 1926 f 1 .....m L '..z I , QM! f 0 ,f f,! f f W 0 1 fly WMV, !f . z 5 , I i z , I , , ,,,...,...,.... ,,,..m,,,f.,,,.,,..,,N,,,,,,...,,,,.,...,,,f,..v,-.--ww,W-m,,.,,.,,...,,,,,,,,,,,,,f,,..,f.,,,,.,,f,.,,,,,,,,,,,,,,,..,-,,.w,MM.,.,..,,,,.,,! 'Q7fQ,2fLQ'zL' ,'ff fbif' pf ' f' -t ww' fn wwf? -,Le ff -Y ' , ,,,. ,, , , , , , ,. fr pf 4 W fl, ,n 4 fqfw,gfgpm7'1-'g,,4,,,i,'5w,H,,i2:j,M,,, 71, I ,, ,, 4, ,,M,m,77,,Z,, ,ya ACTIVITIES f Q?Mm:4vWvfzQ1': T7'7QTLj,74fW,4 Th 1, I , ' 344' x x ' l 4 , '7 f:Mi127mWzzfrW Jill WWWWX 1 ,Q I L X I n H n W 0'f.mmfwnuzmimfnumfwwwwfwnfmmvzwamfzwzzzzffzffwemffv'ff ff wh 4 my U Q RSX., 9 xg ,, -fwci 2 ,sf N f 1 Pnl' JL..- -2-ff.: ,Z ' ' x-.ww 5177! X M M 'A'l ,aww 7 4 v ,... .,,.. M,,,...,....,.,M,,.. ,,N.,..,....,,,.. . .,,, ,...,,,,,. .,,, , , ,,,..,,,,,, , ,,,.,,., .:w:,x 5,,f .,.. .,. -----v Zddvjwm .,,,, ...,,..,,,,..,..,.., ,,,,.,..,,,,.,..,,..,..,., HN.w , , .,,,,.,.,.,,, N ,,.,.. ..,.,.,,, ..,.. :AK 5, 5 if fb WWE: 'shi ,113 W mn Lx -1 ring: -....... 1 ,.--. r TN-9f 'N J.f1'N-.,11xf36'x!'Z1l'! 'x2 f 'X 'ff 4- '-fi? 11? 4' WJ? 54 'ff' ' 7 'F wsu 4 7' wmv, 4 7 ,V f wzfrvnw If aw wmv azz 414. V - . 2 f -4,-1-.f -- , xy Q fp- . X: , Mx.--ff xxzq- sw 2 X114 X- ' N f . - Q N- ' Y' Q 'N - . .N 9 Q N' WM' TT11:12:1511'.11fg1,::1,::i:':'1..,.31,,::t1.,1,M,.1,,gi..1,gL.:11.' ':L::' 'M ' '.:t:1:i::'.1::.,1,'11L11t,1i1 'i1L11' W ' i' ' ' W ' Lg,g1111.,,,.,,L,g,g.',,.,.1: ,, , ...,,, , , 1 , ,...11L. gg,.,Z- ,, . ,, M, J - ir ,Q S' is F if va V . :xi E , K Gig .I 'z e i 3 .i 1 s SQ 3 ,g ,S ?! ,s 52 I F ' .. 5 X if 4 'f Q .' I li F5 1 fx I gg! ,E 1' I . if 1 I A 5 ii id ,E 5 E, 5 if qs . . X , 5, .i ,., - I v Q ,qi , !' Y 5 5 1 lif SQ ,S , E - , E X, . . ,i -5 ie 3225 ' X 3 52 M i X3 X . ,XJ X , ,, ,. ,X X . ,TQQfi'j1i'giQft:f'jig2j'1 .'jgtgg:1 ,As ,N gtjggi?j,t5jQg,fjgfjjf ,:.gx'l::jQgx5fpgxqjfhg, , :jXf:fLgE,q 3 H , .,.,,, Q, .,,. . Qf ,,,,, , , ., ., , A , , . ,,,,, ,,.q , qw, ,.., , ., , , ,wx HRW 'SQ N N x x x N N 1 X I 1 1 JK' X 1 I ' L1'11l' 1,1'X1.1II:11L1ll ' - 1926 K CAL P DAR 1 1 N 111 I N I 11 N1 .1'11 ': 111111' w . 1 S1II'l1IX1I11.11 ,'1 1111-111111-1 12 S11111111.-1:111- 1l11 X5 14 I'11'1111:111111-1111-1:1111111111:1l1-x1111,-11-- ,'11?1111111111 Q11 X11 1511111111: '111 2.1 11111111.5 112-15f1' 1,11 1111111 ,1111-1111111 IX S4111111: 11111111-111-111111111 1l1111'111 11111111 11111111111 I'1'1111:1111--f '1'1111'1111111 1111, ,'1111111 111111:1.'111:11111111i111 11111111111 I11111'1'I1111' X1.1111:11S':111 111 I'111!I-111 1111111111'1 1, 1-'11--1 I1111111:11I 111115 N11. 1111111-1' 11:1-- :111 1111-111'1-115 !11'1i?-1'11111i' I11111-I- 111 1111-11:1111- 1H'11l11f'1 Q, 1-'11 1 9.11111 111 11111 ----:1f1111. 8111111-11111'1L' 1 .', f11'11111111 1. V111-11--1-111111-X111111111 11:11111111111:15f 1l1'11111 1 ,Y1 '1111 ---1 1:15 1111111-1111111-:11.11111-':111111:15 S1 111111' 1111111 1.1i11X:11111f'1111111 11:11:1111 .'11111111I1111'1!'1111l111'1'111x111I1f 'I1-x:1- 111-11115 i11111121f 1i11fI1l f11l11111111l1L'1f11l1V1-11' 11:15 111.l1'1'1'1111'11l1j 111Q111 111-111111'1' 11, 1l1l1l'1111'11 1111- 111-11-' .'1-11i111f- 11 :1111 lL:1l111- 111 11111:s4' 1111' 111111- 1111111111- S1 111 11-1 f11-111 11:11 111-1'f 111 1111 111115 1I1'111111'l' 111. 111111111111--1111111111-11Ni11I11111111111Q:11111- 111-111111-1' 111, 17112--I 512111 1111-1-111111. 111'1111J1'1 1fP. l11'511111111z1111111115 1115.113-1111, 111-111111-1 III N1 1111 3:11111 112-1' 111-11111112141 l'1111l11:111:111111-111111 1,111-1111:111 1111111111111-1111:1:11'1-1111111 111 1-11111 111-511111-1, 11111111111 111 11511111 1.1. 1111' X 1':1s11:11111-f 1'1-1111111-11. X1X'1'IN1111-Q11 1 .'1 11-111111-1 3. 1111-115l'11111is11111m1'1111111:1115'111:111:i111s:111i1I11:11'z111-1111-1-l111'1-11115:1111:-111:111fI1111. 111 11 .'1'111111 f-l:1L11-fx :1 s1111f1'1'i11111111 1-111111-sl, N11111-5 111111, 1111- 111-1111111 111111N1111111- 111111111111 11 111 1-1i111i11:111- 1111- 1151-1111113 111 1111-11 .111-115 1:111111115 K11111- --111':11111':-, 111:11 S1-1111111 11111111-11 111111 111111 :1111111f Ill 111111: 1111111-11 111 l'I1111l'-1, '1111-111-11:11111111111111-1 1111-11:11111 411111 111 X1:111111:1- .1111,x111N :111-s 115 I1111 11:11111- 111 X11-11-111'e, 11111 111:111:1- 111 11111111-IX 111111 1 ,'11JXfll'H 1111511115 1111-1211-1-115 1If1l11'1' 11:15 '1':111-. 111111 11111 11111 1111- 1-1111-11-11 H'111'1f' 111 111' N1 111111, N111.11111111'1' 11, Xll111111'1' 11:15 1-1 111-1'-1. 1111111115 111: 1111-11111111:15f 11il1ll1'V11l11 Y1X1l11 1:11111-11 41111 S- 11111131 1-1:111 11111111111I1'11'1l J1111f1 -11l1l'1-. 1111 1111- X111111:11. X1 -111111-1' 11. 'I'111 1'111111-ls XX111f 1111411111115 112111-1g1-111111115 1'1l1'11l1' '111111 111 1111- N1111111, 1-211151111111 1'11.1Gl51'11 l1I1:- 111111X11:11 11111, 151111--1111111111 111 211-1-11 1111 1-1-- 1, 1-1':11'11111'f- :11111 f11111:1 11.:1111 '-'1'11- .-1-1'11-11. X- W- Tlir Lrxiixiiluu 1926 'Nil l X IX ll 4 Y I 4 r Nl 1 Ill 1 I N x x 4 I i l 7 XX N I X i , R X X Xu I I 'vlwnur .rf 1 l'llll'ifl lXl vc 'lliluv-1' lx, xii K--V iiiw--i-iii? Si- iiiiif Xkllll :i i--xxaiwl lui' llivli' iimlili- xiurli nl llv'l'l1l2lllllU1lllill'l lui' ilu' iiziiwiilrx ,W illlllvl' ffl. Sfiiim iliiuf li:iiv- vrrlilv. Xll1xl1'Xl'I'XlJIlIlX liliwa llll'Ill. tllilixzili-V: plays uri Nix ll !I'fJllllll. 'Nix' iiilwl' ffl 'llixiiilifuiiiiiu llwliwlziy XX'1'1lllJll lvzwl lil- lllillllillll ilizii XX - liiiw-If! lllliiliv-ll jll l11fIl'l4IXll!lCIi lm 1' llllI l l. 'l'lii1'l'wi11-lifllixxliu 'l'li1- lll'Sl :mul frilly mn- ul llii- fmiwuii. l'l'm'w-ils lui' llll' In 114 Ill ill Iliv .Xllllllill Ilr'l'I'IlIll I' 3. 'iiii.lli.i fin-i1fxw,iii+'f In lXXlI lllll XX1'2Il'!-lJl'Uli1', lll'l'l'lllll4'l' li. .llllIifll' iii-xisif:ilI1-iw, llii- lzilw-sl lllllll rrlll. l: l 'llIlIl'l T. XX' mi:iii's .' urly l'l1il lirmlilrl lrl'HLIl'illIl in zilifllluriilm lm' llllI'llll5 ul im-fi-iiiiriu llllfl Sliiiulf liulil fluff Illvvllllt. Nil lily mimi' su xx- ilwviilwl In liaiu- ziyimlii-1 im' Iiiiiiciiiwixx, Xlix li :-f- :iv--s ll? :i l4'f'llll'l' uri lin' flrills 'l'l1:il :iI'l 1'iizm1i xx - XX1'l'1' .'11i'lfi'lsf-il ln i liiw- lziliii l'.'i llvvm-liilxi-l lll. Vlillll-'Il'lll1lrlS Slzimif siulv. lri'r'1'1iilr-Ai ll, lmiiil llrilliii'-X ill-lziii-il Ir1'l'lIll'llIillH'!, .X lzniu- :mil i-1ill1i1wi:if1i1- :iiiiliviii-v ill lx ur'-v-If-il liim. l'1'w1ui':m1 lully 1-iijfiy-fl. ll1'E'l'lIlll4'l' III. Sviiiuix linlfl :li-liullllul Siwzmisli ll2ll'lX' :11 llio' liumw- ul Xlis, if .X, lfvlifmls. 'l'li1- mini 1. Jlllllwl ul' 1'lllv'l'l1lllllI1 lll Nui: an lllr4ll'XX2lSllll'lLl r'm11n','i :itll-1' Ilir- 11:ii'ly, llvvv-iiilu-i lx. Sl'Ill1ll's ul lzisl iii llii-ip nzililrzil :Ali-ni-iiii, Ai-I Vmiiiri swviimis lui' ilu' i'lll'iwlllli i.m:,:i':ii1i, ll:im11 ' llziyiirls msifli- ai lyiiir-:il lzil Semin Vlliils. I-fXili'5liwly iw-f'iX--il .i lin rl, 1-ziizfly if.l' In-iii: :I urrful vllilri. Svlincml 1-lnsi-s thi' Iwo in-1-lib lluliilzljv. .IAXN '.Xl'X' ilsiiiilziry l, Svlwfrl lu-:ills aiuuiii. .lilllllillj ll. Vlvfluf' f'1ll'il suli- slums lnilzly. llwlsvf-:i1'fl ilXXllf'l'5 zillim wil Irv u4vlwi1iwl:i.'I in iicnl :if il l'wxx:i1'1l. .lZ!Illl2ll'fw' 23. Sw iifvrs Slill'I lrl':l1'liI'll!u lm' iiluyf wriili-ii liy lllf-nisvlxi-s, .l2'Iill:ll'X ZX. Xli:-, Xlim-iilxilili-i' :ml Xlrs. llllili-lxiuxiiil visit us ni: i'1'iii'1's1-iiliilix--s nl ilu- X' T7'llrlX'l'1lll1. 'l'liisi'li1lv1l'l1'i's lliiw-prix'-rl1zi'lli'-lu-sl imriuiiinl lm--ins limii lliuli hflmiwl lirwilx, l'lCl1lll',XliX' r-'4'lm1'Il:i1'5' ii, Sir :llliwwx rI'1ll'1', lCx1'i'yfuiii' ll2lS zi sim- zirm. l'f-liiu:'i'5' ll. .lwiiris f-iw' Swiiirmrs :i X':1l+'ii1iiii- pgivly xvliiiiwi 1'Xt'l'f'Ill1l' um ai Il1i'ill. l 1-lxi' tary l l. X':ilf-iililiii llziy, , V 1452245 '. K 1 111 XIIII I 1926 11 XX 1 I 1 x I 4 II In LIIIN I N 1 X I N II II I 1 II 1 X N1 X XXX Xu X X N I X IX lllI4 N Ill I ' UQNN L 1 I ll I II 1 I ,TI ' .,1:- JILII l,,,X WNW I4'IlI'II1II'j BN. T51 'XXI'iII1I' s1I1IvII. III- aII'1I Im' III-111111. IM'zI1I 111' .XIII-2 XI XIIVII xIlII'1'Il I. XX'1'1'+'IvI11':1I1''I'1Ix:Is IIIlI?'IIf'IIIII'IIX'0' IHI5. NI7II'l'Il I, I'1II'II's IIIIX' Ivy I1-'II1'I'iI III. IIIQ- .XII1II1:II. XIJ1 l'Il Ill. XII: I'11I'I'i1I, l':I11-.X11I111'iI 'I11 I.iI'1- IIIsIII'II1Iw- I1I:III :Im-A II 1:1III IIII II1I11I '-I:II'1'II Il. Nlifs I.UIaI I11II1f II1fI'IIzIiI'. XI:II1'II IT. SI. I'zI1I-I1-IIS 111151 1,1115 111 UI'l'!'II In-SIIIII: III1' I isII. ,XI'IIII. .I.I'I'II I. .XII I-'IIIIR Iluy. NII: II'IIil'I' IIIIIQ-s :I II1IIIIIzIy. .XIIVII 2. S11 iI1I's I-III--1'1:IiII IIII- .III1II111's XXIIII IIII IiIIsI1-1' IIIIII1 IIIIII IlI1'III1 I1 IIII 111111111 IJIIIX .XI11'iI 3. XII's. Ifux, II1I1I--1' :II1s1+I1-vs IDI' I'. 'If .X., qixvs :I I:1III 1111 :Im-IIII II IIIII 111 .XI'I'II 13. X':I1II1y IVIIII' 11IA:II'Ii1-+- .X11I'iI El. I,iII'II 'I'I1I1I'1I:I1II1'1Il. .X1I'iI III. .XszIpI'11I1I'1I1:1I zI1I1'1-I4II.'i1I: pays, N111 IIIIIQ -1' I'f'I'l'IXl'4I sIII11'1-Ix In I .XI 'II lei. X'II1IIIy I4':IiI' :I 1111211 sI11'1'1-ss. ,X111'iI QI. NIIN. .I. II. 42111111 .l1'. I-II1I'I'l:II11I'II IIII' Sv Im' Girls IXIIII :I IIIIIIIIIII III IIIIIII II l'IIIIi1- I1'Iy. .X11I'II II. XV: Iv'I', 111111-I' I-X'+'I'5'XXII 'I'1'. 'IIIII' I'IX'I'I'S I'I11II1I11:: IIXVIA. .XI1I'iI 21, S+' I11I'pI1lj. l1I If'II1'1'. .X11I'II 311. In XXIIIIIf'I'S i1I 1I1o' 11411-115' 4111114-si, .X11I'iI III, 1'11II11IiIII IPIIIIII-s IIRIXW' QI III'lIUI'QIIII IIIIII laws:-111 F.l:I,'1 - 4II'1l'I'III 11 III I1 II II4 III1 I I 1I'iz1- IIHI' 1I11' In-sl I-s.'zIy. .I. ' .IZ -' fr, III11I111' sI1I1II1111s IIIIIIIIIII11-I-II. .I:I,' I. I'IX4'I'yIJ1lIIf' 11I1I1 sluys Iran: I-111111211 is ue-111111: II11-II' IIIIIII-E XXI QIIIIIIAS. .Ia j I I. Miss S1 -Iunly I-IIN1 -, Sv- AIII' I'I:Iy: IJIL FII ' ' Huy 211. ITIIr'1'f-I:I1I1'1-:III- S4'I'IIllIII :II TIIQA Iluptisl I'IlI1I'I'II Ivy III-Xp .XIII KILIX' 201. 1'IzIs- III 'III. NI:Iy EN. 151111111 -111-1-111111. s1'I ml is JIII, ff wmmw wwauaumamnwnpv W l uf . , , K ' ' 0 ' ' ,I Zi 3241. .. WWWM 'mnmWwyW sf, !faMg..f:'-...f?s-M? lr - Q I ' vs: ff 1 W- f 'c'ff'f'fh-Wit' M 1 9 2 6 ...7:L:::z::.::'...... ':::::::::1g:::::::::'::::::::::..::::::g....,. M I ' -1 e ,ee-as-. es .g v. . V4 rely.-1 an f -K . 11 v x - -- ' .S . K ' . V . . ' 1 ' H ' U - 1 s . l L 0 x x l A L l ,. , . . . . n 1 H I - , - . . V I Y 1 1 . . r . - ' 1 . . ' . . . - - - - . V - . . . , . V v , ' y - Q . . 1 N Ar L - rl I 1 - fd K 1 - . - - . . r .S v . . A ' ' ' ' - ' - ' 1 v .. ,' .' . . ' . K 1 K - .5 . . X . . .' - 1 . , ' . .i S. . , . .. 1 ' ' '.' , .1 it . ' - . . ' . , L , L . an 4 I in L A A A 4-' , U f. N ' Y . . ' . , ' L u Q . . .' ' . 1 , .' ' . 1 Y . . ' v . . . . A . . K 1. - ' '. , . ' . . . ' . . ' . . I I U I L. D I 1 l 1 A l 1 V , . Y i . ' , .. . . . . ' . , ,. . K, . . 1 , . . I ,A . . . ' , as .' . ' Y' ,' ' . . . . w 1 . K , x , ' . . . . .' . H . . H . . . . . D . . . L . . ' 1 1 ' V I 4 1 R . v L . . . L NSF Mis lchols entertained the members of her Senior expression class ind the cast of the Touchdown on December 12 The guests passed a delightful evening plaxlng liunco, there being eight tables of plax els Miss Maiguilte lfieeman won the prize foi the gills and Knox Patterson noni the box s piile loth piifes were laige papei tuikexs filled with can x The looms w eie 3.1tlStlCdllS decoiated with maiigolds and Thanksgiv inf' motifs Ii I chols served 1 delightful salad coui se Music -nd dancing bi ought the evening to a pleasant close TPIP TO THF NIOON The liip to the Moon was a iollx affair celebrating the close of the subscription contest conducted bi the school Principal bakei, assisted bi Lax l ik uid sevelal othei students, directed the entertainment piogiam which fonsisted of novel stunts and games The pal tlclpants weie divided into thiet groups, the Meteois, Itockets and Comets Fach group woie then 'Cllbfll maiks The Comets the winning team, VSQIG honoi guests of the fvc ning The iefieshments consisted of gi een cheese and crackers .ind plentx ot soda water SP AN ISH PAPTY The pretty home of Mr. and Mrs. C. A. Echols was the scene of the first Senior party. This entertainment with its appointments accentuated of the Spanish idea. The house was decorated with streamers of red, white and green, the national colors. The guests came costumed and Miss Rhea Mason won the prize for the best girl's costume' and Joe Cleveland received the boy's prize. Both received pieces of Mexican pottery. The guests matched dissected Spanish pictures by way of securing partners for the evening. No end of fun was derived from a dressmaking contest in which the boys dressed clothespins to represent girls while the girls made theirs resemble boys. Another contest was that of making a humorous talk using the letters contained in f'Gonzales High School. Mr. Baker surpassed them all in making the funniest talk. In keeping with the prevailing motif were the refreshments which consisted of tamales, enchilades, chile and bread. The napkins were tied in the Spanish colors. There were fortv-five voung people present and the chaperones for the evening were Principal and Mrs. Baker, Mr. Kee, Mrs. Saunders, spon- sor for then Senior class, and Mr. and Mrs. Echols. -1, . ' ' ' ' . Q11 --. '-.:y?.,mi.fF x?f:'-f 0 iffy .ifix M 54-VM 4fMM4 V YWwAfAW0 hHWW'W ' , . , L4 1122614421 ' -l lu I XXIIILIJELUI 1926 -1 If.i:'w FAR v MORIE S , 'f V1 www fp fl! zhfvffwff 4 ff fumflywfl I 1 QM, fls?lmf 1926 M N IOI s 1 umm tw an L1 Annu xx 11110 Q . xx xx1 1 X ttnt U x N 1 N x N . L 1 Q 1 mn xx.ls recon xxl lac mms .mc X llllltllll mo N . 1 Ultx 1 xnlx lu l 1 ,, x ln tht fgll .out n mug 1.1 tc xt Xuw ILLQIXGI lll t tt IIC Ill xxhlch .miim tc mtch QLINLINLINLIII to thv onloolxux Nhlllllil 0 xo x Qdmtx .md con as N 1 0Nx N 1 1 L Ill ll cxtn xt It IKNIIIIUII s conslxttd oi co11fXt.ltc 1 1 811111 on ltttuct Q , xx.1 an mm N Cuut N mxxx All AINNIAII ta -X tmx hefut lmslxtt mer mltcd 111.111 ts Nltmhcu oi the i multx plosent xxuo Nllw lmx Sponxol 101 thc Jumm .lv lv IQICL N11 het .md NIM Sllllldilx, SDOHSOI fm thc 3111101 Class Sl 'NIOI ILNIOI PICINIC lhe SLHIOIN comphmeuted tht JUIH01 Class xxlth an I xxtu eg hunt 0 oxxcd hx 1 DICINC SUDDC1 m tho Countx Ifulx on I11d.1x -Xplll P xt ummm nc lxlftlltlx lINIJ01ttd IIIUINDLI 01 I lStll lllbl s Ol tu t xxtla xcutx ot eggs 101 GNLIXOIR -Xftu the hunt mme phxxtd lop tht XX ll 1 md othel ganws xx hllv soma plaxtd on the se saxxs much to than NOIIOXK muxx uoxxd .lsxtnxhlcd uound thc tzhlts xxhan tht tux cn cn xuppxx xx fu .mnounced Ch.1pcX1onmfX tho lmltx xx Q10 NIM Sfllllldlflk Xhss Ihlx and Nllis P10101 I UIN CHI OW lhe iust hospltlhtx oi thv P11 Commencement QOQINOII xxtu the hmu tl u lx appmnttd luncheon UIVUII hx NIN I II frlflllt I1 m hmmm of N wx ll ladx Lax xoscs lent thou dcuntx hues toxx.ud tht dd01IlIUC11t of the fllllllgl 100111 xt tmhlc Lud xxxth IH dltlxtlc luncheon ict wld fm 1 C011 01131101 1 lmslxot tlllt xxxth IONCS and tlixd xxlth lxxnndvl .md xt mx thv class colols lall Uleen t.d1B6lN blllllld Ill xllwol holdux fht xx xoh D1 csontlng 11 lox clx effect lhe d0lICl0llS menu COINlTllNLd mmcxd ham m pdttx xhollx, putatou du f-mtm hot mlls combmatlmx mldd, ln ldx cxmm tm chux colon sl Cflldllltxl hloclx calxo .md mlted nuts ....... 4 ' 'Q lf x?iN'f. 'f ' 'Sf' ff, 'UI' i ' ' - , . ,g W2 0 , 2 4XMf'4'ffXim 1 'ruff 4 X L, h Q ' ' K, Qtwqfbyk- W V9 ,f,ff,- f ,,,,,f,,,,,MM f-,1 -vw,-9, - HZ Ylfwffv. f , ,-:.,1,f1A,fX'Z'.,Z,w,:XX,Zgfzmj 5... . X, ,X 'J ' - ,..,x, I, , M' in I , 1 V -3-41377'--3f575?7775f7fX-X57-5:4507 'f '-'f- lil-' - 3 I X ,, x ,, 5, .-,. ., I? .Q ,-.1-7 .I w'w MM,, ,,,,,,, 2 , xwmerx - mp U ' .ILTN :-.'1X:NI0I: IX.-x1:'1'x' I 'l'h X J ' i' Cla X t X 't-' Xl tl X SX ' 1' 'l'1.'.' th z fz IX inc Pa 'tj 5 txt tl 'X homv ot Mr. 'md Mrs. J. I . 1'mXm:chel on I l'id'lj', FAlJl'Ll'll'j' 12. Th X 'Q mt Xrlm' oi thaX I MX .' IX: 1tl'd th 'Xl ' .' ' 1 72 X ' X tii'.'. lfpmx thc :u'1'1x'-11 ut' meh ,' 1 X.'t I LX .' 'X1 lestud to 'ljU'i.'tl'l' ' X ' ost 2 I' l'.O IX 'sXXtXXltl XL' la XlX't 'tl ll 'dX1 111 xx'h1c'h .Miss C'u'tXx' I'ltXdzx II .'l'm.' 'md C'u'clxx'tXlI Gil Xttc won thv 'izaX, ij :1 h1l'g'tX stxcli ot czmdx, folloxvefl hx' dzuxcingg madv up am z1tt1'z1ctix'e Dl'0g'l'2lIN l'o1'tl X IRQ. ' T1 , ...f . .51 tix . X I -R-U14 1'-u't 1. 1 , , 1111' tx, l dl' tX'. , 'j X' I li L X X' ll if A . A l A . . A 4 , l ' 5 , Cl' Bl I' X' X. . '. ' X X 1 Q: S .' ' ' X ' ' 5 f X 1' Xi i. 1'5 fi? xl tz X ,' ' 1 ', 1 m 1 w Q s 41 WTP A L ,' .' X ' ' X ' ' ,' ' iz .' X' 'Q' fll ', ja ' ' .X X j 7 'j,. 1..TlX SX '.'lzlX'iX 'X a X' 'Cz.'X zllt.',f'IX1'X X ,,,L. ' , ,j..v ,i A ,. K. ..., x - 1- 'll 2 X . ., YL, v ' K. X . 'v , L, 4-xx. -h. ,' . L, . . .- t A X X' ' ' X z ' z ' X X 'st all 1' ' tj .X X' 'X .' X lg A . ' . . - - V li 2. Y D 2. A A A 1 C:1ll'X Fly. '. 1. . u 'X . 'rl A 2 X' I . v. 2 , , - - X I ' I . 2 t,'.xx2 .. xd V. . 2,, .. .v , , .. -',. , Q.-M. Qi 1757 QuX.lTff tt', ,ilfl t 5 'J,.l-f f 1 f, ., ,,,. ,,,, 1 ,. . ,,,,,,,,,,, TZ 1, q h l. Iqilxi H qt U II 5, 'V 1 , , -flf if ,-, -1: I , ., , ,. ,,,,,,,, , V, , f' ' ' f ' f' ' I' W ' I' A 'rl 'fr n': 2 A I B 51571 VA ', ,glljff ,,,, , , , V 1 ': 9 , .. ,,,, ,,,,.,,,,, ,,,,,,,, , , , ,,,,,,,,,,.,, NW. ,,,,,,,, N ,,.,.,. ,,,,,,, , ,,,.,, 1 1 I! 19 I A - r'mr'Vw' f ii ,.. . iffg f, iff? i W Eff: :lf ya if 6 f 4 f 41.1 mmm: fli ik 'H 2' C If 4 2:1 ,Wi ?! 12 i f 3- , R lx EW e ag fag Z f JH? WE i '45 i sf 1 M2 f ,L 45 , if Q Lv, x f. 2 , 2 3,1 227' , f , 1 my QW: Qi HF? Elf ,,,- .,,..,, ,,,,., ..,, .,,,....,. . .. ..,.,.,,...,,, ,.. .,..,.,, ,, ..,.,,,,,,,,,,,,.,,,,, --.-.....,.......l............,,.,..N.,,. ..,. N ....,, .., ...., -,,. ..,......,w.,,,,W ,.,., . ,.,., ,,.,.,,,,,,,,.,,,,,,,., , 'L 'f f ' ' ' ' ' ' f i,,f ,' 12 , A, 7,-.::',,.ffc w f ff: V Mg .Q 143 fi' ,Y Q? ,mp ' , . f - . f . ' 1:0 ' ,,: aww' 2 l,,,z Lv,Z'u'i' 'VZ'24y':w, 'af f ' f ffz, ww f ,mf -If A 1 ,2I'l111I,1fx11111tu11 . .- ' ' 1926 T Ng.--......,. ' w l1Il'l'Y-UNI: LATIN TOUI INAMI NT llIK I 1t111 Tou1n1ment 11 h1ch hfw placed 1 plemlum on 1ntellectu1l c QNLIILIIL lS 1 ne11 thmg m T6YdQ Fha Inst I 1t1n meet was held IH IJall'1Q ln 1991 Gonzales dld not lllttl tlIlS context but 1n 192 1 thele we1e f0Ul sectlons of the Tou1nf1ment md OLII School 11 as among the fnst to en1oIl IH the Southvwst SSCIZIOII Thls StCtl0II met ln S111 Antomo Ap11l 3 In thls contest Ifmnk F11 '1 fust 11111 I Itlll xtuclent 11on lust place ln the St 1te 111 the I 1111 Lontgst lllfl 1cond place 111 the dlSt1lCt 111 the 1111tten test He 1nd Ve111on O 1' 111111 11 on thc School 171178 111 the Inst 1 e ll examlnatlon Th1s DIIZQ 11 IS '1 Cl 1111 c 1l lJ1ct1on 111 11 h1ch lS no11 III ou1 School Ilbl 111 lhe th11d Iatln TOLI1lI'1IT1tJIIt of th1s d1st11ct vxae held ln S1n Antomo Alllll 9 1996 SkX6Il contestints hom tlIlS School enteled thls contest L llllt Iflx NN on thud pl 1ce ln the xlllgll test L0lllb6 NI1lle1 fou1th pl 1ce 1n tlu CIC I0 I11 1nl1 P11 tl111d place IH the C 1esa1 test I 1 1nl1 I'l1 also won lI0l10l lble IlI6I'l'LlOll ID the I ss 11 contebt I ach of them lS p1oudl1 1111111110 the lcttu I 'III hono1 11 l1lCl'l let 111 hope 111ll by fm much app1ec11t1d III the futuu IS th1 Athlctlc lattel I JW RH Y 1, 1 F v , L I AL ,.. H . . . . 1 1 1 1 1 11. c , c 1 2 2 ' -1 1 1 1 1 ' ' 1 1 ' ' - ' 1 . .. 1 , 1 1 1 1 . , .. . . . . 1 - 1 1 11 1 , 1 Ac c 1 1.1- . 1 ' 1 1 1 ' K T 1 1 1 1 ' 1 X ' 1 x1 , v 1 c , ' ' I 'l 1 1 ' . lx v . T v 1 1 ' l 1 r 1 1 X 1 1 '1 1 . 1 ' I . T . it . I. . N 1 T l P ' . h'1 5 X f A Y 1 51 , C L , C x V 1 I 1 , '1 1 'I v 1 n l Y 0 I Y 1 v v T w A 1 Ac 1 ? , 1 1 c '11 1 2 A 51 , 2 R1 1 1 ' ' 1 1' ' 1 1' 1 1 1 ' '1 1 1 1 H 1 1 . c c ' , ' 1' ' 1 1 1 1 1 1 ' 1 ' ' 1 -' 11 1 1 1' 1 1 1 - c . . 1 c 1 4 f c 1 1 ' . . . . . , . 1 . 1 - 1 1 1 1 11 - v 1 c I , 1 1 1 c K 1 ,, . . I . h . . N . '. v . ,i . ' 4 4 1 1 1 c , n. i ' I' V . , . . . y N I . 1 1 A , 1 1.1 . 1 X , '1 c 1 1 1 1 1 . ' ' ' 1 1 ' 1 ' ' 1 ' 1 - ' 1 ' v - 1 ' 2 ? C 2 1 1 A 1 1 1 ' It . I ., 1 1 1 ' 1 1 ' 1 11 1 1 ,I 11 Y I 1 1 1 1 1 , 4 . , , c 1 1 . c I 1 1. ' 1 4' 1 .. 1 1 1'1 1 - ' ' 11 I ' 1: , 11 1 c K 1 1 1 L 1-1 1 1 1 ' 1 1. 1 ' .1 A I ' ? x 4, 15 , , 1 , c 1 c X ' ' 2 1' 5 ' l ' '. ' . 1 ': j,ll':'1'f.ff' ff ,fll-f flff- 5 -1 1 ' 'I Ant--v 4:11. ' -f'v1'f...u1f 1-1.1 -11 . . ., 1 . - , ' A 2 V LllllL'LL'JllIIl1lUll ' - ' ,ljlfll lf55'0,e,W,,-eW, ,e,eW,2 . ,M , 2 , f fd- XllSS -X1lLl Sl -XIOX lil CL-UI-XIION Alice lepiesented C H S in tht 5611101 C uls dLCllTIll.tl0I'l duimf tht Lountx Meet xxhlch mat hele Nl uch P6 Shx xx is xxx udul first pl ict 'lxxo xx eelxs latel she xx ent to Sin NI ucos to lttend the Ihstilct Nleet Adam she vxon f11St place and as 1 iesult she xxent to the State Meet dt Austin Thele xx inneis f01 the State have not been innounced xet 'ue velx pioud of hei FlO1lI1Q Thlede and Conde Hoskins ieplesented C0117 iles in Juniol Declamation Floime l1I1fO1tUIl itelx lost hut Fonde xxon fnst pl Ice Ile lost hoxxevei it tht lJlStl ict Hut ' ' 'Ash 1. . ' u' ' - 1' - 2 2 ' ,J 1 1 .. 2 ' x . , A 2 . L L' I .2 A, 2 .2 . . ' .L. 2 J. ' ' ' ' xii i 2 ' s 2 A X . 2: i V I A-Y ' 5 ' 2 ' Q S ' xr' c A x ' ' . . V' T - S . 2 A, I Alice is a Senior pupil in lixpression under Mrs. Lucile Iichols and we .' ' -' S - - K I 42 xx ' ' 1 . ' ' 2 1 j .' 2 2 ' xi 2 '. R ' ' 2 x s ' i if .. ' M. f. ,Xmw ,-' , Thr UXIIIEITLII1 :ii ' ii , iffy - ff 4,:i,,,Z1T:.:,.:,::: :1:1'.,.i,:gp,::,5:',,gf:: ..,, gg ' ' y'Mf'-fc - -f H . ' f TAX. ,. , ., ,..,, ., ., , , HJ f'-Mm., ,www 'lf 4 S+., ...,- ,,,,,., ,M L, I'II'l'Y-'l'l1lHiIf MNT -N ig foo l XR xx -X Og. bl' 0 x.f'Xf'x...r-x! x J' -Q10 5 -2- 1 9 NL' 7 Q Q to x. 'X X,-1 X L G 'A ws 'Ll C9 K J ' ' f Lif 'Q ff 'I X4 1 O P 0 Ox Q0 f fl? X C , Q 0 O M Vw , f Q x r' A .J Q Q91 -N ,pc sh . i J' ' 5 .' I iw .3 if ew .Q.,y:3 1 .it ,M fr' 9' I' J I 4. 5- 30 '- ., : g,., l 5. 1 My , Til? 'rw . Q 'dxf A , +5 . 'Q ' P- ' 1' N x rffsfgg XOPUJQF CQYJDQUIS v F AHQQ-SQ, 'A+ I' FH IN SFVCN sr tins 1- 1 1 - . V - Y V ' v Q vm -'T -, x ---' M 1 . . , .A ,W 1 . ix i . l x 'At , Q,-7 X ii -' ga- - 1 .IX , ni' -f .- - . ' .1 'ima 'f . . 1 if QRS sz. . -,B ' Qi s -5' vf ' , -Ci' , 3 T-' 43-.-' ' ' 'ff 2 3.5 ,,:.iE.Jql. ' TL ' uf, ' 5' sov- yn.-o Ou 1 ' 'lx - ' P 1 1 1' .-ruff ff, 5 .- YQ 3 Ji.. il!!- :lk- -,1 H fi ' . --- - . ,iv ' 'f.:. - FUHERT KLUGE MLLMM HAYNE5 BESTFYLL Fun ND 1 A.,- Lfiiiq' ,a.gy.. .1 o n sk. 1. Qlvrj. I ' X I .,gzy,z 7 ,jf .H ,Z 5 W ik .Qi ' u 1 ,,,, N, WT. ,, A 1.47, ii . .. ,,:3w..,j....,., .. , .-f.52 . ,,. ,U 1 ,, I A , VN ,, ,,, , .,.., ,1 ,,,..,, qi P u V.- ,,,,,,,, ,,,, ., , .M ' , ,,.. -Ml ,,,, f H::,:. ., .,,. ,.,,,,,. 311, ,,,,,,, ,:,:,.Q.,,4,,.J,Q:g:Q,V,g,:f,N ,,,, i I 1 , ,.,, Lx: ' , , ' p 1 ,lv' l V C1 'Nv-H, if K - Sqxw W dp- V 5 5 Q Jyf fl, fi 1? To B113 LUCIIQ I3dVlS I chols, xx ho has Vk0IkLd untlrmglw fm the Staff fol the Semox Class and for the School as a vsholc, we WlSh to expl ess our gratltude ,W wmv aww 'E Y 1 N fs 1 '1 Q 4 . i - f .125 X! it H 7 '1 , , x 3 ,f 11 . p A .. . x Ms' wi . . . nie, V . . Y . 11 . 1 K y v 'S - 1 ,V 2 , W, ,,,,,,,-Z , f , -' f, f H , 'ffm-lf-V m1+wnvwnx4'wwwwfzf:yf f. 'ff fwwrr, ,, 'vngw 1. 11 - - - A 1 51'11L'1,1'xi1Ig1L111 1 ' 7 ' 1926 ' ..... 11111 1 1 x I X1 H0111 N1 11 1 111 11 111 l1IN 11 S1 10111-X 111111 5111 111 1 X111 S11O111l11 ONS 111 N 1111111 51111 tf 111 11 1'1V11 X C1 111111x1111I 1511111 lX111L11 1 1 1 5111 A O1 I 11 11 1 'X111111 X 11111 1 1 1 1 NII111I 1 'X 11111 1 1 1 N111111 1 11 X11 111 mt N X1I111I 11111 X11111 11111111 111 1 XI N.,fX..1 X.f'N 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 111111 -- NI '1'111'l VANITY 1-'I-X111 .-X 12l1'Q'1' 211111 1'Il11IllS1ilSl1C 2ll11111'11C1,' Q11l111'11'11 1111' 1lI11'11111Q' 111. 1111' 111211 Y:111111' 1'1El1I'111I A11111 113. A111 Q11 1,1111 1'12111' 1111s 1I1'111 12l11'1' 1111s .1'11:11' 11 11115 1111 1111s il S111'1'1'SN. '1'1111 1'11111XY111g1' 15 11111 11s1 111. 1111 C1111111112111'5 1'1'11111 1111 1'1:1ss1-xii MUCH 1111fA1 1'11-'1'1, 1111115 11111 111'1'X 1711 1,1'1'1' 1-11311111 1111111 1,1'111z1 1,2lQ,'1I1 1 ,, , I H , A 1111111 Yi1'1z111 A1111J1'1' '111'II11I 1111111 1'1I'2l1 .1z11111 I , I 1 ,, 1-111111111111 111-21111 11.111 1.' . 11YS 111111.21111 1111151 I 1 , I 1, I 1'11g'11111 11111111 1111 X 1'z1 11 '.'1111 .11 111.11111 1111-X' Y111'11111' ,I , I ,, I '111'111I 11111111 111.111 1111111 111111111 1111 11111111 MOY' 1 ' 1' ,. 111111115 . .'1 1 ,' 1 , 1'11g'1 11 111-11111 1 2lf' 112 1'1s 1,1,, , ,H ,1.,1 , , . 1' 1117111 N111111: 1'111111111111 I 'I'1-11111 1111111 A121.'I 1111'11'1'111,, ,,,, , , , , 1 1'11111'11 1111 11171111 B1O. ' ' ' ' 1. 111 1111171111 1 11: 1,,, 11 f 111211111 11l'2lf1 . 113 I 7 H , .11 1117111 C111-11 '-II 11111111 , 111111 1111 1111 I I I I 71111111 11111111 1'11:11'111- 111'1g'111 I 11 14111'Y1'1111 11111111 Cl ' 111216 L 1,1--1 L- I W , 111131 11 1117111 .111x 111' 1 ' 1 1'10 ,,,, , ,,,, V f ff 11171111 13111-lic-1 Q 1111 I I '111'1111 111.21111 112111112 1111' , I 1111 I 1111111 I 11 11 Ii '11 111711 1111181 A1,1,-I 11 'X11 IOYS 1101, 1 -1 'lui-11 W I I , ,I I 11f1g'11111 11112111 1111111111 1,1111 11' 1 11's Y 11171111 A - in-f H H H iiii V 1 G1':1f11 1 II: .ws 1111111111111 1111111 - I , T111 1,,','X1.I'L111Ll1I b U - V A ' ' 1' 1477 1926 , ,N1N'X N111 11N 1 5115111111 .1 111111.1111 11111 11 1.11 .1 1 1181 1 111 1. 11 1 1.11.101111 11011 1 11 .1 1111111.11 111 1111 1111 A1101 S1.111111 1 11111 .1 11111111 . 1101111 S01111111 1111 . ll 1 .11 1.11111 11111101 .1 111111 111.11111 1111111.111 1 .IIICLS H111 11111 1 . . 11011 1 11111111111 111 .111111.1 111 111 16 11111 1 . 11111 11111 111111111011 11101 11111011 11111111J1lS111 1111 11111111101 11 1111 .1111111111 111 0.111 111111 111111 1111 C1111S1f 111S . 1 1 111N11111l1111D11N1I111.11X 1 C1l1111 11111111.11111 111111101111111 .1111 1111111111110 111111111 11.1111 1110 S1111111111111111 IL 11 111 111 Lf JN 1 f.lI1C1I1f 0111 11 111 1 1111111111 011 F1111 111111111 1 1 1 '1 111 111111111 NXXIU1 1 1 . 11111 1111 .1 . 1 1 11011110 11.111 1 1111111.1111111 111 1111 111111 11111111.11 1 1111 111111 111111 1111111 11111111111 111111 011.111 .1111 1.lI1.1fI1.lN 111.111 1111111 111t1.111011 11111111 1 111111 1111101 1 1111 11 11111 11.111111111 C1111 .11111 1111 111111 IL111111111111 111111 111111 1111111111 111111 111111111111 111111 111 1110 S1110 1. 111 111 1 1111 '111 10 1. 11 11 l11N .11111 1111111 P1t111111n 11111110 1111 1110 111111 .11111 11111011 11101 f111m111 1 111 11 1101 11.11 111.11111111 1111111111 S1011 1 1 IX' 1 111 Y.-1. 1 A1ll '1'1 1s .' .11111 , - ' ' 1'0 1-2 0 11- 11 1.' 1111 1 1111 '1 111' 1111' 111' Ag '-1111. 'l'1 1 -I - '- ' '11 1111111 ' -1 ' 1 '1'111 , 1,10, 1 . ' 1111 '1' 11,- ' -i-1111 1, 01, 0 1 1 1. ' .' '. 311' 1, '111 1 '1i.'1 1 31-1 .' 1 J A121 'g 11'111 1 '11'1', 21 .'1 ' 11.' girl , 0 W ' 1 1 ' '11111' 0- 1'1-1 s 1' '11 1 Y' 'tj 1'1'111' . ' ' ' ' '11111 1'1111 .-X11-.-1111111111 121111 11'111'11 111'11.'111111111 1'i1's1. 1' ' 1 -1 1 1 ' 11,1 11'11'1 '11'1111111-'1 1- 'g' 1111' 21'11' 111101. ' . '- 1'z11111i11z11111 11'111'11 g11111111i11g ' 1'111' 1111'11' 1111111, 11'11i111 11111 S1111i111' 0111111111 112111 1111141111 11 1111111' f11fl'1111j' :11111 11'111'11 1'111111'11111,' 1-111111 2 2 ' 1' 1111 .' . T111 311151 1,1111111'11' 111111 111 2l1'11 1111 1'1.'s11s '1111 1'l1',.1't 1' ' - Q, :CC . ' , .. , A h. 1 . . 3 . . ., 1 ' , . I. .sy 1 . h. -1'-- ':, -11 1','z' 12 1:1 . 'l'1-.Ia I-1 11 .' - .' 1'j.' '1'--1 1 1 ' .' ag . 11-1 G 1J111'1'1 JI 1'1, ' l 1-111 1' 11 1 1 11 '1 '11 '- Q 1' 1 11' 1 XII -1011. Hg . '1', L1111l11,L1X11l111U1! . A1 1 ' 7 ' 1 1926 - , M I , ' :I r1Y1'1'-1111Jl.1 7111111 111-xt 112111 111' 1111- 111'11g'1'z1111 was 2111111111-1' 5111111 1l12lX, A 1,2l11' 111 - 1- - 1 1- 1 . 1 1111:1111's, 111111 1:11111-1j1'11v 1i11111sc111-1 211111 1,1-11 1. .-1111111111-11 1H1'1111'C21S1. '1'111- W1I111111'S x1'1-1'1- 111111 :1111111u11c1111. 111-1'1111'11 S1111111M-1 utvst 1111'1. 11111121111 1121111118 211111 1111111-V1 1x1ug'11 111111 311151 1'11p111z11' 11111. 1,,1'111a1 1,11g'l'1 N111S1 111'2lll111'L11 1l11'1. 111111121111 1Ju1!11s11 N1 x 1 QQ o fx x 1115 s.Z'X..Jo .IX I' 9 uanlzmiuvw u-:uv-n.uvl.au1 -van 15, 1111' 1i11s1 .-X11-:Xl'fll1I1f1 11Oj'. 1'121.X' 11z1v1sgB111s1 11OIJll12l1' 11111. Q111211'11l' 1I1'1g'111 9 , ,pw ,wana va 4 i1 A 1 1 H. . 311: 11z11111.'111111- 1'11y. 111.1 151.1 11-, 11 '11 wiv? ,,':H 1 1,1 1. 11 I 111 X1' 1. iv, 1 1 1 3. , 1 ,- i . 7, 5 . . . - m nd, ,- ,, ,K ,':,, ., .1 - , ,-,- W 1 zz. , ' .. - '- L Xllll 1926 1111 N C1111 1X1 ll 1 111' x 111 x 1111 N N 1 11 N ' CW00K 31'11'1,,,'f.' 111111 swxw 11113 1'11l'N'1'Y X111f1f'l' X711 g11111111111 1111111 :111 11Yl'1'1.1111'111111111X z1s.'111111111111 11111'11 11'1'111:1,x', A1211cI1 213, 1.'11'1111'1'11l1I11'X' 3.1111-1. A1 111:1s1 2f111j4'11'1w:11111 111115 l'111111'1'11 11111 1111111111 ' 1 s. X1'z11111I111'z11111N1x111111111111111111111111111-1'111'111111': 11s. '1'1111 1111 1'11111g' wz1s1111x'1111-11 111 11111 111111'111'1' 11x'11111s, 1I1l'1l1111IlQ' z11'111111111111 s111111111g1', 11ss:11.' :11111 1'111':11 11111'1z1111:1111111. '11114'S1'XX'111'1' 1111111 111 1111' 111211 S1'1l111l1 1111111111121 1.1111C11XX'2lS Sf'1'X'1'11 11111111 1'.'l'..-1.111111:111111111111.'1:1111f x1'111'11 11l1'11' Q' 1. OW' X11011111W1'1.g'1'11111111i11111'21C1i 11x'11111s x1'111'11 f11'1'1'1'1'1'f1 1111111 1111'111'1l1 1111 .A11111111111111'111111111,'1:x1'111'111111111z11 11111 1 '111' 1l1'11111111s 11x1'11111 11111111 111x '1'1111 11111'1:1111:1111111 111111111515 xx111'11 1111111 111 11111 1111511 8111111111 1 l'1112l'Y 11111111 . ,. I ATHLETICS if ff 1 MWMW I f WW' WMM WX mf 'ww W ,Q 'F 1 I II Mmmwwmwfwwfwwmmwwwwwfwlf ww 1 wf 4 4 1. 1 1 1 1 1 1 1 ff f 71 'lfda 0 Y 3 M'o f1v .'f'a'-lf' 4 Jr, f 1926 11111 r'.1r Ill N N 1 N n1111111 H111 1 Ha I 1fon1l1o11 I 4 1 1. ubbald 1'ldXl1QN 1111 ll 4 1 41 S X N ll 1 11 1 ll xll 11111 1 1 -11 Ill 1111111 1 l100lX THF 1971 FOOTBALL SF ASON Wlth onl1 foul of laat 1ea1 Q lettel men back, Coach Lal1e1 get out to 1111 m a D1 eaentable team An altogethel ne11 backfleld had to be developed 111 addltxon to most of the lme Thele 119.5 plent1 of matellal, but It 11 as hght, as shown b1 the team S avelage of 141 pounda HOWQVGI, most oi tl1 m.1'e11al 11e1c undelgladuates and 111ll have Q6VQ12'll mole 1ea1x 111 11 l11cl1 to gam avoldupolq Coach lu1lx9l tllllled out '1 flglltlllg lf not a vsmnmg tn 1m It fouffht e1e11 n11nute of pla1 and dld not let 1 httlc thmg hlxe a blg SC016 flll oppon ants fdVOlJ dlSC0l.ll2126 them The l6fl66IH1Hf2, featule of the team, ho11 LVCI, 11818 the fact that lt was composed ma1nl1 of men 11 ho 111ll be back ll 'xt wal Spe lal cale 11 'IS taken to tlam them and QIVQ them expellence, cxpe 1all1 the backfleld Although the season seemed unsuccessful to mam land was ln pomt of games vsonj, 1t was a euccess to those most closel1 mtelested Let us hope v11th them that next 1ea1 Q team, 111th t'h1s 1t.11's expellence, 111ll 111n ltq share of games 1 . , 0 mmf-0fR . ,NL . ' ., . f-.x.:.fgxz..fgXf:x,g,-,7N,qw,g,.-5 -1,1-1,,,,Ng,? t f 0 af f jf? ,..,- ......... 1 ,,V, ., ,, WM, ' . ' ' ,T 1 ,WMM ,.fW.f,fWW,M ,fvafzfwwn m.,M:..e. waz' ,f 3, la yy I, , 1 , A 4 W I 1 W I :',:1W,,.fQg:ffffZQ,Ztzzcfiiifz,.Qf1l.:.L,.fQL::f.,Q- ,,,,,.,, NSI? 5 ' ,V 1 Q 1 If .,.,,, nyzgfmfuhvw-ffffw fffffff--ff ffww--vawww-wwf-1--ffw.wmmM.M,.,.,,...,,.f ,,.,,,,,, ,M .,,f, Q 7 ,IZif11111112115fZffZZL.lf',.llIJ1llIIlQfllfLfIflI,f.Zlf11,Q.fIf11,lIIlL,I,ILil,I...lLZlflLflIlff..ll1lQ1I..f,,fl.LQ.ffT.if 4' , 1 'ff-mm 43 5, sf 4 'l? 6 11 U , , ll , f' 2 Ai 22275 ,Ui H ' 'lil . ---' --Xie ---f ff - V -f--- - , -, A Q 1 W nf L1 'V ? Z 'w fl 1 1' 1 V , 1 1' 2 Z Q fi 1 ,, :1 1 , V E H6 gil 537' ,V 1 ,415 , 1 5 , X I-fl 'W' 2121, ' ' ' 1 7551 1 me 1 - , K 2 ' I1 1 , a 53242 , 0 gill . ' 1 1 ' gig? - 'iff . ' 6 , 41 , - 6 141 1 1 '- ff am ff: 9 !' 1 1 9 ij lv. - 1 n 5 fx lu 1 0 0 ffl 1 Q 29 A X1 , ,,, 135 GE ' Fro Left to right: I'i1'.'I 1'o11': f'02lf'l1 l12lli1'l', M1-Gill, Fla jd, I1i1-l'i11.'o11, Yt'l'll0l' 114, ' A . . , . . , Qt Ae- , 1, L,l11'1.'I1z111, ' 1'b0l'll1, nbc-l. ' Q21 S -' ' ': B . M 1nl'i11', H ' ' , 'j M' 1: 3 lllette-. Alll1l II 11, Smith, .1111 1' lN'l'l'y, . I' lkil'1'. gl 'I'l1i1'1l 'o11': fl'l '2ll'l'l'l, IC 'i11g. li. M 1 l 151. Mol ' Zill, Vlug -, l,i11, :1 l. 1' 1 l -1 '. if ,135 In lf 4 755 11 1 1 !l'1 1 - - - 1 v ,5,,? QJIY A ...fo 1 41 1 A I A . ,i 41: I, - ' 1 L lv . -'BQ 1 - 7 - - X . . . - . . H4-4 73 L . - L V L . .5 1- . . . I . . ,Q V-, qw V . . . . Ig . . gfygg 111 ll . U - . . ' ' . ' .' ' . , . . 1? 3'1Q 1 ' c la.. . .U ll ,x 11,55 1 .-.. ' 2 ' 1 - Y . ' -S . ' h Q3 11 1 . 0,5 1117! , , . .. , . - . . . - . , ,- , lfga Wi ' . ' ' ' . ' . . A 5 31:11 5- -f 2 ' '- 1' ' 1 Q V ' ilk?- 1 v . . . , 1. 1 N' I Y 1 N A N' 3: . 1 5 H: C 1 ' 1 . - -1 ' - I I - . . 1 I f A . - . I 1 JK C 1 . ' 3. - K, . 1 5 W 1' ' 1 . . al .21 'G wg '11 dsl fl Z'f f'fZIjf1',1 ,,,1, I , V - Y - A W V H Y . . ,, Y' T ' 0 Aw A M fZf'W7KI'77IE, 72 '!9'7i' 1-1 . 1 , ., 1 ff' -'V I . , L!!i0fWW2 5f3 FWWZi Wf'5l!fV1 f.'7Z 1'f75l'7f7V al4W'Q A jf 1, Lfnff'zVfvf:s14tfz'H.3f:L9f - .1 , 9:9 Th 9 lavxlnlltuu if -sf: 1- ':f:Qf.V'f:::S: ' ' m 'w -'-w A'--1-'- .-'w:Vf:H ' Y W Zffzlflffffffxil::lff:'VV'2g',':.',.': . ..'ff1:f1fffflfffff'flfxlffffffffifflflffl I V 1 1926 ' ,glliglh .. - W, V 7 ,,1,a4.a--.- SCHLII UIC C '-X118 ll On 0Ct0b6l -hd SClllll6IllJlll42l came OVQI fO1 the fllst ganle of tll season 'She had the adxantage Ill Xltlgllt but Gonzales had the 1lClX11l1t1l.QL Ill flhlltlllg bplllt, as shown bl the tact that 5ClllllQIllJlllf.l was held 111 llil own tellltolx most ot the game ln the fl1St mlllute of plax qCllLllLIllJLllf3, scoled on two lollg passes to tllell left end who hld out on the slde llllt Phe tlx lOl DOHIL was suc cesstul Gonzales came back stlong and held the ball IH qCl1lllLlllJlllf3, tcllltolx the lest of the qualtel, but could not SCOIG In the second qualtel Hut lIlt8lC6pt6d a pass on Schulenbulg s V l xald llne and callled lt to the ten Xdld llne befole he was downed Hal nes went thlougll centel f01 f1VL N1lldS and Menklng Cdllled lt acloss on a stlalgllt lllle buck Hexe klcked the goal Gonzales made sevelal thl eats to SCOI e, but lacked the necessalx punch to Cdlll the ball acloss C ONZALI 9 CUP I O Q0 -161 Gonzales plax ed hel second game of the season IH CUQIO on the nlntll of Octobel Gonzales was out w elghed about ten pounds pu man alld w as out plax ed ln QVGIX phase of the game Cuelo p1Of1t6d 21 eatlx flom the lnexpellence of the Gonzales llne and lan fake closs buck aftel fake closs buck tlll0l1g'l1 oul llne f0l VLIX sub stantlal g'dlHS, otten eludlng the S8C0I1Cl11lX defense fol tw entx of tlllltl walds Cuelo scoled ln GVGIW qualtel Manv substltutlons wele made on both Sld8S, but thls dld not challflc the sltuatlon anx as CU610 made apploxlmatelx the same 90016 ln GVQIW 1111111 tel, whlle Gonzales dld not make a fllst down dullng the whole g lmc CONZALLS YOAKUNI Q6 133 Gonzales plal ed hel best game of the season agalnst Yoakum Yoakum was as neavl as CLIGIO but Gonzales was ln a flfflltlng mood and Ollt f0l levenge Gonzales lecelved and Nlldlxlff Cdllled the ball to the one lald llne on sevelal take C1055 bucks Hax nes went thlough centel fOl a touchdown Hue falled to klck goal Gonzales agaln 19C9lV8d, but dld not go fal befole she was stopped Fhe lest of the qualtel was hald fought wlth nelthel Sld9 galnlnff much but eallx IH the second qualtel a Yoakum back smashed tlll0ll0ll the llIlC and, eludlng two backfleld men, lan f0l 'l touchdown A pass f0l the extla polnt was lncomplete Gonzales held the ball ln Yoakum t6I1lt0IN the lest of the qualtel, but falled to SCO19 q6V8ldl attempts It fleld goals WGIC wfldc and 9GVCldl passes w ele lncomplete At the beglnnlng of the second half Yoakum began a steadx fT18.lCll down the fleld but evelx lnch of the wal was contested blttellx The puntlng of Hele and Nlldklff set Yoakum back sevelal tlmes, but neal tht end of the thlld qual tel the Yoakum qual telback w ent tl1l0llg'll centel f0l fl touchdown A pass to thell llght half w as completed fOl the Clitlil polnt The lest of the game was hald fought all the w ax wlth nelthel te lnl maklng a sellous thleat to scole 'jf' ,,l x....f 's2Vf ' 5 'WN-.,V11xsV..z 'INQX' wWN.lZXf,4NLf ' vwuwummlwmv' 1wmw'ff'n.9s1V zwaesf' Vnaawfmz' an Q CV 1 Y 11N1, y w 11 41 1 r- r- L I A A4 1 L I I L .AA J Ak ' V ' V N - - 1 V V ' 1 1 1 e , L, L ' C V ,1 1 1 1 V1 1 1 ' V ,' - ' V 1 1 , 1 V1 1 - 1 L L 1 L , L ' . ' V 1 G V' 1 1 - V ' ' V - V ' 1 U 1 K K K L 1 1 K 1 L1 , V V 1' 1 V 1 ' -1 A L 1 ' 1 1 ' ' 1 v A V 1 1 V 1 1 1 1 1 L . L L L L L ' . V H ' l' V' ' , ' . V ' . ' A V. 1 1 L 1 . L L ' L L . V 1 V 1 1 1 1 1 V' 1 V L ' L I L x A Q 1 1 1 V 1 1 V 1 1 V V 1 V , a L 1 . ' V 1 1 . 1 A' . JK. :lf . ' . 1 . .' , ' A V, V ' V V, 1 V 1 V 1 V V 1 1 V ' 1 L . l L V V 1 V 1 V 1 1 1 1 1 V1 ' 1 ' V V V' V ' L I ' L L ' L , 1 I l ' - 1 1 V V 1 1 1 V A 1 1 V V A L L L L 1 V 1 1 1 1 - 1 1 L L 1 w v Q1 w y I X ALL i 4 N ' , V 1 1 -V ' V ' L t A 1 1 1 11 1 - ' - 1 V 1 - 1 1 11 1 , L L L , V ' - V 1 1 -1' , 1 ' V . V V ' V 1' ,1 , ' , L , V 1 V 1 1 1 V V 1 1 V V 1 ' ' 1 V V 1 1 1 K L A . L .. V I ' , 1 . V V V 1 V ' . , L t L v I V V V V ' - v 1 v - 1 V 1 1 1 ' 1 V ' ru l 1' ' V 1 1 V 1 1 - ' V 1 A 1 ' 1 V 1' L 1 L , , . V ' 1 ' 1 V . ' V1 V V' 1 V ., ' 1 1. ,V v qw N1 V ,I L A l A A ' V V 1 ' V 1 V V L K ' , V , 1 V 1 1 V1 1 ' ' ' 1 , , L L K L , 1 L L 6 1 V ,V' V ' 1 ' 1 1 1 V 1 ' 1 V V 1 V 1 V 1 V V V 1 V L L V - L , x , , ' V' V 1 , ' V ' ' 1 1 V 1 V L L 1 r , V 1 V V 1 1' ' V ' ' ' rs v 1 V ' 1 V 1 V V 1 1 1 ' L x 3 ' V V ' 1 V - f 1 1 1 c V L L L 1 ' V 1 1' 1 V V 1 V c . L V ' V V1 1 1 ' A V, o 6 C n C L V V ' ' 9 ' . V 1 V A V V V V V, V V J Y n 1 K 1 ' ' V ' V' , V V V ' V t A L L ' ' 1 1 1 V V V 1 V 1 V V V V 1 ' 1 V' 1 1 V V ' r . L L V- 1 V 1 1 -1 1 V V V 1' ' 1 1 L . 1. V' V' 1 V L 1 T... ..,. T............,....,.VV:..,,....z--.g., , ,,,,...V.V......1,:..,, ...:f. V V 1 , V ' .... V , , ox! s ' 9 V v'f,fw'--W a ' ' om. 4 as--V. 0 ' 0 Q ' Q ' g ' ' J ,Vf,r:V'w,vwaw , mam, V. , 55155-'S - f V- ' f f ' V 1 V, . ., f-.111 , 4 Thx I extnqtuu Kcslzi.-f9 'K.J' -,1 '.,,,f x,,f'N , 'N..,f' s.f'x 1926 IN XIX NIXON COINZALLS 132 OJ On tl1e Pold of Octobel Nnton came OVQI to avenve he1 defeat of the 11 ll bcfole llld she dld lt to tl1e tune of 32 0 lhe teams 11e1e fdllll well lJll1IlCL'l IS to 11 tl l1t NIKON s backf1eld bemg heav1e1 than ou1 s but ll8l hm 1httle 11 htel th 111 ou1 s He1e however the equal1t1 stopped NIXOH lltllli SLIDQIIOI 111 eve11 othe1 ph 1se of tl1e Game 1 0111 1les pl11 ed a 1fame but losln f1 ht She seemed bew1lde1ed b1 the take pl 11s used b1 Nhxon IN1xon 11a1ned tlme aftel t1me th1ou1 h the lllle often fO1 a 1 ood dlstance lhls state of affaus ho11eve1 was 1eve1 sed 101 1 sl1o1t t1me Gonzales stalted down the f1eld on st1a11fht hne Dlullf es llld lakes but 11 IS stopped 1ust IS she came 111th111 SCOIIHU dlStdllC6 C1p t'1lIl Ve1 no1 of C onzales made the th11lhn11 1un of the 'fame ca1111n1f the h1llf1om h1s 1 1 11d l1ne to tllell Z0 1 11d hnc befole he 11 1 downed LULIINC GONZALF3 Q13 OJ Afte1 1.110 weeks of h.11d plactlce Gonz1les met the heav1 Lul1n1 te 1m on tl1e H1 h School 1f11d11on Conzales d1d l1e1 best but lt 11as not 1food 11101 h 'lhe fleld was sh htl1 n111dd1 1nd the opponents a 1 1eat deal ll88.V1Ql Stlal ht hne plun res 11e1e the o1de1 of the dak a11d Luhnvf d1d most I 1 1 111111 The ball was too 11 et to pass and tl1e f1eld too slo11 f0l end 1 ns Gonzales fou1fht 1famel1 but the heav1 hne and backfleld of the opponents batteled he1 hne down and COI1tlIll16d to advance Gonzales held SQV61dl tlmes when Lul1n1 l1cked onl1 a few 1a1ds fo1 a touchdown b11t twlce Luhnff C10SS6d the Ooal l1r1e Th1S was tl1e ma11f1n of he1 V1CtO1X thnteen polnts FLATONIA GONYALFQ Q23 OJ Afte1 be1n11 1a1ned out of a letlllll 11 1me 111th Nxxon on Almlstlce D IX C onzales tackled llathel she t11ed tol I1laton1a on he1 home 1r1ound but lf 1111 Conzales 11 as too l111ht f0l l1e1 opponents I l1ton1a s team 11 as heav1 ibut lt 11 as also fast? She Ualned cons1st Llltlk on end 1uns and shozt passes Most of he1 touchdowns we1e the 1esult of 1 bll01t p 1ss to one of he1 backfleld me11 who outlan h1s DUISUQIQ tl tl1e 1fo1l me C onzales 11 13 not able to 1 am on '1n1 th1n1f except passes and onl1 H1190 of these 11 e1e 1food fo1 an1 substant11l 11a1n In the second quartel a pass Il1111e to NI1dk1ff netted about th11t1 Xd1dS In the foulth quartel two 1118313 lxlldlxlff to IIPU nes netted th11t1 f1V6 1a1ds each but each tlme Gon zalts lacked the punch to push the ball across the Ooal l1ne I l'1ton11 sco1 ed tw ICQ ID the f1lSt qua1ter fnst a touchdown and then 1 f1e'd 1oal Qhe QCOl6d two mole touchdowns befole the last whlstle blew Thls left the S0019 23 0 IH fdV01 of Flatonla GONZALES NIXON Q0 181 The da1 before Thanksglvmg, Gonzales went to NIXOH to revenge he1 self, b11t she was unable to do lt NIXOH SCO1 ed ln the fllSt fe11 mlnutes on a S6l'l6S of llne bucks and fakes Gonzales came back and l1eld llel ow 11, C2ll1'XlIlg' the ball mto NIXOH t9l1ltOlX and holdmg It there for the g193.tQl pa1t of the flISt half DLll'lH,Q,' ,,.,,..,.,s....W, ,,.,,, ,. .,,...,.....,......,,......,.....1..w. s . I 9 . 4 Q 5 ' ' V .5 h 1' , ,... i-..-.,.-.-.4z1- '.-I ' 1 be od - - ' . ' . : . ' . fc , ,V lf f1f1'z:1'..,, '91, rf .71 -,..::::':t:::::::x: 'J7:11:::17:z:x:::::::1'1.:::::L:::.. ' . . l rd VW f Y f Q VY Ywiri SIX' K .' 'EXP-K ' v w 7 11 1 - . - I 1 - 5 0 - 1 1 I 1 - . - , . K., t.,2. Y, . 2 K. , 21-D . . ,,. .'.-Y ,, A n w v . 1 Y. ,w 1 r . ' . 5 I, w U 2 c H c . ' Q, , . . . ' , ' . I ' I 5 :vw I 1 n ' v . r A c Q, c 1 . , , . L , . F L. . . .lf . k K. U., . Y V H 1 ' 4 W' ' . ' Y 1 vi 1 v I ,Z K c . ' ,., fl fl . 1 . , . . 1 . . .. , . . . ,. c l . . my . . h I., ' ' ' - 1 ,A ' 1 . 7' ' 1 1 1 . . ' - 1 . v. 1 . . 1 y ' 0 ' ' K 9 1 ' - 2 - - . A. - S . - . . D ,Q 1 'I ' 1 vi 1 1 - v 4 w 1 1 V- . 1 1. I 1 1 I n Y K x L. I x C n L 15 , C ' I ' ' I 1 Q I U. I 1 1 l l V' 1 I rs c 1 . as ' - ' 1 93' v . ' ' . 6 v - ' . . v i . 0- Q 2 A Z A Z S J . Y v 4 1- . . A - . . . V . . .. ' , v ' I. , . c l I, c . , . . . . 0. . . . - . . 6 1 L., . I 1 . , I., X 1. . J Q ' 1' A' 2 1 ' ' ' ' . 1 Lv n 1,1 ' C v I h u v V ' z-1 as . o TJ1' 1 l ' 22 ' ' S ' ' 'Q ' Q ' ' 1 7 v U v I N- ' 1-1 o . y I . w 4 u 1 . v , 5 . . . , 1 ., ' y ' r , V v . f r 1 1 . V ' Cv 5 . . 1 v, . ft ' . . V I I 1 . U v bs o ' L c- . 9 . -,J 1 . . 1 J 11k - 1 1 1 1 ' 1 s n -1 v' ' 1 . . as of Y , v W . . 1 .' ' ' v v 1 . 1 I 4 K 1 c 7 2 ga I . , . K h. . . . , . , . V . . 4 . . 1 - 1 . 1 . . - , 1 . A 1 . D , . . . . - . . . e . . K. Z . . 2 L . Y , . . .K 'r I . X I., C l n N v 1 I v l v 1 ' . 2 - 42, c . I., 1 ' . -I . - . . v '. 1 ' 1 n . D C 4-1 ' y 2 I , YA A ' ,' , . tv Iv, . . 1 1 v 1 l v. v . I v l Y V . : ' - X' v C . . ' . 2 4 J.. c V ' U . 1 . 1 i '. . . ' . - V 4 c 2 L ' ' , 2 5. . L 1 ' ' ' ' . ' ' Y y . 1 F ' 1 N S, rv . ' t 1 ' Lll11l1:xt111 11111 - Q N 1926 .-,,,., s Llmt s1t ssct L llll 1' lt mln 1 1 11 mss C ut 1 11 suh lu llN tus lttstt. t 'llt s M11 .ts 1 11 t 1 s t wt ass ltlll 1 t J. rss ill 11 list llts seentef to ttltollltlt Q 1xt111 .mtl s ll Quint 1 llll 111.11 ll 1t l11stt111.11 t1 Q 1 x , U l 1 X 1111 int IXOII NCUI if l llll ill ll NLCUIN lil nhl xlll' I 5 HN gtllllt' lf l ll lll INC l. xll 10 0 lX0ll N 7 Xgllf ill 1 lt V115 C OH IlQfi N XX JN lk 1121 N 11,1 N K J. till llli N till 1lh11 0 11011 that thu tilOllUilt tht 6101114 as lt.1111 occ s Ol s lht 'Nlv ll 111111 tltftttd the-111 to hot Ll1oQt1l1tt s.111t 111d1ts .111t L.11t 1 11'1 NK ls 11tl1 . is at 1 1 t 1 tt 1 N 1 1 uhhl M1 lll f Q N P Ill lllll 1t1111 Ill lllf l l 1' 0 t 1111t t x lls xt 1 t it l 1 out llllt ls 11 s t xl 1, Hts t plhlll N 11 111 t il Q s tllbt-11 Nltl Ill P t ltllll l ht LU t H N Ill 14 I I 001 N1 N I 1 is llllll N lll S llll N ls QNX s N 01 1 L. ll 111 1 s X 1 Y llllt I 1 9 D 1 t UNI Ll! lf lt 111 IIJN ll l1L1 Q Lll s st ll lllbllt s 6 t 1 llllllll l1m1 1111 t Itlllll 19 0 s 11 0011 b1t1l1t ll ts N t t U IX l 1 lllf lltll tl N li IN N s , 1 s 1 111111 2. Xl1ltt111 ' T111 L ll 11011111 t o 1 t 1 L , Ill? N N t J N It 11111 1 1t1111 t1 Ill 4 tilltt N t 1 , A K 1 i ,r 4 . 1.1111 -t,1t1ll1' this ' 1 sl - 111i.'.' l l ,'t1t1tl cl -11101-s ltt sct t111ct- 11'l1t-11 tht- 't-ctt ol 2 gl t ti ll ' l ' .' -'ul ul' tht- 11-111 i11 his hz. is 1'l ht- 11 q ill Zlll t111t-11 fit-ld lt-11 j'2ll'liS l'1't1111 tht- 111121 illlll 111111 t '1c- 1'ht-11 l'1cl'-'l ll' z lout tll' C'll'l'.X'lllQ' tht- l'1ll uct' 15: t111 illlll I cl'.'. ll i'g1ill '-5 Q -1 1 ' g1X,' ' . xl -s' l 222 'ti lt'llfi ol tl- -Q H H Th- 1't-st ul' thc hull' 11'-1: l1-11'tl-lt111,'I1t with 111-ltht-1' sich- g11111111g' lh -1111 z,,'1. Q '-lzgz' ' ll il'll', 'I' gllosctn-Q11 I11 tl '- M lla ft' '-L ' -la l' 'l' ll l IX .' Q LU 'l lint- l - '- s l ' - . This '- .' tl -lm '-at l'llll ol tht- 'lllll' zz: 11' -il -s - .. . on ri. 1 A ' 'I' 1 ' '- ' Kg 1 ll-5 -' gg' nl .'11 '11, - . lv '-- - ' 'Q 1 lui'-. 6419.211-s t-t1l' s-1t'.'l'i fl 1'ill tht- t-nts, t-1't-11 il' tht- Qillllll 11'-1s -1 tl!sz11111t1:11l.11 'Ill l'lCl'StlN.'l'Il. tll-' 'l'l-I.XNl l't1,' tlt '--11t11' Lt-lt l-211tl 5 t't-t-t, lvl: i11t'l1t-s, lls Ill 11tls. filllllllill iillilil llll t-X -t-llt-11t illl -l'l'.-1't-11t't- z111tl tlitl his sl1z11't- ill slt11t1 ins: his t11t11t111t-1:ls1 llt- 1121s l1:1t1tl1t':11111tti hy l1is z111lQlt-s, l11tt 11lz1yt-tl :1 i'tlIISiS1t'lll uit t-. Willa tliztzorl lIz1y11t-s l,t-t't l-I11tl 5 tt-t-t, Nl: i11t'l1t-s, 1271 1 1tls. llztx 1' 11l11ttl Qu: ' -1' until tl1t- lust t1't1 ga lllt'S 11l 'll l1t- 1121s shiltt-tl to ltI11tl, llt- 11lz1yt-tl :1 Q ol 4 :mtl 11'z1s 11t-1' -1' k11t111'11 to t11iss il 11u11t ill hi: 11t1silit111 nt' szlll-ty. XK'il l'-,' t.Xl1i-l f'ill'iSli2lll l,t-l'l 'l'z1t-lclt- ft lt-t-t. ltr i11t'ht-s, ITU 11t lllliS. Xh sta rtt-tl tht- st-11st111 at lill2ll'ti. l111l was sum t-l1z111gt-tl ltl 'l'z1t'ltlt- 11l1t-1't- l1t- 11l:1yt-tl 21 ua -. lt- 'z1.' tl1-1't- 11'itl1 tht- tight :mtl t11z1tlt- hi111.' -ll lt-ll ill t'Yt'l'y 'z1111t-. llrj - Clli'ltsJ llt-yt- l.t-l't tluztrtl li l't't'l, H15 1tl.', lltjtt- 11lz1yt-tl il gn l , lll :lt fil12ll'ti 2 ttl 11'z1s th- llllllll'I' ul' lht- ll'lllll. Not El lllllll 11:15 hltwltt-tl this yl'2ll'. li- . ' 1' l' lll -1' ti t't-t-t. ll5 1 1tls. lit-1 -11 pluyt-tl :1 ' tntl Hillll - :tt t' llll :mtl 1111111 his 11z1sst-.' 2lf't'l1l'2lIt'. llt- 111z1tl1- at liilil' 1111 l -' t1l' tzlvklt-s in tl1- li11t- ztrztl NX 1 at 2 l z1ll-21111111111 11lz1yt-1: l'z11'lylt- Nt- 'l -'ry lligll fill2ll'ti 5 lt-t-t, it illf'il 1221 1 1tls. l'z1t'lylt- st111'tt-tl tht st-11.1 at ltlntl, but was t-l1:111gt-tl to fill2ll'ti X1 ht-1't- ht- 11lz1yt-tl 1,-t txt' ll1t- st-z,'t111. ll1t lust uz1111- 'als his bt-.'t g:z1111t- as t'z11' as lliilylllll was t-t111t-t-1'11t-tl. l'Itl11'i11 t.lt-llyl llz11'h 'th l'i4'l 'l't1t'l1lt- ti lt-t-t, 2 illf'ill'S, ltii 11t 11tls, This 1 .lt-lly's l'i1'st yt-ur, but ht- 1'zs at Yilillililil' plziyt-1'. Ill tht- lztst t'-11 QR -s l1t- gtll tztt-l'lt-s than any oth 1' li2lj'Q'I'. l.z111'1't-'1t-t- tl!-1'1'yl Fl jl Hifi 'l': -klt- 5 l't-t-t, H115 im-1 -5, 1317 W, 1115. 1,111 llliltlt- tht- t111t.'it1g tzivlilt- fiuht to hnltl his 4111 1111tl 1121s lil?'I'l' 11ith tht- 'l t. tl -t11'art- fKt'2llSi4'l Smith liifl l-Intl 3 l't-4-t, ltr int-ht-s, ills 11t11111tls. litqttsit- 1,l11ttl his t'i1': ywur :tt l-Intl Hilti 11lt1yt-tl it 11't-ll. Nt-z 'ly all ut' his t111 -11ts 11't-1-t- lz11':t-1' but ht- XYQL' not -tl fm' his tztrflilt-s ht-hi11tl tl1- lit1- ul' st- :lm-. XVil'z tllilll Alitlltitt' Q11z11'tt-111:11-la 5 lt-t-t, ll ' -h-s, ills 1 tls. llill 11l11ttl llztll' n1t.'t l' tl1t- yt-2113 but 1121: 1-hztitgt-tl tn t.2ut11'tt-1' ill tl1t- lust t11t1 K2 11t-s. llt- 1 1 zt LI ' '- lit-ltl l'llllllt'l' z111tl tht- l1 -ut 1141.-st-r tm tl1- tt-21111. llt- is tl1- t-z111t:1i11 tlttt t' 1' '2ti. l'zl'i11's t'i1'st yt-111' r111 tht- tt-11111, ztlsrt his lust. llt- t'it1isl1t-tl tht- st-atstm ut ll:1lt', illll pl 11t tl l'zl'i11 tllivlil llit-lcii1st111 l,t-lt ll:1lt'h:1t'li 5 l't-t-t, ll ' 'ht-s, ll! 111 s. 'l'hi,- fillill' H1081 ul' tht- st-1 .'t111. Ht- 11.'11z1lly t111t-11lz11't-tl hi: t11111t111t-11t z111tl 1111: :tl qt- 'z 'Il1'. . ' f5i'lliil Nlt- l l1' liitzl Ilztlllmt-lt 3 l't-t-t, ti i11t-ht-s. Ill 15, X1 11lz1yt-tl llatlti ull th- yt'2ll'. llt- l11't lc- 111 111t1st tml' ll1t- It111,' t-11tl l'llllS 1111 his sitl- tat tht I' -. also most nt' tht- 1111.'st's ill hi: lf'l'l'il 11'y. llt- 11'z1s t1111' lt-.tt lillt' 11lu11:t-1'. lCt111'z11'tl tltI1111it-J 1i11 Flllllztr-li 3 l't-t-t, TW, illf'il9'S, llift 1 1tls. l'I1111it- 11l11ttl tht- t'i1'sl t'f'11' 2-'Illllll'S at 'llutltlt-. hut 1111: t-ltztnut-tl tn l-'tilllntt-It. llt- ttlztyt-tl il atm ill' l tl ilillll - :111tl t't111zl1t t-1't-1-1' 111i - tll' 11l:1y. 4 f 'r ff 21 gl m ffwmmfwwwww . V, fx-,V :x.v'3x!.f5x.vr :A Q Thr Lextnqtun .fx Wa of, V, aff, A if, 'W 4' ' 1926 -M. RIYTY NNE 4 I .lg ax. fix 4 x 4 'Q 'f n 0 z z 0 o I 1 ,'.'.'.'.'4'.'.'- u'o'o'a'o'o 'o's o s 9 ff f V 4 v 5? J M ,, , M .,,, A I M ,V I ,V K - A , ,. ,,,, ,,., ,,,. A , GW, m 6' AA6 , -., , ,, A 41 'X-' , ,N:,lZt:5 ,.,, n ,..,i1,.zi ' na-MW'-4'- 'w ffff M-v-v 'M-wwfffwwww'-ww-wwf-M--fffwlfwwf f . 'Q.gY .,WJ1lZZf.1'liCI.IfZZ,T1LT1l'535fTL.fiZl,,.'5Z,.-W--f-1-M ff-f-' -W-ff-M-----dw----ffm-ff' 7 9 ' L,,f AM l fL' . . W f M, . , 5 , , Q . M 1 'ffm ag fs 2 w Wg ig? W iw? Mi ,A QAV X Q. ' ' Pl - AEK' ifq ' i ik' P 5365 - gm - I 1 42 ,w Q Q F fi- 'o 1 'X 5 w fo: X X L ez EE X gl sms' Q ni ,f ef 2 :x 9 K Q 1' if 'K i eg ,Z 1 A 355 3 5 Y R Z I4 l Z5 Q 1 f ax 1' 3 T' il ' ' 1. e H, if 'Q uf? -1 o -df 1 5 X ' ' o r' Y' 1 1 D X 5 , fd , ' a ,x 'V fl gi 1, Q if 625 , In i 052 h . Q l 1 74 2 ' 41 13 'ZH fbi 59 Qi Ui lx X Wy f Q r r A Thr Isfrirurfml ' , ., . , , -,.,...,e,..W. ,,,, . , r .W ::.LLf::: Q.. , L In x 0 My-r. ff cf X r 'X s I 44r.xr,xxy W GONZ.-Xl.l'IS l OO'l'llAl,l, 'l'l'IAM HAS llr-XNQl'l-IT The 1925 football season was very fittingly closed with an oyster sup- per at the Star' C'al'e l r'iday night llecemlrer 11. Oysters in all styles were enjoyed to the utmost. Gathered around the festive hoard were twenty- three football nren and several faculty nremhers, Superintendent Kee, Coach llalier, and Mr. Saunders. 'l'allis were nrade lry Superintendent Kee, Mr. Saunders, and Coach llaker. The members of the team who are to graduate this year: William llaynes, Calvin llrckrnson, Hoyte Heye, George Smith, and Lawrence Floyd -were called upon and responded with short speeches. li iam Midliiff who was elected captain for '26, and lloq Verno' retiring' captain, also mar e short talks on the past season and the prospects 'or next season. lhe letter men this year are William Haynes, Vlrlham Nlrdlxrff ld ward lemmm Nlrlton Nlenlrrng, lteulrrn Nld ill a xrn lllCxlI1s0Il, ll x 1 wlrerry llrytt lexe wrn r r r rrr rr L Xmr treorve Smith, and lawrence Ploxo l A x rorwales Ilrg, 1 rd not haye a yerx rrgt traclx team trrs year hu 1 show ed up well rn tht County meet, and would haw done so rn the drstrrct meet h rd Xlarn -Xvenuc and lrraclrenrrdgt Schools of San -Xntomo not been rn that met Although Gonzales was not allowed to p irtrcrpatt rn the County mart as a contestant, she entered rt for the pr rctrce rt rftorded her She placur first or second in every event she tntered lhe following 18 the result 1 I l 4 loo yard dash Newberry, first Nlrdl rft second 'UU yard dash Nlrdkrff first One mrle run Hay nes, second One rmle helax t,onLales,f1rst Cllay nes, Newberry Duhose Mrdlrrft J The team enter ed the following ey ents rn the drstrrct meet, but failed t rl ru closer than fourth yard dash Newberry and Nlrdl iff yard dash lbulrose es I yard dash Haynes ,xg 1 www aff,-an X. 2:2 I? -M, I.. Q XX , 1, xxx, 1 - it r 'C E ' , ' .' j ' '- H: ' Q ' . ' , C - . . . ,. . . . r ' 'Q , . . ' ' 's L , -. , C' l' l' .' Cz 'ljl ' Ne ' 4-' 1 I j r, lid llarlro 'tl , Nlnllis Key Cl sti'u , l'oy ' r 'nor, Y ,r,YY - . A, . . 1 I. . , ri iii , l'fj .... ,ln 142 22452 lil? 'l I ' C l ,Mi 1' ,' . 'fl d' ' ' ' ' la ' l'.' j ' ', t 't - ' ' ' l ,ya r . -' r- '-- V, -' -,' - '. ' ,, Alfa 1 A A L L L A rr it . -4, ,. . ,. . . I9 her' e 1 rrts: 7g . 1 , lg . . -. . , A X , r . ' .--' f. . .- - Y - r. ,' ,f ' . ' . . ' f ' lift 4 x , , . V K. L. . , ' I A EWR' . . lgifl o ya 1- Q ' ' . , . . ,r,.- lmr yard dash-Isewherry and Mrdkrff. Q20j -.' '. r' i' . ,tllr - - ' .' . SW g - -p - Q ag ' a 'O '7ff'T ? l 77T'f 7' l'7f'ffff f7ffff'f'ff7 f'f f 'f'7ff'TTffT1'fZf ,,,,,., ,.... ..... .,.,,,,,.,,.,,. . ,.-,,,,'fT 'f'f':e: ' ' ' Y -ff--f f - '- '--- 'f'M- -f'-f ll ' wwf wa. '-'f V fwfwwe' f -nf Wa: ww' . WfcfwrwmwwfwfWWWfW w1f:afwamwfnfw7wwmwmwvmwv4zfWfWfww1ffwfwmwwfwwwwewmfvwawwwwwwM44 'vlmmnvv-fmnww Q Thx I exmqtun 1926 0-ff' 0 Q'. 1 v C9 ,x!f X.,f 'x,.f fm QFXFNIN UNI FW Lett to ught 10111011 Pattelson Loaeh Qaundels Gllette Mohxman Bottom lou Nenbeny Ilullose Hawnss if-aptalny lJlClxlll90l1 Ulfunll PEQULTS OF THI' QFAQON Januau 11 Waeldel , Januarx 28 Cost - , 5 Janual x 29 Gonzales fl Februal x 2 Gonzales 18 ff Februalx 3 Gonzales 11 'E Feblualx -m Gonzales 9 ' Februarx 26 Lullng 16 1 Gonzales Gonzales Waelder Cost Smllex Lullng Gonzales 1 v n 38 26 28 8 9 l . Xgf:Xg!p0,gxo,:x4,5o..f5o1gQf5ef5xs,gXygx 14Xg,5o 0 0 4' .0.o' 'O' 4 Q v 1 v 1 5 4 0 'l Q X xfl I 0 I I V, V. -, ,V.. , , .,, . , ' V I I My . H2-'W H-H f fe' HV- - W- -mf-:wa ,21j'f'7 '-'-'Mfr'f : '- 'M - 11f'g11 . I ,I ,iq - cf gg. a , - iw ' --1-eua 2 as 2 , . . .- Q45 21,91 - if 4 o ,5 l, W lI:'f Q! 6 29' -f ---W . 1 X 6-' let 5: 9 xi! -, ' l Z! , ' li L ' s ,. 5 , 'Al v I . 5' 5' . ! a A r,, . 24,1 2 V' V ' g sl ' - 59 ., o Q? v '. 5 0 4 ' ' ig .3 Q , . l. al A ' . all H91 H Q 0 ,ls ' fl' ', 1' U I ' , M o lf- ii' ' I, I fl' ,A 4' Q ' is f 2- - lie - .' 2 . Y: .S V 1 L .k.' 1- ' A . . g Q -s , v VA Ll ' la -Zi ' of c . ' 4 ' -1 X, Q' s ' 1 v X ' ., ll? ' s ' ' Y ll I . L 4 x n, 'A sn 41 rx 'O 'l 4 A1 I lt' 5 51 . 28 L 7 1 . . lv , 3 - 1s 16 1 e 1.3 ,. ..- l .J i I Ju X 5 1 ' 1 ' ?T1llZ1.JUX1lI1.1tL'l1l:f -Q 1 -1 , ' 1 9 2 6 CQ '- . .. fffff' 5' L Q- X1x'1x11 fl'Xx11 lll'IYll1IXY 01 'i'l1lC SEASON 1 111 's j1' '1.'.'111. .lNYlll 1'2 1 . 1' ' ' I ' -' ' 12 ' '..T YA' '. ' 1101 L J 11111 11 N 1 N t 1 1 t11N111 1111 1 1 1 1 11 1111 tht x 1 N 1111 1 lX 1 R111 1 1 1 xl 1 1 10 Il x Il 111 ll 1111111 110111 t1t1o11ox111f1 10111 111 s 11 111 , 111 1 tx 1 11110 1151111 1 11 111111 1011 tl 11 N 1 1 1 1 N 1111 0 L 118 1 L XXI l NLS 10 'S 11111 1 N 1 1 CN V1 41.8 14111 01101 l IL XX AX lk Q If Ll HON Ll X l l X fl 1 ltd! 1 QU 11111112 5 1 N 1 Illd LN 14111 111 1 L1 f 0 flXl 1101 llN WAN Cl10ll ll to XXIII 10 0411111 11N US xC01'J Ull X 10111 111011 110111 N M 0 OXK lllf' f .IX rlhllldlew 111K Lt X AL f Cl I 1011111 CN lllllx 11111 LlC1Ll l1lIl11XXdX XXI 1 11 11111 1 1111 LS lf 110 11lX 0 IL J. 0 X111 0112 l 1 UNL Q L lf NNI 1 110 C81 011 11 01152, Ulf 0 I xC016 111 1.110111 11111 111 1 os 1111s 110 1111.11 x so Hoof 11x 111 111210111 1OIll1I.lLS 11111 not xhmx 11111 t1111n1xxo1l1 1111t1l the l.1st lux Y'lllll1.ltiN 01 1.11 11 1111 S111 Cl111ll11r1 1111 11,1 momtx lll 110 11119 11t 1 L s 011 th1 0 111 111111, 1111 It tl 11111111011 l1lIlN1L 111 10 118 11111 111 111 1.21111 LII 111 Hltll Coxt 011 tho 1111 1111 0 1 8 18 SCOI 1 Il xt C111 It mu 31111161 x t1me to 11111 1110111 11o111.1l11x 1101111118 rQ1111s1x 11.111111 ulth 51111111 1111111111 111 moxt pomts t um 110 4 1xg1.1c1 to lox to 11th11 Snulu 01 XX 111111111 11s 8111111-fx 11.18 .1 1111111111 1111 to XX ll lc111 111 111 countx 911111 111111511111 11 111 11111 0 IL 1 N hwl ttl 1ll to1111111111111 ll 111 .11111 111 1 ll 11151 1o11f.111x 11111 he Q1 1111111101 1 11111 111 on 0 LII N 111 ll 11111 1111111 11 111s 11 0 111111 11111 f lf 101111118 1101111108 r c Il mt 11 1m to he 111111 t0 Cf1llX tht 111111 1111 the 16 C Il 11Cc1o1111t 01 slclmus 111111 X1lCClIl4ltlOIlS C,o11111lu 11111 not 111.11 Ol 1110 1111 Rx The 11t11111 11111111 111 1 ll 11111 xx 11s 11l1t 1 C mu, hu 101111108 s1111111'1 to mt 1111 111xt 1111111 S111 111111 11 11001 Cl11111ce1 to XXIII the 1.111111 111 1.1 um Ll 11111 1 C1o11111cs Al1,10L1 l1 the N111w11 V118 not 11111 successful 11s 1.11 11s 111111111151 51.11111-s JN 1111 1111111 It 111 11 lt 111111 1111 Xdlll 11111 11x111111111c1 .111f1 4114111 1111 1 x 1 1 1 1 0 11 111111 1 1 ex 1 1 111 AXIIQN 'Ill lflilxllls 1111 11111111 1011 1 11 1111010111111 0X'l ll 1 1 sts. '1 f 10' Q jlfw wwf f fwwmwff ff f 1 fwmaum' Q 0 ll11 t1111 1111 111 ll xx 1X 1 1111, c115x lllt 1111111111c1111 N11 1 1 1X 11111 I I ll.111111x XX111111l111 111115 1111111 111111 111 111141 laxt 1 1111 '1 11115 11 1111111111 11 to ., 5 11c1x'1 1151 this 111111: .Xlupt 11' th11 1L'2llll'S 11r1111ts xx'111'11 th11 1'11.'1zlt 111' ll1'll' x'.11'l'. 1,211 1 11 lD11l':1se both 11l'1-'111 21 901:11 ,H 11111. As '1111 1'1l'L,'l A 1111 this j'021l', tlllxj' should 111111111111 into 1L3,'l'O2l1 111-111-1's h111'c11'11 tl1 1 111111 1. ll. S. lJ1cki11.' 1 -11111 U'l'l21l'l'L'll sl1ow11c1 1111 wvll 11t 11'l1'll'1l 'lllll .'1 V1111 .1 11.111 111 1 th-'t11l1i g' tl 1111 1 ,' l - 11 ,' ' ' 'fl,'. 1 1121? l11 tl 1 1'11'st V1'1111l11111' 51111111 1' llZ'll 1111t 1111 11 ,' cl fight. W1' ' 'lllfl 1 Q11 11, l '11v1', lll'g lIl to t11ll 111't111' the 1'i1'.'t h'1ll', '11111 W1111lcl111' 1 111 '11111 sc '1o1'2S t T. f'V 'l'l1 1 1 'st g 11111 tl Cost V1.1 t1 h1..'t g 1 1 01' tho s11'1.'o11 1'o1' fltbll- 1 1 . . 11'? 1, ml It 1-1 ,'lt1ll tl 1 tl 11111' '-1'j1'1 1l 1- 1. At 155 1-5 the lx 1,411 ' ' 11' tho l'1.'t 1111'11't111', Go l '1 1 1 l1'11 1' '1 '11ts. ig 'l'l '1 .1 5 tl 1, 1 .1 1' st .1 '11 lj ' ' '1 ' ts. Tl 11' ll -',-1-,-1' .-11-1-11 1'-1111-111' 1,-1 ' 1' 1 ii' XY21' 1' ' j tl tl 1,11 1. Co '.11l c1'1 t l' ' tl 111111 1' 1' '1 1251 1 l 1' 1t 1 t' 1. 'l'h 1 g'111111 0116111 tl W' -11 ' tl 1 l ' 1 1 1' 1 55-T .1 S . . 'l'l .1 1' 1 Q2 1 tl C ut '- .1 t U 1 'lj .' ,Q 1 tl 1. my -1 1 .- .1 - 1 1 ' .- ' 1' - 111. 111,-1, 1 tl 1- aff 1-1 1- 1 1 1111- t1' - -1- 11- .-1 1 1-11 tl 1 -.-1 1' 1 -1 11 tl --11 1 1111 QQ - 111 ' .' 'gg 1 1 1'1 3 - .' '0. . . . . . 117 Tl L1 of 1' 1' '1 .' .' j .' ' ' ' 1 l 112:1- T1 put 1111 11 gozxd fight, hut 811111111 was thu host t1111111. lloth siclos IJlilj'l'f1 21 1 SL, 1 1. L' ,... . , .Q . K. L' 1. .. L. . . .- 'Z , , . 1' ' tl 1' '11 1 .' . XY1 1111' '1 t t tl 1 s11111i-1'i11'1l.' 111 th11 iff 14' c'i't1'i2t 2..'i1 32 ' ' 1 t. 111 l tl 1 tl l, l' ', C' 'xl .' 1 1 tt 't1- ' 'l' tl 1 l 1' 1- 11111 11 '1 l .t l. l' ,' 1' 1 tl 1l-.'l'1t 1't 1' tl ' 1'1 1' l ' 'xl .' 121 ' S L ' 1 ' 1 1 f' l1. 111 . . . . . 1151 tl '1 '1 '1 ' ,H 1 tl I1 l' 5 '- .1 ' ' tl 1 l .' 1' t 1' l .1 11111211 sez '- .1 l. l 11, l 8. .1 Q1 C C 1' ' . ' ffl 'L 11 ' 1 2 1 I '1 1 ' .' 1' .' 1 101' 111.'t .11 1'. Witl 1ll 1' tl 1 1 l11Cl', 'fc 11 t' 51' ll-1' 1. 1 .'f1Il, 1 1'CXt 3' 1' 19213 xl 1.11 sl ' 1 Q '111t I1 11' ' 1 t tl 'S -'11-11-'5 .-lm. Zywlf 4'7 ':, '1 , ,ww W- gf: 1ff 1 ff 11' H ,111 1,114 , f wwwww - fm '1':f' www fwwfwww ,fy , qvgmw wwWz111W'f 'w,ww1fz,W141 wmffffzff 44' 1 fl 41115-f.2,f',-V. Z,-f ..?3,f'yf.,,,,?,f-f'-V. M ,Y 3 ff , , ., , N , , ..,,,., ,, .,.,. M., .. ,,,,., . , 1 , ,my , ,,.,, ...N ,.,,.. .. M. ,,,,,,, I ,,,,,, . ..,,, , ,,,,.,.,. . ,,..,,.,,,,,.,.,,, . W, .,,,.,., , . ,f f I 12 WW Z f M 1, . , , , .WW ... . , ,,W., , Z M zwfzmwzmwawvmvzrfuwvvzwmfzfWvf4m WWMWWy0 ' If .f 4 'Sf . f . f , , 'Q if I ' WfV'wf4,., , ,..,,, ,, ' .' . ' ' V, V X, 4 f SI.X'IlNIN -'IIZIQLIQ 'I 'J Z., Y., I: , EI Ax ...,, IP unmn 1 sn P nm x . or xm I 1.1 A- mu rw f.1 I .Im UINXAII W dIY Mm + IIN 0.1 . .ui X 0-s ITTIIIIIIIE C+ mu + Ixl In huaxr r 1 - , ,Q I 'I P I U n ZiZwz'f-mwfwfmrvfmwawmwfffwzmmwmzwnwwff-,cvwzffffww''c 'f ,rry an ,. . .,,,,. ,.,,,.,.. ...,7l,L.:1,f',:i -1, ,,.' ...qi ..,,,., ,, V . .M ,,,,,,.-ff I' , 2 1 ,'x Z 2 ,3 f xv mv ss, , , , I ,. . I D. --- - -1. '- 4 - 7 1 1 3 ' , L. I -.-I 2 . 1 .. f T : - - , F f , - : v - + 2 f - 1 I X:-Ep N -E :5x:' 32-11 .-1 is: 4 33-QF,-1.1 r 3 -.2 2, ... -- - .I 5- v- ... .. - A . : -',-- - U---.::N 1.1 4 . - ' ' . ' ' 1 , ,... -1. ' . 1 M, . ,' x . 1 IL E . -- . 7 v. - , . 3' 'T -- V I - 1 .. , Y . -1- .7 2 . -v 'IA 1 L - H - 1 ' C , -4 1 . I 'Z . 1 '. . . -1 Q x , ' ... '4 -A C I v . A ,A . L . C .. .. , .... A X --1 22 1 ' - . ' L ' ' . A: : ' A .Z 'I I... .fr::1:f.-'-,- -4 1- 1 1. N ff- ' .1 'A 1 ' .. -'J 5: I :' - , 2 v , -1 D' 3. -1 , 5, I , ..... -. -' :-4 - 1 : 1' . , ... , .I , . I - :M . : . Z .. : ... ' .... -.N -1. . -1. : F . . 2. L '- f Q 4 -1. 'l- -, gg,-' A A: -' , . -4 T' I -.- .. --- -. ', - , -' ' , - . 7 .. - ' - 1 , 2' W ..' . ,, 5 I , 1 4 -4 A ' , .... . 1. ' ... - Q - A , 1' - -f - -- 4 - 1. :Q 4 - . f - 2 A 'Y ' . :r - -- a ' 4 . :T . V g... - .4 .Q ,-3 x I U' -Q X . ' ' -f '5 C . - ' .... ' . ' . -1 .... .L -Q Q V L :im . Q AA . V, . -1 5 x . x 5 . rf 1 .4 ' , ': ' '. :T 2-5 ' - ' ... N '. ,T A .. . : .4 , x L, :J . K. , I , -1 '-- .z L' -1 1, -1. If . : iv - -- X f 5 3 - . Z. 4 ... U -- .I -5 - :. -, . .I - - - v . ' - 'v': gg 5' E za: T -. . If ' . - - 2. 5 - :- - . C :r 4 . -, :- - 5 - . - I . 1 -f -- -, N --' --' A .1 ... H 1 - ' A . f ,, . - - E -Q I . : I If -S -Q -, S- . 'F - ... :1 .. ' , ' - .. -1 ' 1' 3-x ' c' 1 ' :. zz' . -. - - .1 T '. I 32E'U:'-. -N ... S' -A ' -' 2':. - . . 1 . ., gg - .. . 1- - ..,, ' . ' T .. - . 3- A - : : . ... , .. -1 gg 5- : - 'L - F' ... - -2 7' 2' . 3 3 f 7 -I '- T - - 'g, 1.4 , - ... .1 ' . If : I -1 .A 4 - . -. , 4 N -,-I ' :- ' :- 'E-, , ec - 4 4- ' A : I 4 -, 4 ,T L . , , x' T 7 .... 4 , U' ... 4 1 ' . Q 5 : 2' ' ' ,- 3 : ' ' - CZ. ' 'Y' ' 3. .... - -- 72 - - - -1 , . .3 'J 5 .. f - - 1: , 5 - .:. - E :- ' ' f - -- :Z . 7 - - f 1' ' .' E - ! - A- : - -. -s 5 N Q I . - A ,A If. 5. 2' .- ' - '. - 4 : .-'Z '1 -f f 4 ... ,f .. - 5 ' n. , , -11 7 ' f ,- . , M : L I I ,l T I: . L . - ax -, N H ' 3' A ' '. ? -I -me W ' ' . -Q . . - : ' ' . V 'l. I . .4 3- A . - -1. . . 'T 4 -4' . . , ' Z. '- . -L , I . , . T . - 1 I - I - -' ' Y 5? . .. -' - I' ' -' -. - ' .. 5 I E 'T - 'l: L. - ' ' I. c- 14, --'T :- III . '- i L.. -4 . , S, . c :: 5 U r 1 ... 3 5 I -f -' - -1 -1 '. '. -A -f . .--13, . fi .- '-I , - W - I- . ! . NIS I MQ Q,-wi--A-1,Q x'f ' ' 1 .,',. 1 ':Q:1T -1-Tit' f 3 T7--W. , .-T:.Z. ..,. . A A ij- .. T4' : -.,-...-w-g .,...,:....:1::i:t:---:T 1 'wavf-s.-.-:asm-.ww-.1 xx. Kew ms , . .. .I f X X , 5 ' ' - ' Y Y K - exif -'ixflf-f?x1,.f?xQ 'Exif Qxf ,f'3'xifS'N'1, ,. -1-'gN,5,1'Q'x'1,'7,j,f:s,:.,.-gyxgnfgxxgr,-pxg,-p,j .. --xx ' -' - - w... ,ww www. Q .-.gzxz-xm.--wwsssamxs nxtxsmu su X KN-Nm, NhI I IMI . 1 . N ld If AN .1 umm um ru xhf I I ual but III NIH!! or .III IIIIIIIIAIICPN vw had -om: good HAIUPN and the xv dl? fmv IIIONIJPIIN 1 I nf- u IP 1041111 fljllvltfldh the mllhtul :mulling and umnlm: lv X Nsxsbfl X I I RSUNNI- I 1 I mrmnx M dx a Cartam max nmrlv hu-elf populfu xxnh hu opponfn .ik . fe x be lmlml I0 IIII nf-xt ww NN14 Uv N P N fd I0 phi! an 1 xx men In zfmw -.vmu I0 be m .1 pxnr 1 1 uhtld XXh+nP +4 A Fo x 0 OIIIIONIIIL nam ua told that F1111 .ud u1 mu 1 lv df Imm xoul own opm on I out Iffilth III4-IYIIU. nm I III tum v ma wx 1 .N 1 vhfll -1+ f I 1 A H011 N cum fa1IuI S + ull by und 11+-XI sf-al IIO zo and bfrrm Ihfm 4 P ll u s uh rnu vn4I+-ll on to plan v , , I f1II hr-1 opponvnt All 1 If x emi: rl 2004 ,fn f + .ur fl 14 IPONIIIOI Q IIIIIIIH KOIIUI N A Xkd 5 P 2 00 3 ,Q' 7 .,GNgf3,f7jf5-gx-ff ,fpslmg-1: vf, 3,-:Xu ref. 'VH'-'f' amwmliwrd xxxw Q.. Th? Iuexlmqtun gg . wu 1926 N Nfl 17l0IIl left to llght lop ION Coach Ballel Joe Bllghl Booty CllllSlldl1 Hubb'llll ll neal O Lonnel Nllfllllft CLP VGIHOI Nlflltlleus Bottom IOXX Paltelson Dullosc lllllllllll lulnf, Nlenlllnl. Haynes lxulllll lxlllal flCXPl1Illl THI' LASL l ALL Sl AQON The base ball season of 26 has stal ted off llke lt lS golng to be a velx successful season The fleldlng has been falllx good, and most of the p ax els ale battlng ovel the 300 malk The fllst few games selved as a Stal tel f01 the team Manx boneheads H919 pulled but plactlce makes perfect Wlth steadx practlce the team should develop lnto one that can xxln ltS shale of games A gleat deal about the lnslde game lS belng leal ned even dal and bl the end of the season the team should be ffoo Nlext yeal s team, hovs evel, should be bettel, as only tvlo ale lost bs ladua tlon, Hal nes and llootx 0 'c'a o ' ' 'o'o'o'o'o 'o'o' 'Q' ' l 6 , , V. . . . , A ,,,, , , , .V 'a'a'e'o nfs ' . 1 - , ' ' '. ' 'Liv 1 ,V ' f ii, 1 v Y L, 1 , 'i Wifi: 'Z 'f': ? V 0 T lt Q . . 3 lf' El . il bl:'x'l:NlN- 1 Ill? 22, 777777 77 777777-777777777777 777 77 77777777 7 -77?77777 77 77 lf ls l If 'a , 7 U f Q ,f 6 X 'Q l l . l. ' u o , o g 'B ' s Q s I N . l , f f -1 ' -. .. M o ' F-u 'E f A, N pc ' ' A Y u . Q u , . A x . 0 V l.l'r w , p, K lv , t g 7, I me 4 A A - 7 ' ' s f - - . 1 VI o ' 4 9 .n li s o a U o . l , A , ' a l c ,. - .- .H . .. 1. .. . .' Y . ,A ' ' v U 1 ' 1 I I ll . o ' . . ' 1 . ' .' ' W ' , . . . v . 1 .- . , , . , , , . .. . . ., . .. 1 , ' . 4' Y' , , Y' , . ,. ' ' ' , 'Hg . . . , . , c , 4 , . , 1 . , , ' , ' .v . L' W o K A-M o u o 3 N 1 p w 1 0 L K, 4 , L Q! K U , ' . . . . ' 7 . . . K k . . . 0 . . . ' j l '- J. . 4, . . . A .. . H W . . H . ' , . ' - . , 'l ,Y u v n Q . . L l 'Q v. . I I U. . ,, . . - , -. .i u v v v lf 7, ' . . . - 1-. fl- ' , - V . , , 0, , - I, I V I . . . . t O , , x , ol ' .l I . . ' o ll, , l Thx IgBXImTTl1tL'IIl Q Q .qJR x!nNy'X 1926 ' x IISLIISOI FUI SI -XS N XINILOIS Homc IL n . x A P Iuwchxx, A131116 111 IN Apu Iuudm -Xplll 9 udfu Apu uudm -Xplll 1 I oc xhdlt hollnllu N IXOII C,onf.1lLs fzfbllldlik VK .mldel I ulmg 1. Jlll 1 Qs fmlllalcs I oc Jml t fn0IlldlLS I ulmg H 0 llxlllll Imllmlex -Xpll fr0IlldlQS XIXOII IIVII VX OI 'IIH SI -XSOX In the illst two garms xxlth IOClxlhl1t Cfonmlu ufxs out pldmd and on C11 s 0Cxhll s mm mr mmf on 111 fm txm xuus md Imus 1 g1e1t dull mon About the lnsldg Hanan than dld GODICIILS 'Ilu hlttmff 1 ckhw t hlt It 1 mon Uplifiltlllli Umm 61 1 m U14 bms bn Ll I ul onlx to bc 0XL1tcllxLIl Ill thu I lst iux IIIIIIIIUN Clonmlu sumul to be off lm m both of than gamns L1 uttmf' was D001 hu flhlflllf' Xu 18 nf lil .ug lklllllllf' fmt hidf um X neu fm u The fuxt ,,.1me mth Iulmg was the fust game m XXhlCh fr0D73lLQ khoxxed that she could plax lJ.1ll Sm hit .md fldded xxdl md pullcd xux tux bonem She got off to an uulx start and hdd It untll thy erd of the game Gomales leallx plax ed ball ln the fust ganna mth Hoakum The gfanu ment eleven mnmgs to 11 1 1 tu Fha hlttmfw vas about umlx dlX'dlfl mth Gomaks haxlng fl xllght aclmlmtlge Ihc fl6ldlIlf.l mu good on both sldei and Xen wood headumk new uxed on both sldes At the and of tha elghth mmng the xcme xtood 'B 7 mth Conmlw 111 the lead Yodkum hon ex el, scored two IUHN m the fust half of thg nmth thuQ takmv the lead 19 In tha last half of the mmm lllfllllg Gon CICS ex ened the count at 1 all both tearns xx ent SCOIGIQSS the next mnmg but m the f11Qt half of the deunth S oakum counted afwun Thlngs xx eu look mg had fm Gonmlgs but 1 txmelx hlt scoled one lun to eun tha count it XX 1th two men on baseQ Gon7.1leQ could not some agaln Tha ganu v 212 called 'xt the end of thls mmng Thls game new one of the but that has been Seen hele m a long tlme It was full of tlullls and good plzus In both sides I oth sldex fought untll the laQt man xx as out Phe outcome mix .llxx AXN m doubt, mth both sldcs hopmg fO1 the beQt .0.0 lo, 1 I .l.l.l. .Ql,l. .0 o QI ' ' ' l' - 1 F- v-. -1 f--4 ' v--4 ' .-. , ' I 4 - . . V A fg -I ' 'A . A, 4 M 4 -A Q my ' .1 F' rv 4 h-I n-1 U1 , . . . . , I . , 1 ,-. ,... . . -.. ' : ' ' f ' - . 'C . ' --A -f C -- 'T --A ' , . P Q ' X: v-4 . 3 , ..- 92 ' ' f-3 , r ' I v . 5 X7 - f -4 . ' . . ' 4 . ' Q , G ' . . . N :L - , - I . , - . , . , , ,-4. -1 'A r '4 i, . b c ,- . K a , .-. , ,- . K . . - .1 ,,. 7, I . b b r ,H - ,, , 7 . , - . N, f: f, : 2- , ' ' ' ' . . N C ' . . 5 ' , a K .. I , Vg. 'rl . ,Y ', ,LE ,Q fn Z n-3 . ' -J . ,-3 . 4 . . . I L ,. Q T. 1 -, . . Ir r 1 ' 7 ' ,. E 5 '. vu N, TD 0 .. . , .. - m .'. .i -- - ', . J. fc .-f-4 , 'Noor' - , , ' 7: f-+ Y . 1 x. Y ' , . , '- . L, H ,-,I .-. W . ' if rj ' ,v - 5 , III. 1 . . N - -' ' ' - .:. ' '1 wi - I - 1 v -. ' 1 ' ' . - 1 2 Q.. 'T . 1 1 , 1 .J , . r - ' J . ' ., I C ' ' fu 4 s , I V , . . , A . h ' - . , '- - Z rd f-+ L., 'OO' W A- . . -... .- --I '... - 1 '4 s v . . L I , . ' V -Q .,, L' - ' V , I 1, , . ' '. S L4 ,, 1 , . ' ' ', . . I 5 f-r . L., . 4 , , . . . K . , .. ... . ' . w - . . . ' r--4 ' .. F, , ' ', n- Y1 . V ' -. . ' .' f-- 7- f: '- ' .' ' - 'T - - ' . '1 ' , ,, . , - . ., , -3: --1 . U ' '. '. f ' , . , , y A , 4 l, A . , . A ., . ...- .' L -, , , 4 - . 4 w ': . - .... A ,-,. M ,H ry ,.. , ' A . ' ' 'A 'J . ',1 H. J, ' ' , ' ' ', A . . ' ' , ' . V 'K' ' ' 'A ' ' A-' L- ' ' . 1 ' ' ' ' v . D F' 4 1 . . ' - ' C ' Y v . . v , . . -+1 A ,, ' - ,A . . . . . Q 7, F- , ,.. U ' 1- -3 '. - Y ' ' 'A -4 ' '- ' Z - ' . I ' : '. -A . 1 . 4 ' - ' .-, P71 v- P-1 . , . V ' 7 A ', .4 QI. A '- Q3 -1 vl uv 3 yu Iv I' 5 'f , '. 4' ' N . ' -' 5.3 ' '. . ' 0 ' .' ' , 3 -1 ' ' ' . V v . 7 .. . . G 4 AE ' x: D O 5 ' , ' -f - - 1- 1 ' 1 X V A v . Ill 4 1 --' 'A . . - ' f: . A - , '- .' ' u w V - - ' ' n '4 I I 'U A I' ' Y . ' . 7? Q . . 'a .4 Y ' - - ,-1 3 . . A A- L 4 A A 4 ' . , 95 . - I , . z-P g . . ' o . . -H ' 'l L A' , V QC H7 7 -' ' ' .' .- .- T A ' N .5 . V n- . . . - r h F . . , '-j -w - . 5 Y 1. F-P v. , 3- ' Vs. I., 9, .. ,' ' . I 7. ., A H A A ' - A .. X 1 ' . 1 V ' . 1 ' 1' - W . 4 V s. A A 2.2 . ' - 1 , 0 , V - K. .. N. I-4 ' 1 W 1, ' -, ' , ' -' L . .xl ', .' , ,', V ' A -f .- . - - rf ,j 1 - ..... ., A ' '-' f ,' ' ' In .-. 4 .. rs- ,..: -1 ' ,-4 p.4 ,.4 ,.4 T- 5, ' ' V . 1 1 .-. ..a . -. L' - 1 '. . . I '.. : . :-' '4 ,z7,. '3 Q. , X, N' ,E A A M 155' ' , . , , tif! , 44.4 . . Q L 4 M , , -.,..i-.,.,,,......-- .,111 ' ' 9.1 .'f,f. ' P ' ' 7: ' 'M' f ' ' ' ' ' ' ...' ' ' ' ' ' ' ' ' ' ' ' f ' ' - ' 854 -1111 I, x111111 111 1926 x sN1 121111 1.11111 21 LN 11 111 1111 2 s 1 s s 1 ll 1 1 111111 1121111 1112111 11 11111 2 11s1111 1 .11ss 1111111 '1 C1 1 1 PN 1s 1 1 1111 tfllll 11N 1 11111111 C1111 .s 1121s us111 21s 1111 111 11 1111 11 1121s 11111 111 111 111x 111111111 12111, 1 I1 11 1 11 16 els 1111 11111 11 1111 11N 11.211 1 ll 1 21 11111111 111 1 2 1 1111 111131111111 IN 1111111115 ls 1111 11 11 11211111 1 141111 11 1111 11111 1 118 121 1 1111Nt116 C 12111 ll 11112111011 11 12 H1 111111 1s 11111 11 111 11s 121 11s 1111 11 121111 1' C11 1 1 11N 1111 111 1s 11111 21111 11 111 121111111 11 s 1, 1 21s s 1.1 1112 21111 11 s.1x1s 111 111 1e1e1s 11121111 111 111111 JK 11N 1311 1 11 11 1111 1111 1111 112111 s11 111111 11111 I1 s11111111 11111111111 21 111 1.1s1111 1112111 LN 21111 111111111 1 111 the 11es1 11121111s 1111 1111 1121111 111 111 11111111.1111 1 1,l1 '1111 1 111 ls .1 1:11111 11211 61 .1111 1.111 11s11.1 1 JK c11u11te11 1111 111 111111v11 11111111 21 N111 11 1 1111111 s s11 11 ll 111 2111111 121111211111 1111111 2 111106 1111131111 xx 111151 1111 12 s 11111111 1.11191 s 11 gt, 16 N 0111 0 16 D65 JJQIS O11 11 141111 ls 11111111 UC 11 1121 411111 11lN 111111111 IN 1111 JIOXIII1' 111 1111 1111111 1 1111 111111111 X1LI11x1I1fl, 211011111 1111 l2lX1f 21 110111 11111111 11111111 16 11211 1111111 111 1121s 111111 111 119'11lNt 111211111111 11211111 111111 N1 1c1NNfd 11111s 21111 11lN 111 1151111 1 11111 s 1 1151111171111 111.11 eu 11111111 I1 111 11 Few 11111111 1211 1I11Q1191 11'st 1111 g1211111s 111 1 121s 1111111111111 ,111 1 811101 11 1121111111112 11 11 s121s11 1111 1111111111 211111 111s 11211111111 IS 1111131011112 1111 8111113111 X 1111111 11 011111 811101 1121s 1107111 1111 1111s1 11l1L1l1l OH 11e team 1111s Xtfll H1s CLIIXQS 11111 111111111131 120011 211111 1111 .1 112111 1211 1111 1121tte1s g111ss111g 2 s s 1 1 1 s 1 11110111110 1111115111 11' 11111 JC111111111 P1tQ1111 1 1 1Nt111 1111 1 s1111 1 1.111 1111 ll 1121111 S11 1211 11 11418 11111 112111 11111011 C 12111c1 11 s111x1 1111211 11 C111 111 11 111211 1111 111 112lN ll c 11111 11111 111 1111 111 1111111115 11 1118 111111 111 1111 111x Roswell 13111014111 11111115 hex C1111s11.111 211111 11101141111 1x1111111 2111 111211 IS 1211111111 11111 121111 11111611 21s xe1 1111 1 s .1111 .1 111111 C111I1Ll 11 11 11 11112 111s 11211 r v H ':-.- L -- .U ,I -4 Q I 41 TM N' ,N1X1X1N.1X 22 1'1'I11,'ONf '11, 01 111111 '1'11IAM Will' 11 '. '1 11-11'11 S11 1't S1 1. 11.112 ' xx'-xx 11 g1'111:11 11111l'1x1f11'1'1111 2111 11111121111 g111:11 112 11111'. 1111 1121: .'112 11' 211111 111111111111 211 s11111'1, 211111 111111111 :111 11xC 1 11 1' 11'1' 1 2 l1'1t. A1111 1 1' :JJ 1 ,', 1 '1 1111 1'1.'s wa.: 111111 111' 11111 l111s1 111 1'1111's 1111 1 11' 11 -'1'2l1'. 111 ' 1111'1 ' g' XY'1.' 11111 2111 1111 C1111111 1141, 215 1111 '1'.' '11 11 ' 111 11111 1111111 1111111' C1 11' 1 111'1111l'. 11111 was 111111 111' 11111 1 1s1 1 1 C1 , 12 11 ,'1' '. 1111 s 2151 ' ' 2111111 1111 111' 1111 s1111' 1 1 1 1' 2.' 1 1 1' 11' 1 1' 11 1 '1 1 1.111' 11111 1'11s1 111' 11111 .X'kil1'. W'11'- 1' M' 111 , 1CJ F' '51 1'- s 1. 11' 111 - 1 1 11 1 11'1 1 1 1' 11 1 1.'t 1-11 1 11 1 11' . '11 121'11'12.' 14 111111 1111 '1111 .' 12 ' 1' 11 1' 11' 11 1 11121111. 111: 111111111111' is 21s 1,'111111 111.1 l'1t' '1 111. '1.'11 '1 11 'j2 '1.'1'.'21'1't.'1 '12:c11 1 ' - 1 - . Jack 112ltt110XVS, SQC111111 Base. .I21c11 1s 2111 11xCe11e11t f1e111111' 211111 111211's sc 11:1 ' 11s1'.' 21 01:-.1111 111111 V1 ' l'1'1t1 11. 1111 ' 1-1 11' .'-11.'11 ' 1' ' ' J' gg' 1 's 11111. 1111 1: 2111 Z1 3111111 1 1111111' :x 1 ' ' 1' ' 1 ' . M11 1' 111 ', T1 ' '1 1,'1.'L'. A111 '1 '1' 1 1' 1: 11111 X'L'l'j' 1- 1' '1 1 1 1: -1 1' 11 1 gt ply' 11 1 11' . He -1'1' 11' 21 1411111 twill.. k.I..h..s.I.v.h-2 X. . M'1t 1 1' .1 'C' '.3111'11-.'111,,' 1'1 1 11'1 11 ' ' 1 '- .' ' ' 1 ' 1 ' 9' 1. 11112111 '11 '111' 1'11w 1- 1 2 1 1 .' -111' '1 1 .'1'2 '11' 1 1 '11, F ' ' .11' 111 . 1 '11' 1111' ' 1 ' '- 1 1 11.11'. 11 .12111 111.11 ' ' 1'11 11. 11111s2 911111 1-'1.' ' ',I'1 '. .'1 1' '-.'111211.' 1 .' '11 ' t . .i .,., 2 .. . .1,...L.1.1 1 1 ' '. 1111 is 111:11 11.'1111 111 1111 11111111111 XV1ll11 1111 1: 1111 C' '2 1' CT ', 1 211. .' 1 113' 111-' 111 1' 1 1' 1151 112 111's -,1 1-.'1'1'1 '1' ' '.'1-11'.'1,1 ' 11 11'.'t1' 11'j11 ,1 211.'1' 11g 1'11 '1 1' 1111'- LITERARY 1 A I LIIII1' I,11x111111111 - V ' ' 1926 1 ,f ,M My 1 XIII -XI .11 111II1111 1 I SCLII1 J Cl IIIIIll IC1 IIIIL LCUIIC 11 111 X111 NIL N AIN III IX I0 1111111111 1 . 1 . 111.11110 I1 IXQN .1 0 III I1 11111111 11.11111 11 11 1 1111111111 1111I1 1111111 1.1111I1110I111 I1 1 . IclIIX5 111 X11 SIIIIJ1 Ill 1 1 1 1 0.111 11.11 1 .1 SIIQ, 1 1111111111 I1 LS 1111 NIIIIIIIN 1111111 1 1 I111111 11110111 .1111I I111111 11111111 1 1 . . 111 I11111gI11 1. 1110101 A 1 11 115.11 1 1,11 1 1Ill . 1 . 1 0 111111 IL LI JSCI11 1111 LS 1 10 1111 1I1.11 11111111 11 .1 .1111 .111111.11 111, 1 1 . 111 .1 1 11111 111 JI I 11.1111 1I1111111111 111 1.1111 I11I.1 .1 I11 0 11111 1111111 1111I1I1111l1, Ix1.111111 .11111 I 11111 1111111 1111 I111I11111 1I11111 1 1111 1.11111 111 I1111I1 111111101111 III 1 LII 111 11111 11111111 0.1 1 1111 JK 111111I111 111.1Il1111111g ll 11 111111 1111 1 ,,1 111111 1 1 II 11111111 11.11110 I IIN IS IC 1.101 11 11111 1111 11 1 L11 1 II11 .1111 1111 1 11111 IIIKI PI11 NICN, . 01 1 1 11 II .111 111 I111 I1.10I1 I111111 I111 1111111 1 1 111111 11111 111 II 111 1 1 1111 .1111111 S111 11 11111I1111g 11.11110 It 1111111 1I11 1111 .1111 1111111 1111 1 II 111.1 111 XIII III 1 1 1 1I0p111d11I 1111 11 1 Il .11 11111 11111111 .1111 1 111 111 LIN 11.1111 111 1111 111 111 111 .111111.11 UI11111 11110111 .1111I I111111 011111111 11111 A111 11 1 1111 11011 PI111101 I.111 11 11101 11111011 1f 11111 12110 I111.1110 1111I1I1111I1J ,1111I1 11111 I f1111111I 1111110111110 11111111 10.11110 11.11101 11 .11111111d I111I1 10.1d111g .1I11u1IJ N011 fm 1I111 11111111011 NI.111.f1 XQXGI 11 1111 111111 11.111 111 1I11111111.1111 11111 I10111 TIIcltS 1110 1111ff N011 1I11111 .1111I1111I1 111 111 1I11111111.111 tI11 I1u11 111111 NI.111.1g11 I10.11110 V1 I110I1 111111 of 11111 0.111 1110 1 111101111101 IIIt6III,,1IIII1 ' 101 1 1 I 0.111 111 11 110.11110 Y01 1011 0.111 V1I1.1t do 11111 11111 I II10 I'IlllIt .md Punch NI0tI1od fm 11111 f111g11101I I105111111111' 110211110 1111 .1 110n.1t1111.111 1111111 111 I11111 H111 bm 1.1I10 tII1S I01111 11I11I1 I 1I10t.110 -XIICIII 10.1111 119111111111 I10111 XIII 01 110211110 1111d1,,11.111tI1I 1.111tI1111111 1111 1.11 N11 LIIIILIIIKIII 1 IIQX 1 111 XII 1111 1111 lfifx fxiliyp IN' 11 1. nnzniww -nwmuvmvzawn-1 on I I .1111'1,111-f1.1' .1 W 'I'III'I IQICY TO 'I'III1I .' f. ION 1 V11 '11' I I1I. .'I'III,' 'Y A01 -S11 1 1 1 I IQ1 1-A al Off' 'I 14S1 I P1'i I. I'1-151 11- I' ,4 Ij 1I ii I '. IC111 11' 1'z1II111 'IIICI 1'z11'111' I I11I'1. I' 1 K'-'I'I 1.01 I' .' '1' .1 ' 1I 1 .'1' I I IQIDIJI 11'iII I1 I101'0 11 21 Cil ' 111' '1 I11I-1-'I'I - IQ, I 1 '1 111' 1 1:1 .'1LI1I.'. W1 1 '1 :11 ' ui 'I1 Call' 1-Y ' 1' .1 .'1111I.'. 4 . L. . .2 ', , I1I111i11-V1'11II, I 1Ii1I11'1 I'111111' 11'11 I1111I 011111111111 111 I 111' ' 11111 . 1111I- 'I . Ill' I'1'11 1'I.' 1' 12 I' 'f0'? 1'11'11.1' I'II1'1I2-AIIII1' II'l.'II't 1111111 I 1I 1 S l.'f 11i1111 1,7 11:1 .'111. I 'I I1I'1f1 1 ',,' 1'-I' ' j ,I I'I1111i11-II11' Cz Ili 1, 1'1I' ' I1i11. My ,g .'I1I N111 .' I .' . 1OI'1'1'.' T- If' 1 1 ' '1 .J I1 III ' II 5 .1 I' '1- ' 'I111 I ' .' I' d ' I 1 z111I II 1 I1' ' ' ' ' '1 . M' I' 1 111' I .' 1' I11. IC '1'l'I 11I1' Call' 1-N11 ' 1' 'jl Ij 11' 11 '11. W0 IIQI '11 si 111I1' ,g :1111111 I I' 1- -. I tI 11' 1 1 ' 'I1 1 1 .'1 Ij. as - .'I Im' ,' 1'1' C'11' j I I1dz-N , I11 M- II 1 1' ' 1' . 0 11 21 1'-111' I IIIII U 1 '1' ,11 I1111' 111 11'111'I1 11. SI1 1 1'I ' .' I'1I I' 1' I'1- ' 1- jg I. I0 II 't 1-1II1' '1'g1'f1111'I'I'1 l A V. C2II'1-11: 1I ' 1 .' 1 I NI. 1 11'.'J-S1 1' I' f1I IJ I: 1I I II .1' -1:'1-1:1 A' -I ' I 1'. Q I ' ,Q ' ' 1I' ,L .I' '-1'- ' ' - -1' 1 ' 1 ' . ' '1,,'01'. '.II ' I fvll' ,' I I11Iz- 1 Q 111 . I I ' . .' - K I. , y , G. S -I . A - 1' I A i ' 1 y . . w lx 'Ei 1 A I , -U, .,--A X i... 11.11 A'tg., , . I Il11'1'1'-1111 I'I,'J-Y '. ,,' . I ,,,, repay ' ' f - .,, x. ?, wwf - , . 2 , ' ' 'iff , c 'a'vArzz4'?Q1!wA'1t7 ze4,Wf , 1 ,, , fa, ., H W., QV, 1, ,,,..,M , f . ,, :gm gUL,fggw'A,fQ4 ..,. A, A ,..,,.N. m,,.,.,,.,M ,,.A, ,. ,f?fQW A 19263 ,lyfmw ,.., .,MmWMW,HM,M - V. M, 1 la . Q ffff' gif Lil N19 GANG NUIN NX OI1tX Nlllldlk 1 1 lf X Milli Il lpkl IIUIH Il 0116 1 It .oofllew gmumls Q . 1 4 N . It hmm mom . xmtxlg coli lx 'No lIltGl1U moms naw fc,0IltlI1llLN to dlctfltc .mf C 1 uve 1 0 mt xxlll xw Lh.u,,a at o lox e ug x mx we no llldllkld x QUIJAIIJNNLI xt IJILNLI Ju ul pax as won .lx we get the mouu me ecx mm 11,4 1 u M14 mx o 1 u ur C111 he N IQSDOIINIUIC tm om d.l,t,10IlN xeatxxe coldlxj X11 xou km lx sup out QUIT duuw ns mk m w11,,1 xm qc, f ,ox Jon ht mm Stxit dtblillllllk mu xeatsle Slmplx clml e It to Olll .lccount XX dont lmu .mx xet u that doesn t nmke .mx dIfftI0!lCl mth us xmtsle Cbf11cc1st1c.1llx to CCIIKX lvdil 1 1.1 xlll Nfllll tasty ax 1dlt0l .um edl s 1 more mucu lmllx Km 10111 01111 ucgnwn I con mtend to domumte xou xedtsle VK ell I ll Nu what N11 Ixu thmlw flblbllt lt I Xl x 51101106 b101x6I1 bx 1 ppm I nex Ll dld Nik so mam plcttx nls lll 111 mx 111 ax fue 111 some of these -Xnnuflls fIXLd.tSl6 eutels J Iuatsle Come hem, Cenex Pludx See thxs panel ' Wall we that dlclgolml 1 s 11 llght lhen 1011 have to dum the S110 H1 the lJlCtUlC that It W1 be when It comes back llmen xou have 10 dum lt lm It locus hel e, b6f0l6 xou send It Sabe huex Fleda fbemlduedl 'No ot count not xou we .1101 Ifleda nom out hom llstunngj Yes, we heatsle You don t because I don t mx self Cboth walk off J Callie Dld xou Lll know we couldnt wll votes 101 tha VJIIILX 11.111 tus xecu ' I welxbodx Hou come 110 can t Hou xxlll xx 0 make :IIN tlung I pple-Ibn t 111010 .mx xmx 110 0.111 nuke monu I un 1 llttk blt 11011111 tlde us 0101 T01 .mhlle XI.ux Ixexxbodx thunk about lt .md corm 11.1011 next Dillild .md me mll talk It 01 61 fbells ungq and 111 leaweb Scum 9 Place same Tlme I'0lllth P6ll0d I VClXb0dX back mtsle fd1.1nmt1c.1llxJ Ifllends Imnullms .md Illlllll 1 we .ue fuxtheled hele 011 thlS bedlltlflll chu to dxscuss .1 ffloomx Qubmcct, monex Hcxs .mxone .mx suggestwns . cux I dm A fum 110110101 IH 111.1101 huex Fledl -he am of xou IQIIUIOUSIX mclmed' ,W M, mf af, vi aj owanusiff E .1 4 1 f 1 hmmm wwwof nM wMA fmfm wfgwwmmvy frm 1,mugtu11 X o K Q H' 2 -5mm rx -riuam' q y E If f- tx' --Pl Q 1 us t ' j s - '- tb-t of ,1 lj 1' ll z 1 ', l 11' 5 1 . V Cz ll' f-C 1 :Z XY -'ll hwvl 10 kecp it in th- study hull. Wal i dm' ' 'L ' for all th'1t in ha-111. 2 M I X- fl-Q H lj?-A . I ' ll-':'. ' ' ' ' 'J ' 1 ' V iz ',,' tt- XXI' ' ' ' - 'UW t '? Vu' .' Fl da-M1 l,' ' '1' I ' -llj - l- 2 'n' -lt l L K, V . ,iz . lil 1' -H I' - 'Y Cha 'ffl 't t M11 Sul! vl-md. H u' g' z 'li'1 'md . x. . J L. . . . 1 b-. iv' U n 1' - -C -' -X 1 j d -V L, , . I ' ' rg tl pf? Q M' '-Tl - tl' 'Url t, I' P ts' Oli l' I 't X j '.' z ' 1 Q' . ff' . I' V. S- .v . ' , , ,. ve v , . x , 1. Av b L , I 1 ' - ' ' ' 1 ' x ' ' 11 N n L v I . . . . L D Jia Lv- 5- '- '- .' - fl -J-Wu rl-L .V 'r 5 - -- fs, j' , 'X . 'Q iflff ffb , A 1 l - . . , nj I C' 'j H z-ist ll ' 'aut '- jj-lm - j ' ' .1 1' t. 1 t 9532 ' ' - ' . Q12 V . , , ' , . . , 1 2?? if ,. h V Y , . X . U . . . h . Y . h . . Y . . rw . i ,Q ' S ' . . . . . I '12 ' v '. R , f A ' . , . , , . N455 5, 5 . . - , . - f A . , - - - 1 . - . ' 4 51, ts zl ' ' . Q - ' '- ' : z ' - ll x ' f ' .' ' '. j ' ' ' l'l'- lx' j5Q . . , . ' '. v Wy ig? '-'A' -- , ' 2' -'Q , TT . F? Keatsie-Qgoes D2liI1St2lkiI1j.l'lY th1'oug'h the whole thing' 212211111-NOW do ifQ ' - V f' ww: ' ' , , . , ,. 5 E , . . , , . . . Q5 53255 v ' '.- Q 5x2 3, ., Y - . v . ' v . 0 . . -,. . ' -0 in ' - - '- ' ' ' xl .tZ.3,Y . A I 1 . . A 4 , ,V gg.: ' C Y - ' - - Y , Ly SQW , . . . . fM 41' A . .-luv .s- K- Y . . , . - hr ,- . f - xi, QNX 2 . - ' v - f'f,'1 ' .' 0 : Y . .' - . 1 ' Q1 f. , , . c . 5 . , ff- I , ' x H LX, ' 7' 6 1 I L, I . . I ,I . -Y . -l lui? Ke- - ' ' ' j - 5, ' - ' A z Staff, ' ' , , hy. . . L ' l L K K h 1 K . x ., l-. .S . lv . I- my - - L, A-? DI, ,.,-1 , , ' . V' V . ' .. m- .. fig '. , ' ' o l f, I0 91' ,. H- .,.,. ,,,..,.-.,,,,..,,,..,,----.,,,,.,,.-,.-,....,--,,.,.M , A 7 H , Xa if A A f AA 1:13 4 -' ,f.f'.wf:,' 1 , - f f f' , f 1 fn f W! fff', fn Aww 'fvf an ,ff wwxcwf ,, , 1 fwww-Waw-vwwwfzmv 'fwrfmf A- W4 X -xv-XNQ -vm ..... QM--..-Q I I ,vi ,LI ' x Ax YI' LII! Q A 4 9 1 EI: a MW fW II. I LXIIIIIYIII fify we 4 :wfnr lauwf 1 1926 M f N I X I Il 1 It mu NUINIAX Sm N mux 1 x . II I xo J . all Im mor x un mm may cmxn .mf aw me .I mum fu cn . of I rm . wld x I . . gg 1 1 101 N x . x ro mc, wud UN so ll N Iclnf N N1 c If U ul cl IJ 4 :llc x 1tN1n 0 Ls IIAISQ God Imm Whom DLNNIIIUN x IIII C-VICII .llxm Illclxmsoll ul 1 IN IIIIU tllp had phmmf I pon .1 SIIIIIIIIKI dm rlrl 1- In I f 0 wma Im had to s .lx N mutx xu Km Idt IIIIN Ild lt home Nm up IIIUD IIIN Llothu he Imuncui mo thc xwodx to Hmm II 'frm . n 4, ggux IIIII4. JI IIIC L ma mx Cmnu 1 A QIJII L lund 14 Nm .mr Imux 0 It Iflf A xo A 51 Xnc NLIXAIIIS two or IIIQL I x u man 1 me-n N mlppx fu coulc me f nu x mm IIN wc glux um L N 1 noun .ls IIOLIIN vent ax 1 ll 1 .lx ww um no Il mc Q- mem 11211 ho muxt me 1 1 I4 Jr Xmx If fm outdoor spmt xou Xe planned if Xml mth .1 Cold xou NICIMIII, H nu fI In-tim Ieme the Npmtmg off if I 1,01 XOII wth dvzlth lac- NI.IICIx0II 1 I I 4 x IW, ax g 1 I I I M: f 'f A4 s c e 0 0 0 s 1 u o q Q s v Q us 1 Q ml 1.0 1. av nf nav Q-vsum-v'-ap.1'2vn:1wwuuv' Woifia-V W .arrfxllaau -Mvicuxf 'E v Ifswfninsw-0' ' 'X?' ' fx QI bfx '.f Q.fQf5 '.fN..,f 'VT ' .7 xLf 'le i.ffx'.f if sms xwmmfna .. , lf! IW. ,,1,.. Z W,'f'W'.?fvf'fw'f4' 'fzl 1 :'fizf'f -' wffwyfqwmwo , f' pw' ,Z'PgVMg 4' TI I x Pu! ,ffm ff, ,,',W YMf'7'W',.'W 'ff' . 1'fix1nvV 'f 'H'. Ml' 1 ' ,1 'f?'if?.,,fQi:g: .,,, ' f ,,'- ,',, Vfff ,,,' Biff? 1, Q ' ' ,,,, ,., ,,,.. N ,,,. ,,.,,,., , . ,,,,, M .,,,. , ,.- ,,,,. ,,,,,,,,. ,.,,, ,.,, . ,,. ,,,, .. ,..,, F ,.. ., .jf N.- ,,,,.., ,W ,..., ,,,,. ,,,, ,.. ..,,. , . ,. , .. A fifii f Q43 .NI.X'I:N'l'Y' INI. nl? . II V X? 'F lil piv--I pals: 'I I papa- 's 2 ' L' .' 'I ool. 6 f'zl1'n-5' IJILTI21-..l'I l.'I.' 1m '. U1 'IIIX of -' u 1 1 15' 7 W1 ' Isnt Z but I'lI do it. Ii ' I fl In' I' HI I ' - I -:su A ' 1 I atti- v4 r 1 I' Mila Ilwu' I,m'cI, Ilmu Who swst our III'lII.X' 1111-:Is I II' I vn 'md M3 I 1 y - i , , . . 1 gI I Iml nm' In'uI'u xx 41 ww. Imt Ilyx' mcrcles drop -ns thc 'vntlv 'z.m .g I'mm Ilmwlm, M ' f CIM ' opcns IIUISUICS,'I.' -11111 Mr. I ec If ks lIIIiOII I, 'I .' 1 .' .' mc- I . IIIOIILQV, own 11' 1t's but il Iittlv. 0112 Km- drops 21 chock in C2lI'0.Y 6, ,gf I ImI' 's lIIJl'l1l.'Ud I ' I:.J l - v - - . Y . . 'I Nr. In-v-.-X1'l.'x -md lm joyful all ye- 1 1 plc. Yo ' Ilo-t won thv rm- 5. 'L III thc I'-ur I uIc. ,I I111 I-I-IwI'5'lmcI5' join in the CII 1' 1: of I 1 ' ' All 5 l'I ,V Iflox ,Z ,. H 4. - .K 135 2251 ' A 1 ' , . . . ff MII .. . . 'X' A Ia z I :I ,g ' - ' II, Z A cc lu- cuuglmt, Iwf'm'I- 1 IIKDIIJIII, K 14 I' S I I ' 51' fi, I ,XI Rai .xi 625 II:.' IIIUIIICI' to ll 1: ' j '-nt, fax, I , X QI f I I -' 2 2 1: . I .' ' If I ' I EU? gg I - ' 5 ' ' . I5 ak 22 iw , . I fi. Ile had t gm I -1 NI- I ' css, Ifjf A ' I I It Ia 'II5' two, I3-I' 'lil' I- wat' CJ, ,Q 255 A f-v I -- 1 - --. gf I iw A rl g I - I ' I, - I: ' 'un, IQ Q I .' ' ' .' ' ' I ' 'Z llm 'II on they ve-nt, tl A V- mg sy t, Igkxf HI If Lg . ip- fvg Az1Iy'f'1,'s I .' 'II ' ' 'sg ji, .fel . 5, I EV: XIII ' ' If: If IN VXI L'1t at I' st tl ' Q I DI A EFI II I' ' I .' I' . 1'- LI Xllll 1926 -XIIINI A . 1 11 C omp m tm nu ln .lx .1 I 4111 wl uw con mu no 1.11111 to xc . on x on mx . . 1011 - xxx mc Home o me ICQILII mg 0 ICQI, mom1.u1, .mr wo an IIN uux, A 1101 mxtul of I, lclx Ilx II e .1 mu XIII I . X 411 an xx 10 was 0 act .lx IIN malta IIN cum um IIIQXIJLIILIICLK .mc an I wud rut nm .un tudent thought INN mndn non would In LIIOLIUII 011141 I tlum 'rlll than ILNDQLIQIXQ placex It ull 0 0 IL . N III 10411 II ew on IL cg o rv mmxtu xxhcn I N .utui 'I lou Ioolxui It Lloxelx .1 ux 1111 1 ICQ mu f mm xun ln IL NA IL lui 011 um 415.11111 x 1 ll 1 un ln thc I x s w Lf I . , 0.11 0 km x ac ge xnxx meuw s mer IC 4168 0 IN on xuu us s .xc x6 I mn mud Imxu of -XI I 1111 C1 1 u 0 f . . 1 XL s .uted ou Iux IOUIIIQX Q at mg 1 Qcmu o u lcll 0 O1 L IL comp upon the pxmte I 1.11 Ile had 1 dupu xte stlum, Q ul 1 1.11 .11 f xx ll I thu muy bdttlmg the mul ot Ilo me mu tom .mr Noun ot Ins spur was lost Afton I,IIIS was lemedlgd thc Cdlltcllll p1oucf'1cI on Ins 011111 4 He next mm that lf he dld not 11101 Ins count xllghtlx In mould st11I Q ClCtIJlllj.1, QUIIIQSS I 1 NO Mm 1.1 I0 cI1cI It xwuk yumlmlc up N load 1110 contents of 11111011 xx cle xelx T111 114 so fdptdlll SALLCILIIIC lltun Ins COLIISU .md .xxolded I LIJIIIQSS XX Iulc C llltdlll Student was off INN 01111111 001112 .uouud the ICQIJUIU In Imppumed upon the Umnnel oi IJ1sIm11utx III ckudul to Ho thm 1gI t Imycausc 110 tIIOLl,Q,IIt It mu cl NIIOIt6l mu III tII1Qfld6d lux wax between the sI1 up 1110111 of ILACIILIS I ook .1 I mncn of C Lttmfl Caugm imc x 111 lf nougm I0 mmm uc xl x IL dxd not get I ll 11011110 he CIISCONCIEWI 1110 11.111110 of thxs tu 10111 mux xx IX ufd tumvd 11.1011 to the mute that Counsnllm COIIHCILIILQ 11fIVIN4.fI Q1 he had Gotten to 0011151 10110 IL nga mu 1 me mulch ooc 10.11 mu oox um mu .1 shm IIUIC o NI 1 1 .mr L mm u 1 SIIIIIIIIQ spues of the H ill of Success III tIu Po t If -X Paw -Xs ho munrk IQ neck of land IllOI,LCtIIIj.l the small Imlbol the Ilttlq tug boat hood C,1.1rin was Vhllt1HQ to pull Inm up to the 1111011 m tho IJLJUIIIILII I mt of -X Paw Thi -IILIII I -I,.m111'N I I.O. .' I 'I'III-I . VK Yi ' ton O I I-j' BI'-',C'1'IL'l. Ai'z,'xStuI t I My g' :ft mil il xt 'I I' sm of I'IX'lIHIll'lt. fm' tlw dist-mt port ot' A I Hu I-I5 t LI ' ff' 'I' I'- - Igtt- I'. 'f 'I'I fm - ' 'Ia ' I l', WI 't P'1 - ', .'Iz '1 I'o11ciI, Iloctm' ICI'-1.1-1' ' NI Mr. I'I 'I '- 5 t ' f' 'st ' X. TI '1 ' '- s ' a' -1- I -. 'I'- ',I C111-' S I ' Ia' ' -I gt -In TI 'I I' I1 1 -I'1, I'1 tI - Ilclit I I II ' I they YI '-z j-f'tI'1Iz-s'IIlf.'I-'tIw-il. TI I t . 11' '- tIjzII g'It. Do ' ' I I1oIf of this :hip cI11'i.'tuu-I I'1 1in Llw I ' I I' ' wl- II ' '- s I ' ,g st ' I. TI b-I s t' H'.'t f' 'qt pt' I' d. ' I full '- J ' . g' -I '- , 'Q t A' t' Iliolugy, 'Incl IIVIIIX jugs of' '-rlzs. Captain Stuck-ut finally got evm'ytI1i11g' stowc-cl away 0l'CIC1'I5', and pr- - j - II-- IJ -II -- -I tI -sn '- 'I 1' 1-iff -I. HB1-Q I 1 H 1'9 '. - 2 Is va ' U'ffI tI Fl- il .l'lx ,.. .,., . ' . ' I .. , - 'Ss W1 th ' f 1,- III-11.' -11 -I in I ' ' ' ' If I mf - I ef- - ' lv r 9 'LI'1i 2 j ' rp 2 ' ' ' . 's, 'nc CI' - II ' 9 f' It, ' I st' 'tel tI ' 'I II Cl: -I. I, I Ij I I Aft ' ,Q ,, 'AI ,QLI-2 'I'L' tII .' 2g I I -I Itt I'I' I t' .' 't ' t fgltl- I. II-.H 'tIrtzII tl 1, '. . ,'. ,L,. .. .' , ,.- .,' '.. , -. L. v. ' ' - ' -Q ' ,. '- T - ' A . Ss. f W WW MW' 'W 4' 'I ill I lxlnutun 1 Af fwmfmnfwf ff! 1 1925 ii- IDOONII IJ j.,1I1ld 16101 1ouN.111d doll lls 1 1 Uliillwlllfl do gl s f so 1 . .lmu .md IJ1.m.1 QIUINXXLH blldtl and QIOOHI, xwlo to mend thell uxnwon m the x dx oi 1 .1 u 1 n x n uc ,lulu .mc cl gun, 14 llttef mth which to Obtdlll food 1 mm Q. o u s mrnc 1 .1 sm. ton on 1 xx stun coast of -Xt11c.1 lhu Stfflllltd .1 lelmblc. Imtne guldg .md IJEKSLAII L H11 IOUIIMX mto thy lIlT.Lll0l -Xftu .1 uuks Xhlllxlll thex sat camp on 1 mall IINLI .md pmccuhd to LOI1St,lLlf,t .1 housg oi logs .md dm On the tlmd night 111.11111 wud slw hecud the dlstfmt tom tom oi d1LlnlS DIUIHN t Dm m sm callad them Hu husb.md wud that It mu oulx 100l1NhIlt'SS tl lt hu 1m.1gm.1t1on mu lunnmg .max mth 1e1 no dm uhllc Lums .md the ,,llldL 1.1 bono 111 suucm 0 on 1 Lube oi bdV1fJ,6S .lttackul .md cflptuled Duma She was slung ON61 thy snoulcluw of one of them .md c.u11Ld fm daxs .md dau Lllltll thex .uuwed 1 .1 Xl .gn ilu homu oi thy sdmgcb xx uf. madg oi vox en glamu .mc t lll 1 C11 lhue was 1 st1kL III the centu of the COLlltXd1C on cl mom d I scape mls IITIIJOSSIIJIQ The mx es of tlu xfuagw .md then chlld un calm llllllllllg 0 see tus neu, stxfmgc, uhm Cl0dtll1L who mls so cuel sslx slung on then chxeftum 5 bhOllld61S Sh was made .1 DIISOHQI m one of the hutk On thy folloxxmg mom m mo mo 1111 be t01U.11Ld0l bulmd to death lhe glasws of the hut xuu xux du .md mould bum eaxllx she thought lt she onlx h ld .1 mx ch Lflflel x me L 111 mel mc ut 1 nu VHIS one 518 SUllCx 1 It IC usd and xx ent out It xx .xx tlllt Shy xx .15 leallx doomed .md on thy mol um xhv would MCL dmth JameQ and thy gulde hefud cues .md ldll back to the house 01111 to imd that 191.11141 had dlsfxppealad HL guesxed what had happened and nent III sefuch of hel He thought of the Ihunw of Doom db Dlfma had cllled tlum IIL 1tlCh6d the x1ll.1g,e, CIIHIIJOII up cl txee to mitch .1 cuemom that was 511111151 on The slght uhlch mat hls exex made hlm flcmtrc Hu beloved Ilmna was tled to .1 stake and hldeoux sfufxges, then b0dl6S stleaked IH guddx pamts VNQIQ pelfoxmlnv 1 Dance of Delth mound hel lhex xellcd leaped xxhnled .md flung themselwes lll the cud and poked led hot nous to hex tendel, VKhltQ flesh, and the ones most clevel mth the bow and umm would take tlllllk xhootmv It hcl -Xt last 1 huge, blllh fe on 111511111 to applofxch hel sloxxlx holdmg a long speal III hw hand He powed It fm dll lIlStdI1t thLll thlllSt It UIIOLIQI1 hel bodx, pllllllllg hel to the stake The dlSt12lCted man could endule It no IOIIQQQI, but he knew that to mt lfile meant death fm hlY'I1N6lf also He tumbled down fl om hls hldlflg place Ill the 11199 and began the long IOUIHGX back to c1x1l11.1t1011 Cmzed mth 11Gf he lost hm sense of speech H11 gulde gwvs fllghtened and deselted hlfll At lfwt he found hlmeelf on 1 sdndx beach 'Ihue um a Qhlp passmg on the bm but he could onlx xmve and tu to shout 'lhe lfxttel effolt ended 01111 ln a mumble The shlp passed 011 ,4 g I ,I 149511501 A ffmvnbavv a 9 0 1 .11, 1 v 1 X 1 ' - M, f' uf !,JW4'4WW 'Q Q 1 f V h' 'fff f 'fwwffnv ,gy W ff',',,f .,f fmfw1f.'2 ' ,f hr ww af' W' M f 1'11 , ' - 1 , . ,, ,,., ., , .. , , , ,, ,, , M... , -,, - .,,, lfil 1 H , ., . . r,1..111'w --wig!! L A A 1 V11'1' - P 1 1 l' nf A tl 1 'S z ll' 1'.', -115 , z lwt is '1 bet. in hm 1x'1l .1 A11' C' 'ltl 0 lj 21 at '1 1' 11' I 1 ' tl 1 3532 'i'h1 C' wells took l1'1vn1 f tl 1 .'t1' .1' zt - .' -lll 'n th1 . I - g1s':, is . . U.. . p, 5 . S . . . xi, 1-L.. .. -i gg-,yi az 1' 1 ' ' '-s ' '- I '. Lit, O ' .1 10' 11-dv' ' ff 6,2 ii? . .. 2 .S . . V, . . . , . L- .,k. L. . , . A .EX . . . . . . Y-19, it , , .2 V- A AK, - x L., ,. . . H., , A ' . . ta, , I '1111 z 'Cle. 1' 2 Q z '1 1' ' ' 'i My whlclm one could be lJlll'I1Cd 01' tortured to death. Ilizma shudderedg she was ,yi .. ,,,,, ,, . -. ' 1 , 1. , .. 51,11 . T.. A . 1 U . .. . we ' 1. J .. X . ., . . J I . V' ,.. sk, A, ' .J., 1' ' 'lj sl i-1lt I ' 1 l'1 3 Ol tl '- Q . . I Q ' l' L. il k- w is Q L . L m t ' Qfjg . . , . -, , J, v ,gg . '. . . 'L.. . - , . , - SL- - . . . . . . . , ,sri J . , . ,, L, , ' . . I l. iv , ' . i . . V l H t. . ' K A H c ' K L ' ri Y 7 . iv'- kv 5 1 4 - . . 1 H . ' . , . . . N ' . ' , - - 1 ' . . -' h y 1 K s K 1. . 2 .. . . . Y .S K, ' 5. 2 V.. A 2 . ll . ' ' ,, . X . , . - ' . v J l. I I' I V . V. .Zi . . it v. I. S .K S S . 2 K-.V l. . l ' ,. ..k K ' Sk-' - ..- lv .. . Y ' ' C . - lv . ' U I ' ZA '4' ' M' lf 4 'fl PZY'5l 5 '-J b1-Qatvfw' 1 'J , f ' 'f , ' ' ,,f f yn' '- -Q WL,-0 ' f ' ,V A V 7. Af , 'nl L.fyZw,.'Q,,,.JZ'Z1Q-3.' 'f N I LZQ ' ' 4 u V ,: '1f v f1:'rzf'v 'aevwf:+zv'r'ww'-'z- f Q22 B u Z' ,, , ,mf W nwwrwmwwf1 zf'c' mfrmmprwfw,nwrwzwfvnw 1, mg. . ,i ,i if 11, . ,Lp iQZ.'fi:Q,1':i, F , J' ' - ,,,,, ,.., 123 ., ., at f ,, ,,, , , I ,I,I,, M 4 , ., ,,,,, ,,, I W 4, I II IIIIIIIIII I , , , , , . IIII I IIIII I I I I fi, fc f W l f ,Q A , 92 'uw J 3 5 ' 5':fN-. 1 6 ,,,,,fj'i I. I V .1 N'f.,..,,, ,.-ff' ,V f 2 Z ', I I H , 3 .1 ,, V . - I WW wiv nW A Y Y VW 'Wm H W W W V- X X dum 'Xlaaun lu ac ll I .UNIX tho Couk How ILI umm. IX Actl mix XMINIIIIIU, c lx mes x x lx 0 xnxx mug cms u N bu don t wg no wax out of It homo than s How, but SUIIILIIONX I don L Unk that 11142001 N woo onoug 1 01 mm, .mn .mx mu IL s com 1 om min IN 41111111 nan Inm umung 1 x 1 Ll ow IIIUIIIQ, on omg ou 0 e no ou Do' me 0 .uux u no Num mum mm mm 0 flx t un cl mm mu Nlandx Hose Johnson, xou Ixuoxu I don t xmnt xml to du no IIISIILN XIIW Ioxctt would fue me tomolmxx lf she N su thi dlxhcs xou dlx an Y u ls my moxt mum uttnn 11111-fu sn I mn nm, Nhmflx don t Nou can uutlun bout me .mdx solutelx uuthm NI1 I Imxcm, .um mm dc t n m C 1 mtg cc 1 uex 0 un 0 an oo in . II Q I 1 fm x Hose Nldudx honex, Ise plumb Ll wx .lbollt xou, and gums what X .mdx I fun t Cdllll uouthm xbout QUCSNIII owe VMII f111xImu I se ine to m.111x xou .mf andx Stops XKASIIIIIQ, dlshes and Ioolw It Inm AIIOIIIN YOLII xx mt ou l1I.1cIx nlghe-1 xou fm ou 0 nu io1eI tlnoxx XULI c on Ixms us 00111 e xou m xxuccom cnc md cI1xmu-f mv Nhmdx I Old I bet that D001 xxormul Iuls .1 Iot Inttel QOIIISC Will Imoxx N 1.1 Nha xsue11t1nIu1 110111111116 x un M tuc um mtl xou Io-0 LII m mmg mtx nun uoud sn Ill 0 ICI Ndncx tl1.1Lxwm.m .N one H1010 she dexll 2 rlI LSI 'I' SIC L I0 'II Kill V418 H0 IOflX H NOW I N xx IX don t mu 00 on .mc unc IL .1 1 n , xo CIII ro IIII hu 1.11 L I .1nxI1oxx ts .1 JI x xm un 4 on II,LlIN oox wu xwm.n mu w Q mu 1.1 omg 4 0 mum Mdndx Plcklng up cl p du leaf x to IQIIIONI xt Ivm Xou Coon mu pate ' fIOIS to the H001 .md nuns UQIVCIIS I0 I ns nom IIIQLLOI cl luxdx Inolxc thlen pl lux LI11 nook .md Nllxs Ioutt dc m told nu 1 blvlx dIIOtIIGI med T114 mg sho I 'uc N Ixg done OI sc .lndx NU un x 11' m n . xo IS .lx -woo .ms 1 Qc I mx H 1 1 I my mu fndx +1 N 1 I my xl xo 1 Q 1 Inca wma 01 mn Mgmt ' .md 1 mc U0 no Il 'ful Wow but then unt wot no m sc 1 5 41 fi 'ff fn mfs, 'wg mf ll ,fr WVIMW X 17 LIWAWWW I WWW!! IW l W7l MlWWW5V fW!GWM0lbWWlWW I M -IIIIIIIN my 'fff 'f I H1-il: Llc Y .lolz 1.2! 2 I I .Elf IQ' ' 1835 I UIQ 'z 'tI's: f 5 A I' '- 'ff , f A121 4 '-.- ' g I'sI .vp-1,01-f1,', 1 .ho um f '-.-1' ' 11-1 I 1 1 U , , .rs V . K. rw, d ff . I - d . - I I K. 1 I rl-OL . VQl,'.'tA ' ,J I 1 I- ' - ' - mv. fig? If It I ' M .' -CS' 9' 'II ' C XY ID M I.'I' Y I '. j BI Q -'I, BI' YO :I .' II I t - t IQ' IV i.'I for VI ,fgfif ' -3 Auf -- 'O tl I .v 1 ,I fl - ',-,--- I I-wr .1 xc-ni I'ut fl I wh fi M' j-Ab: rj ' ' . '. . 0 .' ' ' if j 1 rn' liml 5' 1 :ul +2 ,Q v-lc: 1. I's -1 t' ' Ij t IL L I - I' lin my t'II'Il!II'Il1L1'I juli. , , - , Y v ' . , .2 , . . v . . X.. . , v .I ,H . - I I . W B. - V, . Q. . 'S' H? . I, . li Y . Y 1-1,-Y.-v t fl I-I . . wut! M .'-- j .-',, '111g ff 1 I2 'V -- 1 . 952 tI-ts I X- 1' ,I .I ,I- slx 'I 1 I I' . 3- .- -wx 1' '-1 g 1- - 1 - lx-I -'1 fl 1 I1- Ij - - .- IAQ ,',if w'1: ' s - . '. X- md -Y z. .CI I II ct :nh I tl u,'I t j 1 .' t ' I -I 1 'iI.'! .' ', .Iona '12 'lj ' j 5 ' III-' n--Ive ju-1' 't 1tl'g' tl-I 'I I1cI'- '. I ' 1'tj j 1 '-1 't In-. img M .v--QA ---'lpn-I, 1' 1 ' -1 5 vi 1 mm- 1 '1 u-1 I 111 1' lg? 'I -I . ,iofl Lv. QL- . Y. , , 1, , .. . ,Z D1 f I, C 1, , I'1.' ' '- I'-115 II ' '1 s I I1 tl 1 ' 'Z I ,JY MQQ4 .1-,. - - - - , . .. ',. - f . ,V . , , 3fg'7 W! . , , .- , A . . I , , Ig, I ' LI' ' '.I ' is I - f 'I 5,4 Mo: -M- I'.' In 11 lo 'ix you fm' 21 long t' uv ow, -md sirco j u is: ff just ,g :I f.l'?I I spcct XOLIIII luv I I'i11,,' fn' zmothu' jul, ' n't 253 j 'Y If M1 j-I ,'11o.':: sw. WI jf? I' mx --IIUW' I I' lI Ik- t: I' H1 II - 1' ' 1, ' Iy'. I BI' j.'-OI I, 'I5', I . u't I'I' tl ' flf' , . .' .. I 1' ' ,Q th' ' L-'J - 0 clo. Ig! I , mi ,, .I....II, ,,,,.,-.. ..I.II -.I.,,-.-I MM W I,,, M ,,,,,,I,, ,, I W I h MIM I,,I 'I' I 1 4,5 oi, M lil: :ar all xii 512 16 'Flu I exinutun ' ' 1926 ' ' ONI HI CTIC D-XY I ill Nlidl iff The moining of a xxild d IX daxx ned lllljlllt and cleai, though nothing seemed unusual about the place I didnt dieam of xxhat xxas to happen I diessed ate bieakfast and xxent to school xxithout anx thing unusual occuiing It so happened that I xxas taidx that moining, and I hated to get an excuse, as I had been taidx about ten times alieadx I ut when I enteied l,IlIICl1Jell Iiakei s Office, he looked up and said time in the last txxo xx eeks but that s peifectlx aliight You can be taidx eveix dax as fai as I am conceined, because I iust love to xxiite peimits foi x ou Cant x o11 sit doxxn and t 1lk 1 little xx hile' lxo ' VK ell that s too bad Ileie s xoui excuse take xoui time about getting to class, and don t foiget to be taid tomoiioxx so l can xxiite xou anothei excuse I xxent o11t feeling kind of dazed, foi I xxas expecting a sexeie iepii ii11d Hastening upstaiis, I got mx histoix book and xxent to class I L1 te to g xe mx exc se to Nliss Dax, the histoix teachei, but she said Nex ei mind the excuse, iust sit down and make xouiself comfoi table I x s ius discussing xou, and hoping that xou xxeie not ill And bx the xxax, xx hen xou ale taidx don t bothei to get an excuse, iust come up to class Do xou xxlsh to shaipen xoui pencil' Don t foiget th It xou max get up anx time xou xx1sh and shaipen it I don t think it xxill annox anx one and I knoxx it doesn t xx oiix me 1 bit I managed to get thiough the peiiod xxithout fainting fiom this ti eat ment 'lhen I hastened back to the studx hall and tiled to collect mx thoughts At the end of 1 fexx minutes I xxas calmei, and xx ent to the libiaix As soon as I xxas seated, I i used mx hard foi peimission to talk Xliss beiingei ieplied to this bx saxing sxxeetlx Of course you may talk. Dont you knoxx' better than to ask for permission' just go ahead and tilk but be sure and talk out loud so it will make a lot of noise. And say, why don t you get that old squeaky chaii to sit in? The one you are in now doesn t squeak a bit when you move. And before I forget it, you may chew your gum if you want to. What? You haven t got any? Well I have about ten different kinds up here. Come 1nd get one of each kind, you may put it 1ll in your mouth at one time if you caie to. Somehow, I managed to hold myself in control for two periods. When 1l.e bell rank I dec'ded to go to the cafeteria and get something to eat, as I was in sore need of nourishment. I ran down the stairs and started to buy 1 hamburged but Mrs. Ieockett stopped me and said: 'Don t bother about paying for it. Here, take a couple of pies and half a dozen sandwiches. Wait a minute, I want to give you some candy and cakes. No don't say a word about paying for them, or I'll get mad. It s my treat today. I ate as much as I could b11t it was impossible to consume all before the bell 1'ang so I put the rest in my pocket. I got upstairs into the English room a second after the bell had l'llI1,Q,' b11t Mrs. Saunders said: V, .'x' ,tif 2 av ...Zi .ll-Qi ie I. I1 l 5,1 fa 1 lei 55 ,- 1 15, .lv . ill ' A 14 a-:Jasc . ' - , Q ,-- Q6 -' ' . 0 , .,,. ., . , V ,,,,, . . f x, ' - , ., , fig ' 'P - ,s.Vgfaaffgf--1.:f:s.:fr-..sf:s.v'rs2f2s1f - ' fm-fmwvw 'Y 1 I ,..,.TLSZZILTTLZIZTZIZ11122122151221LIIfIfIlfflf'L.'1lIZZffIZfIfffIIIfZ.TIf ......... ...... lIZ, ' ' , gl , i, 1 ..,,. ..,, N . V I x ' 7 V WW W pw, Ijl1ilI'IiY-'liljlllfl2 ' 3 12-1 Xl, 6 will , 0 gif' I' 'l 'I 4 3,6 axyl ,XG ll . , .. ' . Pls 3 - I ri MI lv , . ' - . .' Q . . . , .' . . . . - . X, fi A ' x A IQ! L- x , , - . . . . - . . , ., , , . 1' . .. . , . . Y . - . , . . .' , , ' , , , ' All . . , . , , A . . , Qi' ' '. 1, A 1 . v. V . - v . ' . .J , is ,lg - - . ' ,lv my . L. . . . v . , ' K. . . V' I , . ' ,lf ' ' 1 Q ,qi . ' . . . gif Good morning, Hill. Tardy again, I see. This makes about the tenth Q fxl . ' I ' . . ' , - ' 1 v 1 K- 1 w I . - 1 A1 - . . - ' 9 gall ' ' . . - ', v . A .I 1' . ' ' I' .' ' ' 20' z A ' . . 71 , ' 'J ' . , ggi ,. '. . . V . . , , . . . . ' . , , , ' , . iff K e ' K ! . Q C el , ' I! M, . . .. . L. . v. Y . . , . . ,i . . - - fel ' ' - - a ' 1 ' ' 1 - u 1 f - - 1 1 1 - . . .- .l , . . . A U - . 2, . 1 I. . J ' ' ' ' f j S ' ' ' 'Q:.. 113. gy. ik z '. '- j 1 asa I 'j .' ' -' .' 4 1 . X I rc... l e L - ,ee . K . . , A . . l . 1 ., . s . 1 , :M I. . . i, . I , .., 2 I. . 'Qi .J , lv lv f .N , L, , . A Z 7 . , , .. , .,- I X, I ' ' N1 , v s ulv 2 .'l . all . . . . . . , , .- ,' - ' . . -. . . - ' M2 , ' . ' ' , l , . . , . - , K. - . . . . . 1 . ' ' , ,V .. . v . -. . . V. , .. . , v . . . 1 . . Y 0 . . e e . . . . . . .. . 5 . . . . . t . , , . . 2 .- . I . Y ' ' , . . Ki . A ' . c ' L . - ls. dl - A A v I 4 0' I I K L v . l'g 'I v , - . ii ? 41, , K 1 al 1 ' ' 2 ' ld, cl I , H 24,85 al . ' 62 75 . . ' . ' e ig xi, If nl w l f' 'Ile X-: - A , 1 . e ' V2 ,. 1 2 ' , w 'iii 1 v l f if if I 1 - . 4 I Nfl ix. 1 'Vi ffl , 1? 1 'K ,I X 11111 1,1 1.1111111111 1926 11111 11111 111 .1111 con 1111111 211011 gc 1111' 2111 UXCI , 1 1 lclxl xo ll 10 x0 N ll 11 .mc 1 21111 L2 .fx 0 llhl 2111. . dllf lt 111LI11 1 111111 11011 lox Ill ,Stl Q I1 1 see X01 e21 111111 L N su, 111111121 21t ll umw 2111 um c211 2 ll 11111 110 1111 111 xo 11111 121 X011 1211111 XXII en 0112 1 1 l12c21usL 111 I1 111te11c 11 .1.1 xoux 4111 Q 121N1 ll f1o211e21f 2111f 1 o 11 1 2 III 110 111111111 1 N0 4 X011 out of clmx 1111 N11C1 1 s11121 11111' 21x 121 1 1111.41 101 1 lt home XNOI1t 1101119 to c111111e1, but I COL11f1l1 t eat 21111 t1111111 1 112161 2 11.111 so mum nt NL11001 1 1Qt11111Ld t11zlt 11tLlI100l1 x1o11ue1111f1 1 1 uw s 1 lI1 1 ex entx would co11t111uq N11 tuxt class t1121t 1tto111o011 11 .mx Ueonwtlx, 211141 v121x11 t N1Ll1C1x0I1 f1o111g t121t 2021111 21 1211c ta st 1121s xC 121 ll U1 ,ut 1 111 1 1.11 l'l1l2J,2.,t'd 111to the 100111 baton N11 S11t11u12111c sum V111d 1 111 N011 1111od11 t take the test 'LUC1211 You C2111 11811 111 t11Q 11211211 tau. 1111112 the 0t11L1s 21121 x111t111 -X11f 114111 L f01j.l6t to t111 to how 1111111 wel tha I10t,l0I1StI11x0N X011 111 11Qtt21 s 11 2110 118 11 15,2 1111111111 211141 1e21d It 1.e21d It out loud 1f xou 112u1t to Nu X011 need not take the nt H1 gmug 0 11112 X011 2111 -X t111x 111011 1 2111111211 A C1 geon1et1x mme C11Qn11NtlN 1 xunt c1o1111 to dass 11111111111 11 121t on e211t11 would 11111317611 next N11 1,211.e1 came 111 121te .md Q 111111 1 4 t111ox111111 C121 . 211101, It sud 121 111 11111 mu Hoof M2121 J1 c'1cL1 1 011 on 11101111111 nmxbe lt 11111 11112 X011 by tm co11t101 -Xml chop 1 1011 tut fldX I'11ex sounded oft tone, 2111d 1 would 1111e to 1111011 11 thex 11.11111 1n1 1110 cd 21111 t0d211 'Nou t111011 0111101 thosa bottles 21g21111st the 112111 1 1112 2 lu 2111 gen en1211 x121x11t 11 zt 21 n121g1111 10211 511 f 12lXL 1 11t 111d1x 1IC1I1kXL by 1. tl t111s class 1 went to the 111311111 11121111 Nhxs 112111115101 11.1111 mc some 111012 gum .md told 1112 to s211 21111 1111111' 1 p1e.1sod S110 also M1111 I1 xou Mant to t111o1 21n1t11111g 21t LL 1, c on t use 21 sm111 11 21d of 1111 L ge 0111. ot 10se 1211512 CIC 1o112111es cacsn 1112110 21111 c111111u1cL x111et11u X011 11122111 21 xuudoxx 01 1 boo1.c21sc, thex llt 111611 1 12114 01 -Xnd 11 xou want 1 bool. don t stop 101 1111, to clue. 1 mst 1x0 2111 1011 xmnt and don t sm .1111t11111., bout It V1 hen bC1lOO1 tu111cd out 1 t110l11Q11t sun 2111 t111s 114111111 1110 It 1 1 mean gmnff on too 101151 21nd 1 1121s11t expeCt111g It to o 21111 11111111 111 11 en I 1epo1ted 101 track 11121 tlce fo21c11 11101 1112 1111 1 L 11111 5c1,1d Come11,Q11tout11e1e I have somet111ng to KELIVG xo e ed me 211ou11d the bu11d111'1 .md than 11 1s 111219111 1 111111 1 11 Q 11 l11 11111011 1121s cdndx, 021112, fllllt ICQ c1e21m 2111d ..1d21 11 21to1 IIL told 11111 to b wmted 211 d f111 to I d1d as told, 211111 111211111151 co11s1f1e1121111L p1of11oQx XX11Ll1 111 of 21 sudden Co21c11 112111121 wud 211 sle, 1011 .md 1.111101 2111d C11v111 1 1 .nd 1llI'l soma mfuo 1 con t C2116 11 N011 12110 lllll 411 m11es 1l1lCcldX on do 1011 cxpoct to get 21111 mud ' Hue 1,111 1121v1 some mon CdI1C1N You 11211 C11 t 1 1tu1 112111 1110111111 rv V1 1121t dont tell rm X011 2110 g1o111f1 to 1221111 sonu ICC 01021111 ' No, xou 1121111 -1,1I1I11'N -1111111 Fo gli ' 1 1 1 't ' 11 t '1tt' 5' 1 .' L86 S2141 ml 11 11 .1 1 11 cl' t.1 1' 11 1' C1 ij 1 1 1111' G '1111 L 11 -111' 1 1 01 1 211 ',1 1 't1.1t' I1'C'll1L.11.' fl 1tt1 . I,1t'.1.11111 1111 tl 1 tl 1 1 11 11 1 to 11 hut, Wi11i111 , you 111 L 12 C1 ' j urs. 1111t11tj 11'1't 'tt '2t211 .1-111'1't' 1tt11'1 j 1 IJ 'tb111.11t'1,,g 11 111 1t21kt C2 111111. 1' tg ' ,gtc .1 111 Q' ' ' 1 2 .1 '1111' ,1 t11t. 811111, 21' .1 11111 -11' 1 11 ' 1 1 ' 11 1 j ' 5. 1 12 1 .1 112 . 11 .1 2'1' 1 ' ,, i'211t1 Q1 I K. . ri- 11A.'b.f -1 if 1 .1Al.h. If i2.1l-, 111111111 ' 1 1' 1.12'1: . I- 1 ' 1 1 1 1 -S . - . .' ' -Q.. A L1 1 1 1 , . 2 in D sk. - 1 V- 111 1 ' .1 . 1't 1 11.1t'1,t11'1t1'.1C11111 11 . I' . ' . t h.' , , Q, , A 'J ,y I. ., -,.11 ft . . A .lv ,, 'k. ...i 1 x . , , sn, . I '11 1 1 1 1 .1 . . 1. '1 1 1 1 ' 1 1 12 ,'1t 11' 1 5 1 '11'. Att1- 1 1 , t1 1t 11, 11,' 5' 1111511111 1 '21 .' . ic' t . 2' . i- 1 ' -' h-' 2 , Q, it . V. I A . 2 ' 2 xy. tube.: 011 the fl:1o11, 1 Willlt to sec ii' they 1112111.21 the noiso 1111111 Ulildt' y11s1c1- Ifldv' 1 Qd ' 11' A1 11 .1 ' 1 2 1 1 'f' 1 6111. .1 CU1111 11-11 .1111 11011: 2 2 j 2 1 1 ' 111 11' 1-Z t cc1. , . 'S . sh. 2 x ' ., .h-2 in-. ' I A 'L.k. D .' . , rr., , ? 1 .1 -11. - 1- .- 1111.1 1111-1 11 1 1 12 j21z1111dj11'11'1. . ' 2 ',' ' .1 1 1 11' 't,f .1 t:1' 1 j 1' 1 1 1 .1 1' 1 1 .. 1211 11 'h ' ' Q 1 jf 1 1't '11 1 1 ' ' '1 ' '1 C ' 1 I 1. 1'21' ' 11. 1 21. T111 .1 1' 111141 an ,.' . , .3 . 2 K. , ' . .' -2 ui .HI 1 1'1 '111 211: 2111 771 'AC' 11,1 Q 1 '2.. 11 2 ' gr 11 1 .1 1 . 1 ' ..- lv I .v . tl ' L- . -. Iv- - .2 xl, ,X , .2 E I ' v k A ,. ,.,... ,, .. .., ,,.... ,..VA, .v,.. N ., A, 3, I XIIII 192 - 5 1 CKNN1 1 I 1 . . x 1 111 . . N 1 1 x Nc 5 IU 1 I1 lf., 1 X X 4 N 1111 -X1 . 1- . 1111 311111111111 Il x 111 . 1 1 N 11111 1 11 . . X X 1111111 11 N 1 1 11 1 111111 .1111 111 111111111 111 .III 11.1 Cl .1111 11.11 2 1 IIlIIf 111111 1 11111 111 1111111111 N11 1111 111 111011-xx ll 1111 1 2 1 III 1111 11 111 111 1 1 1 111111 11111 . 1 1 . . 1-1 III lII III1xs X11 N I inn - .- xI'111II,l'. 1111111 'I 2- -I A V. Q 1 , 1 11 1 1 1 1 .11 111 LI 1111- 11111 1A1lI' 111'211-111-1- 2111.1 11l1JI'1'. .I11.'1 111- 111-1'1- 1111- f1'1.X' 1111- I1I1'1'1 12l11lN 111111 111211 11111 111- 2111 111211 IS 111-' 'f. lI'.X'. S111'- 11111 111211 Q11 11111'. I I 111-111 1'-1x1 11111. This 1111111 111. 1I'1'2l11I11'Il1 XY'l.' .J'1'111IIQ' 1111- 2111 111-1 111 N X'0II1I1'I'III11' 1111211 111111111 111- -X1. 1 111-111 11111111- '1s 12151 EIS I C1Jl1IfI 111 111 III' 111 111111 111111g's IIUI'I112lI 1111-1'1-. A111 1111-1' 11'1-1'1-, 1'111' 215 ,'111111 GIS I g'111 .11 1111 111111s1- 21 11'1-II-1111111111 1'11i1'1- . 1i1I: 1i1111- 11111 11'1-1'1- !'1'11II1Q' 1 1111-. 1111 11111111 111 1111- 1111 'lII11 C111 1- 01 1 111111 111 1'1s1 21 1'1-1-11. POI-1.1 1'ON'1'I'fS'I' 1111- W11111-111's S111111' 1111111 III 111'1I1-1' 111 111-11-11111 111111-rs 111-51111-s 1111113 'III 1111 1111'1-1111 1111'1-1- 111'iz1-s 1'111' tIIl' 111-x1 111'ig'i1121I 11111-111s 1111111 1111- II1g'11 Sf.II1711I 1 . 111 U11 . 11-11 215. 1111-1' g'211'1- 2111 1-1111-1'1'1111111h' 111'11g-1'-1111 III - . ' lII1l 111 IBI1'-'1'Il11'1I 1111- 11 Z1'.'. N1-11 1111111111011 111111 1'i1-S1 111'iz1- 111' 1111'1-1- I I1'lI'b 1 -111 1711-1121 II11s1'i11.', .'1-1' I 111'iZ1- 111' 1111 11 I1'lI'S, 211111 1,1-1111 11111, 1111111 1111 111' 11111- 11111I'11'. '111 III-I .- .IAN N1-11 1' 11111 I1 12 1'1-.' 21 1111 111- 1'11111'21.J1'. Witl 1 -11-1'111111211i1111 21112112 1'21'- 1s-'-' 1-1101-, 'I'11 '11'11 ' 11 '-1-I ' 1 '1, I1 1'11'1-s 21 1111 111' 1' II' :XIII '- 1' ' '- ' 11-11. 'I'11 u '111-2 I - Q - I W1 - 1'1-'1'1- 121111-11 'IIIII 121111-11 2ly1'211II, W 1 11s1 111- 1-1'1-1' 11'i1I111g' 19111' 211I1'1C1- 1'1'11111 I so 'I '1111'. W111 2 s1' Q'-1'. ' s1'1111 -1'1'11'1 'I'11 11'111'11 'lIIfI 1111- '11111 .4 '1111'. 71111211 111111-1's IIIQU' 111'111'i1 111'1I11- 2 1' '- .'111111'. '111L1'X1Il1 1111 1926 ,......f' X .1111 111111 1111-. 1 111 111.1111 1111 1 111 Il 111111, but xt 11 .xx lost to 111.111 11 11 N 1 111.11 1 . 1 111 IS so . 1111111 N 1111 111s1 11.1s 1111 hx so . 1 lk ll 1s 1 1 111111-t11 111t 111101 11 11, 1 111111111111 of t111 8.111111 N 11101111 t11.1t 1111 llx 11.11 N 11-1 A1111 t1111 11.11111-1 .111 111 11111te, 11 11111 1 H11 11 111 11.111 11 1 1111 111111 .111 1111111111 XX1111 11111111ets 111 111111 11 1111 xt 1.1111 .11111v1 gave t111111 to 1111 111111 to 11111 11x 1 111111111s 1111 11x.1s of 11u1s XX1 11.1111 11111 I1 1.111111 .11111 1011 11111111 1111 .ue t1111- 1111111111 . 1, 1 1 O I1 X x 16011 H111 O F111.1s 111 10u1 1111011 111 11111ds X1111 111 11c111111d 111.1111 x sc1 111, 01 111111.111s 1111 t11111 c111111111 steeds XX 1111 111111111 111u1 v.1l1e1x cle-.111 U I11x.1s 1.emem1111 the -XL11110 XX1th L111c111tt 1111111e, 111111 11IOXXI1, 1.11men11111 111111 t11111 111111111 11111 111111 1111111 t11.1t 11131111 010111111 0 F1-1.11 XXl1.11 111111 sons of tml 11111 111.11t11 11111 1111 .1111 1 X111111 XXlt'St1tf1 fox t111 111111113 111 Y1111 111 111111 111111 SXXQIX .md f11l 1 11x11 XX1111 111111 1Jl1,.l11 1111111 1111s 11111 511111111 .11111 f1111t111 11.1111 11- .111 11 111 1111111 11111111 X 11'1 111111111 1111 11111 111. 1111 A A . r w Q qi,-,' Alt , , 'I' 111 .' A S C- 9 1 2 ,'1'i1l1.' 111 ' -' 111 -1 ' Q '. 1t11111' 1'v1-1' 111111 it. lt iQ 11111'1- i1 ' ' Q 11 1111. 19111' 11'111-1'1- 'll't t1111 191 1'11 Q 1-'l1I'.f S11 ' ' Q1 Q t Q11' Q f-1i '. '1'1 1 1 -11: 11 'z ' +1 11 ' X 1' 1'11 '1'1 1 1 tj of 11' '1 '- s t111 1.ig'11t. V w 5 ' 1 . u 1 5 v n l v' 1 ' l . . , T11 ' ' 11' 1 +- j . '1'l'll1X' this is ax 1111111 of s1111s111111f 111111 1'11111'111's, 'l'1 ,1 Q 1 Q ', . 1 , .' 1 lv - v v 1 - - , 011, XX'lI Tt'X'l.' 111111' 11'11 11v11 joul -IX.-XS X . ' xl 1 K1 ' t. . f ' X S, ' ' ' ' f ' ' 1 Q 2 1 ' '. 1 x' . . 1 1 1 b., -1 1 1. A . I Y . , L 1 ,' , 1 . . 1 , . , ,' . ' ' . 7 . 5.2 . x h. . . X' ' ' -' 2 ' '1 ' 1 1 11 ' f., , . , ,J L,f'l v K. , ' L- '. lv 1 1 ' 0 'I' fi Q j ' P t Q1' X' . - . . . ' ' I I. ' ' 'l'1 1'1 1 f :111 11' Q ' - - 111-s .11 1 ' j '1' . - WWWZZWM-Illrt ly iwlrlllrttrrt W f2f,s,f,, if, 'bfi-s..ff. ,sffr-0 4 X f' 'V' 'fl ,I WW ,Zz S COI ONIAI DAMF THI Ml- Iach star the Colonial Dames offer a prize of ten dollars rn gold for tlrt best essax on some aubject relative to American hrstors Maxme hrrffrn s theme was the unanimous selectron of the Judgea III II I' QIRLQ OF LUN! AGO By 'Nlayme brrftrn Sarah and Jane were spendrng the week with their grandmother Vkhen they rkened the rnrng of e vs to trnd tha It was ratn g the were ehsrppornted In order to pass the ttnre awav they went up to the garret anti be gan rurnr lllt., through the things there In an out otthe way eorned under rafters threk wrtlr dust and tangled tobwebs lllet came across an old horseharr trunk Full of eurrosrty they settled the mse Ixes on th tloor before rt and began to tm estrgate ll It nrust hate been great grandmothers trunk' exolarmed Qarah as they pushed the w obblx cot er and began to poke eagerly ln its dusty depths I know rt was for look at the band box with the quarnt latender poke btnnet rn rt See rt has .lane Adams her aampler wrrtten on rt sard Jane On further exploration they found a bunelle of old letters tre d wrth prnk rtbbon ft queer old spellrng book a box of old pre-tures and last of all a short warsted short al exe-tl muslrn gown sprrgged with tlny taded lavender blossoms rah and Jane tired on the bonnet and tried rn tain to get th rr I rn lrpper let s go and ask grandmother to tell us about these de ar funny thtngs suggested J rne so satherrng the spoils tn therr arms they trooped down the st trrs to lrnd th Ir 21 rndrnotlrer t r wa tour great ranemotherss dress e sud swer t que tron Tell u what the I ttle girls did when your mother was a Irttle girl l r tndrrrother t-tl Narah the wo tte- eree a out here air ard serret ea ery o ste of long ago Ier ur a randmother was rlrttl grr r ere rr tl ux es tor two rate now ln New I-ngland the little mards were brought up ury strretly r I rrr anl wo Idl g rt ho pun lrock wrth whrte kerthrefs folded modestly at therr throets I e wrth a whrte border to tote-r awaw from sight their hair It th Irttle Puritan girls hare bobbed halt t r Indmother' ts ee t r me were gre-atlw dreaded lhe little Puritan girls dressed lane lronr under the-rr cap and hanging down their backs but when thu ll the glos 'I brards were corled aw ay out of sight lhe educat on of the Puritan gtrls rn book Iearnrrrg was stdlw ne gleete el lhough her brother trooped oil to school exe ry rnornlng she u urlly r lllllllt I rrt Irome Nllll r mother and got what rnstructrons shs tould trom he w a t at was deemed neeessarw tor a glrl to know ard she uld r eleom I I more than write he-r name 'J I andmother hat drd the sarah be t Itnre x ounr. r tt e rerrellng tene writ 1 ll! 0 1 ll! sllelllt dear ust e-eause tru ew I-ngland plated all dat nore for I shed rousewlte torld I I Iul rex run and wow ant aked and :re wee e I knit nrost all t e- L othes ant rouse rold Ilne rr w r r I I x I wulle I the grrl did their Iart ot re we e w en we Ie-e-I when ther we-re so rrral t rat trey rat to st Int on rr ml t I lr Iund the arn 4 If t e t -4 men nu s el rn wearing edspreads lrr s I IX u r s pinning and wearing and wing wt e 'url ma den Ie drppe-el candle le I rurtu e 'llll rrdpl wa a wonder u eo Ie e e llrttrrlesgls it s w her s th r rn tle k elen a ming raise lls llltg pturrp I wlllfllllp. ttrke I ther nexer sard at I e yor w Illt ess ot het puele ll re- p e tee Ie I w P I J' Il y Ill I 4 t e I I nearlt so rnanw prrtrlege ll rrrre s s I are lult U fl ZX' aan .,.,,-.,w.M .,,, W,W,.,I.,......,,..........,.,,.-.-, M WW M fm f Ll. Q ,LEM ,,, 9 ,gm- ,H I ,I-V-' aging '3 - 5,-kf.Nff,ff',g g.ZM':-or, ,W :..,1fis,'5f , ,, ...W-..f..-km...-.WS-.-I-0-.-..IM,-4-:TW-Ziggzzimjlr5:51:53ff qw, I ,553-,gggggggng:7g3',gg5g3ggg3g,1,,3g:::'1:1 ,.., L'..l4L,...W., -IIIZLL-'L efgeW.s..,....mW A X 4 It ,,f,,,. ,.f,,,MV I I Q I I LJ ---f ,,.,,, ,,,,, , ,M fu ,AMI '- I: I ,ri ..--,,I-,e any ,,eu 5 W u, , ,u -- IA l5lf!Il'Y'-JSKZN... 5 fi . . A 'J J A 'I '4 A , . . . I L. he , . . . . . . I , S xx., v A. A e ' - ' .' ' - v. , v Q . I : I . : . ' aw: ' - - see-ond mo ' ' th -ir i.'it , ' t .' ' in , y '- ' - ' lg' 7 ' R I ' A' xtn. ullhl yvsr . , ' . I., . - I . , 1' , ' . , , . . ,- 3 I ' ' ' f . , ' I I 1- . 1 I L., . . -Y e ' I I I ' ' A-. ' I In I . ,.. t. ' . , , ... ' A M ' . ' v C Sa - ' ' - - ' ' ' '- e- 'e-e-t ' to tht- vt' s ' - s. - I 1' f - I -1 I- I - ' 1- - rr.-I I . . -' 'Ye-S. h's ' S .' -H' I ' sh az' in any to he-ir' - be-gg F . So - t ' ll I girls gath - -I ' b ' -h' 'r list - -I -' g-'l,' t he-r' .r try If VCI 1 yo ' gre- t-g ' I -' rt ' e- f' 'I sl e- l'I 'I have- re- I :uri ,' 1 ' l - '. .' 'I ' ' - ' .' 'art t'ar'ty ' ' ' ' ' ss ' 5 - - . ' - ' ' .' - in 'rag me-- . s s ' ' - ' - ' .' ' ' I .' nne at littl- gray e-up , -' 1 - ' . . I -I v .-' , A ,' . I ' .H ,Ii lil -' ' - I1 -. f Uh, no! VVhiIe they were small they wore- the-ir' hair' In two smoothe- braids t-timing 7: li Iles 5 ' ' - ' . Q ---- .,l -. - l . - Sz -. ,, . ,U -- 0, ' - s ' .- - ss e- z' -t - ' ' he- ' ' .'.' -5 All l-'- ' I ing , as 'Il h' .' - ' ' ' ' ', I .' - e-o te-'y s- I le 2,3 I ut. Ir' w' - ' - little- Puritarr girls do all I ,' I ngZ ' 1 ' -Il My -' '. j .' b I dieIn't go to se-hool is no sign llrut tlre- little- girls ot ' N I ' ' A r '- arf- rrrlI.' - I .' - ' '- - r hrtrlly te- rnel TI Q sr ' '- ' I b' - ' I '- -I, and wash -el end ' te-el. AI .' ' h -I -.i ' I I .4 -I - I- 1- spun tnl r tr I-rr hy th- I-rr ' ard 5 ' 1' ' ' tl - 'Ir'k. 'l'h-y 'e-re taught to spin on the- gr- t Iol I wI ' ,' ' '- .' I4 ' l I' I - I' I UI I fe s otl Io re-tte'Ir ll 'l'I -3 ' wt , - y' ' on th- eflr :le re-e-I, ani easily tille-el th- ruiIl. with we I- ,- 'rrp A us 1 ' ' ' b- .' '-' I' 'IJ el' 1-o lei vt-ry ofle-I Jltlll. QA But rs ' ' ' ' - se- ' -r'e- not th- only tresks ot' the- I 'llltll C 'i , SI ' -' -If in tr- spring and rnarele- sour In llle' rrrn. 'I'h- I teen 1' '. ' P ' ' - 'I' I ' o , 'l'Ir- wt--k Iwtore- .' I g .'u -' hu.-ily llvlltlllp-1 he-l' V rno e' ' r itfr 'tt I -- t-rrtt' I up Ielna unl .' ' t -rs. Ile-r' rr o ' ' ' .'I,e-' 'e- that al Ill -, e-hlld, ' r ill Ike- re nr I e I' Igf' Q' 'l'I little girl was e-xp:-e-te-el to Itnow how to Imlte- Ie-5 ttnl rrral - lllll --rue-eel tth -,, the b st ol I -rn. A Il nr 7 l'u :rn girls nrt'Ir ol I -r llmn you tw I girls IlIeln't luxe- '5 - ' 5 .- - ,' -' - -s as you lr 'l'IrI- lele-rr ot sitte-I-II wet. lolel that ph- 'must f not pr unt ,' in the- prt-sefrII-I- ul he-r e-Iele-rs' I re-reel this rn It hook ot llldllllvlh lerl 3. little- nraitlf rr -- . ,l'f':l Z QR' -.fr -,. - . I as f . ' . - I ' I f ' - I ' - ' I I , . , , .,,,.,,,, ,,,, ...............,., , .-a..,.,,a ,-.,.. .,.......aW,. . . Tin I.,txtui1tun W M 1926 .1 v X lit . s e s . e y . te sntuge 1 o s e l Now w 1 t s 1.1 s w e t. lx gi you nnun iooe . . te . . x was t g ne 1 nsvlf in the ne x tllllll 1 . e e t s gt s ' . l P 1 l I1 NS Sd K AUP 1 e l'l 1 .111 e s e e s . tte llll ' e oe nt e ns 't s .se N re ie . N uii tin ni el unhlee ie Puiit.-in malt s ie was stle tl 1 . e . 1 f . e . . 1 , 1 , s s e . g 1 s e ' 1 4 st lt t f I wexei . . . 1 in .ine tieitiin ytdSlll1' N ie e 1 . wus ust. n' is el e nnxuie of me n ist .tne u t 1 w .ts N tote-n ie n N . n w. 1 1 r N 1 e louse ie 4 . . .1 nepfne-t ie-.ie .is . ' tie 1 o o sc e e e nnee . e . e . e e on N iei spinning: fine we .ui 1 e mo mei ni ee y N e . et i lent n .ti Stl gh ie e 1 e oo nei t N elft VH e ey Ussl ut L1-A FQ s sv XXL lc Je ni.ie e into 1 oc eee slot lein fs 1 1. e . ie . Je nnsxleftnift S es was nought up wit 1 .1 lt ii dll ii et nioie you se e e . 1 s t .uloint tl to et onnet e .1 eet . . se .intl foi ite e- e-tuuttton 1 e- u. et ni. s pet taps bette-i . 1 . w n f . it oi e w ins e-ie .ini fi s .ie e 1 4 N x c 1 N 1 fl e in P .ii w . . . . ee w . .int 1 it-be-lho li dit longe-el tot gn tibhons .incl rltl y tie-sse-s y 1 N ni. ie f . GPN 1 t e N .ine wonm 1 fine niothei t it niy 'ltd ' - e t- w .isnt I' Il . r dll N ts eee s.u.ti i f e-dt gi ine niothei tie t . ie N e e e outh he- w as born on .i . fe- e in .1 ion w tile e e- we es woile nle he x as only e N . N N e .it t 1 s inet N19 would niee e s st t e- . t it me 'iarious mothe-1 ftppe ue el t gie-w u 1 to ie eu ies o e hos e-ss wi 1 nntnne is .es -wee .ine unconsfious .is .ins otly e ms ee . f t .is lil e e ein f u :on ns .ti e e.tn ti ion e .is . . e ' e ti A e Syytt-I ds ft flowei S e- w as rlffllNl0IHl1 to ie e eo e ne gio ni.unn . e yhise-ye ntee y s int f e-a teena nio ni .ine o ni we i ht use wite N l N s. vt e w 1 e J N e- iel supeiinte ne te se , N I io seivtn N with wont s-i u t 1114 Ji te ei fs y io lflll i Item in t e- mouse- e N ,iste sua w i e i an mug t .tnnly nr-in ' .mel e.ty in u ton fe tu.iin or in n . e le .mio f 1 toni 1 hme N s she glow e . o e . e f tu lhe- yt-ge td e gait e n . t ee fied we-t it e-n we te in iei t ia ne ei he-1 niothe-1 s guielei e s louse ie ie mee ie N in vase- of sic lene s .ine iow o ust- e-ni ur 1 1 gut en .1 1 w as with its -.tiff box he-tlges Ant its quttin fe tot e rr is e . n ' . s e 11e.is Jonqi . t y it fu N . s N . o fe iei i - miie nty N dl blutle oy y ng at iei it N 1 ft et t N .tim . ct N igiei x . x mornin- .e iei tlot 1 I H S to Ill! xllllllllg UNK 00x tit' xllll ls 'shllll ' W t l 0 I 1 AIN If Z I f 1, 1 1 M iw f W f ff 1 1 fwffwm if fffmwwwffxwwmawmafwxf In 1 W fm AH! lv Wm: -V ff ' tv, A 4, ,. ,V,7,,. , N. , ,.,z 1 ,,7,,,,,. V, ,,,,V .,,, . :hi 4 , t ' - if .,. ffnf -fi-ff--f--lm. r ,f ,V A , ,,,. ,, ,.,. N,,...... ,,,,,,, , - ,roy , .W ,,,A ,, W W' ty --tzttklt . X -llllili t' 1 gy V 1 H ,, M ,,,, gg W, Q X' -n wnyone- s1ee-:iles to th -e-. :t'tnl. Szej not, 'l haue- not he-'ir it he-fore-. Ne- ' -r e-nele-uxoi to lie-lla thine- t-lele-r out if ln- te-ll it not riuht. .' ', n tg ne-re-r qut-.'tion I th- trith of it.' V 5 . ho wot lel y'ou lilee- to liu- up to those- rtle-. f 'l'l ' t'.' 'hy th- little- 'ir ,- e-w ' to v' ing we 4 l I ele-uuire--e-yt-el 'tnel Silbvl'-llllll1lt'll, ye-t se-lf-re-li'tnt ztntl we-ll fitte-el to 1 11 he-lp the- e-art -st-e-ye-el l'urit'tn l'ui yho biilelin-' at hoi - ft r hit .' ' ' - -x 1-,yr e- ry. 1 'Z tbl, tDr'tnelniothe-r, lool' :et the-s- pit-t ire-sf 'l'he-.'e- little- rl: are-n't lurit'tns, tire- tl g th:-y? Se-- how qua- rly the-y 'ere- l---:ue-el, il .I' . E Ne, ne-ith -r of the-nr sire- lI'll'lIl ni l-nn. 'l'h- on- with the- wooele-n :hoe-s -intl wh' - e-up is tt It t-l girl. Sh- livs-el in ll All'n,y. Sh- t 'tx tziuglt to he- just 'e.' re-:1 -e-tful to he-r pa'-nts 'is the- l' t' ai . llut tl - ' i, ul - '- s Q , hu: - off to st-hool with he-r hrothe-rs, he-r nrtny pe-ttit-o-its slit-ling out 'tbout he-', gvx he-r wootle-n shoe-s going t'lzi1e-1-lzep, 'tnl he-r two fl'exe-n hrwiels blowing: out front uneie-r 4 he-- white- c-'11, 'is sh- hurrie-ti 'elon-' for fe--ir sh- niight he- l'ite- f mr : -l mol. Sh- le-'tr ie-el gtk, re-ry little-, ho ' -'-' , for only 't Slll'iIlf'l'lllg of re-wtling, wr't' g: ' l 1l fl 2 ght Q in ne-l mol. 'l'l1-gre-at troublt- l'ey in the- fat-I thut the- te-zu-he-r :relly l-I gl'.'h 'nel z '- 'l' l l-I g'l':l ' l lt t-l Sl l' . WI - the- :nrill Ilutc-h ltinele-rr-liv '-is le'Il or e-le-ve-n she- was rt-ntove-el front srhool 'tnei ht-t tnie- the- 't.'sist'ent to he-r niothe-r in th -l .' -l mlel. ,-I'-lt In the- niorning the- ltut -li niztitie-n '1rose- vt-ry e-'trly 'till 1 '- ' ' l b' 'l'f' JI 'intl got l - e-hiltl 'e-n fft .' -h mol. Sh- sl'ii i-l the- t-re-'ini from the- inill' 'lnel the-n t-hurne-tl th- htltle-r 'intl nrteit- ele-livious rhe- -st-. ljflfj e In the- afte-rno the- little- ltutc-h niziitle-n .'e-ttle-ei elown to l -' .' ' ' ' l ng lit wh'l- he-r tl -' k 'tt -l. Pre-se-ntl,' :he-, too, woull t'il'- up he-' ' 'tti g ' tel .' 'oll , throu tl - stiff little- gztrei -n to visit one- of the- ie-xt l r -'t1lihn .' 'ughte-rs. ' til- th g - l. the-ir b n -tile-.' ke-pt up the-ir llll'P.'. lllf clit-le-e-lirle for the- 'mol l'tel to 1. -1-' -l -l'-ls gs. 'l'h- othe-t' pirture- you l'u'-, .I'tt -, is th'tt of at little- Quulte-r girl who live-tl in fgfg l - .'h .' l ' ' l -ll tl - strit-tne-ss of the- Pu t' g' 'I or - 'e-n .Xs ,' f -- in the- pit-ture-, sh- wore- 'i plain elrzib r-olore-el gown, and he-r stiff, FTE' in' ' - 1 l' - b -. Sh- w' ll'-I to school sohe-rly 'enel with elownt-'ist e-ye-s, f'or noi.'- - frivolity we-re- strirtly ' 'b'lle-n, 'l'h l -' ' of the- l'ttl Q 'il' -r -eiei H7- wa,-, --l- - ' th'et th-et of the- Ne- ' l-I gl'tt l ' N- ' A st 'l' g'rl.'. 1' '-tl t-'ire- w'1.' tal'e-n to se-e'ure- ti e-onipe-te-nt te-'trhe-r. 'l'ht- little- Qirtke-re-su w'es I'llf.fllI to wall' ' th n' 'ro ' 1rtth, 'intl if the- w'iy we-rv s'ilt -1 'ith te-'irs ' i 2 ' ' us 'ttle- he-' ' ' ' 'z 1' .' ' 1 '- tj l' je-t it eliel not pre-ve-nt Ile- :lini 'title-n in l -r se-ve-rv gr'ty frot-lc with he-r ge-ntle- th - fr mni gre wing t' -ry :we-t-t ' l ' ' nly. ,iffy But, Cr' l rl -re- eliei 1' g'-' t-gr'intlnioth -r live-. Sh ' at u t-in fig or Ilutt-h or Quul' ' szirl f'or the-5' tlitln't we-ar elre-sse-s l,ke- thig one- we- have- of he-rs? UQ? sql' -i l. 2,-'ft No, you' gr ' - 'z l -' l'l not be-lon! tn 'tny of tl Sh- lit'-tl he-re- in th- S . S J ' - l'trg 1lz t' t' 'l th -r '-re- ne-Zro to elo all the- ' Wl' - s vm' ,' z t-hilel in he-r short-w'ii.'te-el niuslin frocl' ' ul 1ll'lilll sun- bot - xl ' --t visitors at th- front .-te-ps of the- houx- ani e-nt rt'tin l -ni '--Q 'tilll -r g Q -z '- . Sh- -' ' 1 tl - l t'-.' fe st tl ' A '--t ' l - .'-' .' ' jb Sh- t .' i-rote-el to he-r f'unily, 'intl he-r fzithe-r e'- ,' 't -t l g 1 l'.' l' 71- 1l' t' t' . Sh- w'.- 't ele-lit tte- sli1 of at girl as lz'nty :QL 'nl : '- ' ' Sh .' ' -- .' -l tl - le-' t -el mire- of he-r - ' ' iy 59.25 'ini 5 '-r surrou l-I by at ll'0lllI of elztrlte-y ge- ' nts. 12542 Ye-t your gr 't-11 l tl -' ' l tl -' little- gzirls of the- South '-'e- e-xt-e-lle-nt L It is true- she- eliel little- with ht-r tanelu :'ie'e- fine- ne- ll- 'o'l'. lut :li f-otl .' - I tl -hour -holtl 'tt-tivitit-g ofthe- ie-11' . '- . tg ' l 'f l -z 'l'l- il' ity, He-r e-ztrly e-tlu-:tin w'e.' se-t-ure-el with he-r hrothe-rs untle-r at tutor yl ' glt ,?,', l - ' h l .' . 'l'h- ,'f'll00lIll',' -r ur -llj l'r-el with the-n - tl ' ht mnly one- ill- f' lla ' g' 11' g 1 - 1 f ll ' strut e-nt 1--ille-tl the- spin -t wt---- ng K ht-r at 1el's -nts. .' - ' ' olel -r 'en th -r t ir- w'is aelele-tl to he-r l tie-s. ' - ' bl- 'l - 25' 'tnl tl ' A'-'t flo' 't:11'l plat-e-tl ' l 'l'l'Kt-. I' l-' ' ' ' 'nt-e- sh- lt-urns-el the he-rhs that we-rw use-ti as .'ini1tlt- l .' -l elel '- -l' ' .' ' ' ' -il 't :th .S-lt'z'l-'s't t f eltl-f' ::l' it-l xl: rip, Ye-ttoy e-t,w'e:l is hro'ifeht ove-r front li gl'tnel, uwe- -t -' ' iils ', ' 'ini hezlljl mc-lu, lil' 'end rose-,'. all r'tn riot t g-tl VVitl her sunbt -t on ne-r I-'l' ela' ' hr-ad anti a :nrl ' h I' follovi ' l -' l -e-I: with 4 b' sl' -t Jn his ' ' 'intl tt Il'i'I' tzf :he-airs, thz- elzu lt-' ff the- plant'ttion woulel go forth e-re-rj ' ' g -nel gall -' ' ve-rs. J Hut the-'e-, I iuxt ge-t j l' ' ' t '. My de-urs. l l'. l - ,' s ' 'ng. Tttk- those- and put tht-ni in the- trunk e'tti't-fillly, th -i sg o it in tht- y'irel ' l 1l'ey. 'T T ' T T M ' ' ..fg.-...,,..,,,,,, ..... . ,.,. . ,.,,.N,, ., ifQ.L.,,IITf'f,,,-,Z.LL....,...,,.... .,.,, .,,,,' , ,,,7 lI. fT'ffffff ' ' f'fM'T jf . Z,'f 'f'ff '1j'I:,l Wf? e 1 Q teif, Q ,, HUMOR AND ADVERTISING zfzffwwwaumf In lmnm up-ouganuwzv fffavaldf zwmwf'1ff'nny'f'nmmmfmmrWmznmnw1y1fmwf I 1 I L I 1 11 11111 II 1 I ffwnmmygf Amwfmw ww Mfmwvny 'fw 'vw W 'fu .J ,lg ff, ' wf. ff' 'ff fn I 1926 ,ZZ N 4 llIII I I ANN 1 Id!! I 4 N N I 4 IIC LI 4 Il x 4 IN IIII1 I 1 tot I , Qs I I I NN thu x INN It s tt II tx N N sopltotuott H ou ght to . . N Ill ' I N It I III . u . . N It u N IIIIIIOI xx If xhtuf tIt1J - tx Nttuutlt IN x tue Ima thump. .t I I I Iox , . I I I 1 N 1 I X I xou Itn te ne I I I III 1 tot to no NN xou Im xx hx N W xou stut w II If NN sou Itu It x sou tuoxx I tw xou fox I xou I I xou Ittt uhx N tt I 1 het . . mtht N 1 N ug ll .tt u.tI ut t tu Iitplo Nt 1 1 fu qw .tmth . ptouou Nuthat .t I I t I u -In II xx lw ptotlo I 1 lllltllld IOII IIIIII N I I Ilftttn tot I sou tuttl .t xtuuutftt x .1 Nts I .tu mot. Il two: xx N mu P1 I I me te ut fe- c mt for xx ttt SIIPII I o N I NIIIIIN II o nt A te ut I um no o te-1 Ihtu .tn oItI Iu1.,h xthool xtutit-nt whom II I tt .twututt NoIe n S. ole wot Hunt 1 I IIS - N 1 0 1 1 N. It 0 1 dm om f o I wou o tft Xou mm Imxe YOUI rhotcv ot tdlttug tt f xo f P me tx . . fr f to 1 N100-I wot I '- I s ffxdx X IIIRUII X tx I I . N I I rt IIII u X IIN XII .'.'.'- 4 o'w'f X fL-fl',f i fr3x'3 ',qx'f ., ',1'i f f13.,ffU 4' 1,lfh9Kfflflflf41' 167595111 'IWI'W0'N -50 G.'WWff W VWWKOVSWV 30l4fVf l3Q?75'L' Yfblal um ,, , , ,,,., Tw ,,,,,,. -.7f,,,f,,,,,,,,,,.,,-,,,V,,,-,, V, v , , - ' ff -, ff' v'f f f f , H ,fqfi f v 4 ff f , ' ' 'FI . ff '-' ' X ,, 1, .,.. Q 0 ,,,, , y ,,,,,, A , ,,,., I 9 ,M ,, ,, V, Q 'a , .f 0 V-. ,, , M ,, . . 0 , .xl . I f,j,r:1:g,,,h,.1: ,,,,, --r: ,.,., ...,..,,., -of ff Af. gg. qi 1 I ,..-W.m-,...,-..-.,........ .,., m- ,,.., W..,- ,,,.,,,, N,,,,.,m,,-,,.,,,-,. ,,,. . QM! cf ,, ,,,,,,,,., ,,,,, . ,,,,,,,.,..,, . ,. . ,E 9 fn ,f III It 1111, ff-I , QI 'fig It I.toIt'I'w- mi ,M 2-I' , - V - , -I -ft! Il, NIV. S1 I-'S Iiu Vixit-s I-I' .HI III-orszv 'tttti I t-xx' I' '- tztk -tt tht- III'I'II'III'lIIX1- ride- I II' tht- que-stiou, umx ultztt otht-r no ::it'Is xxIII t-tIu- tht- --:III -, ,rg ff IQ ' I i Y W' .iuxt 1' I-1-1-sIttt1atlt IIo you Iuou 'IRIN-11 you 't11tI I wort- St-Yt'IlTI-I-IIN? I0 Ift' :I 'tu Nu I II2lXI'Il'I tw-:tt-Its-II tI1'tt ctw- yt-I. In It I II I Alt: II: I'-' 'I'1-univ III-II, IIIII you Inou that you had 21 tirutu in your 1--tr? ' 'I'--ltttiv III-II Y sir? Alr. IIItI 1' W -I is it at sttztrt- tlruut or at Im:t.'.' ' m'. ' I ' I, 'I't-:.ttIt- II -II 1 tIou't Iuoxx hut I think it is :t Iztp: I 'tmtf' V ' . II - , f I Y -'I' it '-- XVI I ge-I twiw- :tx mu:-h sl:-I-p :tp you tio. , Il U '- ' ou , you Imw- Iuitw- :ts m-my I-I-tspe-s :ts I tio. I-Ipplv III-y Miss Lu -' Ie-, :,ix'- tm- txxo bitp worth ot' tI1i1'Iy-t'Ivt- I-I-ut Iir-I' -ts, . 1 f ' fy! Hl':I.fllI Ft' -HI I'lII Yo I1'tvI- :I b't.'I' -I hull o.-I-. N. . ' ' - Ho ' t'omt-T Itright F--.' -tu II IbIf-.'. . XI .' Iio,'. It-II - sz - ' -b aut 'IIt- IIztx'1-I not I ,'. I fix, Iloy Alt, ht- tiiIIu't h'tvt- -my shoe-S ou. tIi4I he-'? I ' -,It ht' ' I. -III wtt ' s't't'm' I 'I'h- mor- yol .'t 11,3 th- mort- j ' ow 'I'I - mt '- you I'uox', th- ore- yot ' 'gt-I ,I 'I'I mt '- you form-I. tho- It-.1 -' ' ou -ft So ' b' xtutly? 'I'h:- It-Q: ,' .' Ig, It- ,' ' ow .jjj 'I'I - It-ss j I' ', th- j -gt-I 'I'I I- It-sg -' fort: -I, tht- tut tw- h' ' ou' ,'g So ' .' :I lif? RI --H - I.ittIt- Boy XIII whit is that tramp tioimz with th-tt pit-r-v ot' wrztppittg: pzttlt-r'. ' , XII -V .'h not st Iouti, thztt if at I 'fh st-I vol gt-' I 'I - 'II I ' mat. I. gl: -f ga If-o Ito Mt: .'1tI4-'I- MII I I-an .' II - ,' iug I I-'tu ' ut-I-, ' CII Mt- .' --I uti --wit, tt- .4 - 'PI IA-o I I-:tn't ' uuw- th'tt. I-I I U, f- ' - I v I , ,I G' tIIII l.I'I's Irtvo-1 - -I ' 'ILL , ,I - - I 3 U1 ,A 4 . mia X Vg I' v- I, 1 8- ' I I tv .fy I't-' t.-'- I hat 'I-u't - y I I ffff - It I 'I . . . . ,. . I VII 'I'ht- tv ' nf-.-.' ' 'as I I I ut b -I ' II - J IL , -I ' 'L I ' I .' -I ng. I h1.' IE: I -I' u I th't tI - j Ig- tI .' z ' .' ' I - ff haul I'ztiI1-II. 'l'It- ,I 1 im- -I at .' - tu mr. l ll 3:2 up K-A1311 --Pr ' Q' ' I, II' is a wry .-I-'I us t-I1'u'p:- but for tht- .'-1I'- I' tho 7' I III st-I1:oI I ' gi ' I. I I -I ,' ft' 1.2-11133 Y '.' ' ' .' ' ' l' 1 ' 'I TI ' if .ff qufg, D 11 I:-lx' - I 't- ye-'urs -13.4 ol' LII on tht- ' I-Ii IIII-. ' S Q ,jili I'1'4.I't-.'.' ' I'II Ittkl- th- It'II yt-:ttf on Ih+- rot-It lilf-. --.I Un f 5, ' .I Cltztrlff- - I I-:tt1't smoke- hf'I.Ul'l' bl' -'tI'I E3 XI I ui-'.' VI, ? Hg I'IturlIe- f'I In-vt-r gt-t up iu im:-, It RL ,' It W - f-'I 'I'h - I'-III-.-I hooI' writtt-u 's -III:-II -Ih It ls at vt-xg' t-rt-v Q .- Wy. :ma I , ,':2 I I kf 2 lf'IT fiM.g?,fSiffQ,iETf 7i?7 'ff M:9 mf1f5Mf5M 4395312 75? ,LQ Aff 23515 I 11 Il 1 11111111 X111 XIIIL 1926 1 N1 IxX1 1 I 'X '111111 -111111 X1 131111, 1'11- '1 111- 11111. 1' '111-1-1.1 - '111- I111I11I1,H 11111::1- 11 XX'1111 111-1 II11' 1111111 I1Il11 . 1 III11 11111111 :11 11111115 15111 1-11-1111-11 S1 1111111111-111111 X11111f1-11. 111111 111 11111 1 1111 11111r1 'M 111111-1 1111.I'1111111-1111:.111X11111:1 1 1 -X I1'11-1:11 'I'I11f I1'- 1- I1l11I11I1l, I 111-1-1::111111I11-1 111111 111 11111111- 11 11111111 X1 11114 I-111-1111151111111 I111:11I11:111y'11111:1.'11111z111X111i11:111:11 1111- 1-I1-1'11'111lX 111 I 11'1:11-1- 1.151-1111111 1111. II11 III1I1 11.15 1111 111'1IX 111111' 1'11111111- 1111-11 21 111111111- 111 E1 1112111 III 111-1' 1114111125 111111-11111111 :11111 11111-11 I11 111 1 11111- 1111 11111111 1111 111-11'1-11-x1'I11I1111-111 XIX 1111111 1- 1I1'11'1'l1'11. X11- 8111111111-1+ I:Ilj. 111111- 21 11-111-11 111 1111- 111-:1-11:11'11f11111: 11 31111 IIIXW 1111111 1111-1111-1'111--1111111-1f115. 1111 If 1111- I11'u1f11':11 I1 :1-11111-111:111 XI1- 811111.11--1f 'AX1--11111 I I1111111111111i11111'1'. 1I1EIl 111 Ir11X 1'j I-'1IXIf I1'1I1X I1IIlI1 'I'111-1'1-1'1111-x11XX111f1-111111111--11111-111111-111 1'1111--11111113 11 11111- I2-11 'AXW--. I 11111121111-51111 111111111 -'1: 1-111.-1.111115 11 51111 111-11 111 11 X11 I121I11'I' X'11:1111111. 1111111 2I1 ' 31111 111111 I'I,-1111- I11lIl111?1! 111' XIIQIIIIZI II111 111111111111 1111111- I111111- X111I 11 111111--11 11111 1111--X I1'11-1111 1111111111 5111 N1111'1 111 1-111111- 111111.11 -11111: 11111-1' 1'I13f111f 111111 1111111111 1111 11 11111, 1,ll'1'5 I'1I1'112l II11X1 11111 51111 u1'1 11111111 111-1'1 511 111111'I1Q ' X111'X I1111I11'1 u111111 X11 1211111-1111NI11111'1111'11I11115111111-.111:111111-1'1:111i15 '11'1111s1111-1 1111- 11111 111111 III 11 III 111 111- 11I11'f111 1111- 111-I1If' X111111111- 11I1. I 1111-151 1111111111: 111 1115 1.11-1-'A 'IIIIQ ES XX'1-1 XX'XN'1' '111 1XX' 1 11111 XI1111111 1'11:11111 I':11'11111f1- 111 1'1lI1I1II1L' :111 111111-111--111111-111 III 1111 NlIIII1I1X I 11I11I1! I'1151 .' ' XVI, 11111 14I1illI1'1'I 1-11-1' 111111- 111- 11111111111-ix 1111111111-110 I S11 11111 111111111111 111- 111-111 1111:1X I1'4lI11 1111- 1Il1111',.I 1 XX'11f 1111- I11'11-f 1':11I 111 'I'1-11115f1111's I1I1I'21IX'-11j'S 11111 111111,-I11-11 1 11111 11-f:11' XY11111- 111111- :111 1-11.':1'::111I11111'.' 11 X111 .X1I1I1s1111 :11111 S11-1-Iv I:11111111- I111' 1111-11 1111111111 1I11111f'.' 1 1111- Ii1111111:1-11-1 I1il'I 1111- :11- 1-111111111111 111 11x 1111- 1111111 111:11 11111111 X11 1111111-1 :1-11-11 1i1-111:1- :1 11111'f111111 :11111 111- 1-1111I1I11'1 11115111-1 11, XI1 1111111-1 H111-111':1-, 111111- 51111 f1111I11-11 111111' I1-fN1111 1' 1,1111'g1- I 11111111-11 1111-1 1I, I 1115 II1- 1111-:111f 111- 1111-111111111-11 111 111-111 1111-111: 11111411-111 1'I5111A 11111111-1, I 11111 EI +111111-111.' 1111111-1' I:111111111111' 1- 1111 1'x1'11.-1- I1:11'I11-1' 'I'11111111X', I121I1I1' SIIIIII' 1II1I1!F 111-1-1151115 1111 11111, I 11111115' I'I1 I1:11'I11-1' 1'1111111'1. 1141111 11:11111- :1 11.1111 1'111I1 Y'-III1 1211: 1111111111 Ii111. 1-1' 2' A !11111I 4' x N 1 'NX r- 1 152 x 1 X 1 1 1 1, I xq 1 '1.11,1.fx.11 111111111 KXUXX 111111-'1111 1' 111151-1111 1111111'11111I111' '11:1151111,11. 111.1111l11' 111' 111111111111 '11:11 11 1111 11111 1111111111.1- 11. 1111- 55111111 1111 1111 11.1-I ' 'I1:11 111 1Nl1l:1 w111'11,111:.11 1111119111 :1 111111 1 1- .11 11.1 1111 ' :1' '111 1111. 1'1I,1,,14,.1111-11 '11211. 1 1111 '11:11 1.11 :11:1T111 1.'l1'- 111111: ::115 115.1111 1.1 1 11 f-1 .211 :1' 11- 1.11.- 11.1f.1111.111:11i 1111111 'T11.4'1111f11 111111111 ':.:1' '111 1111-11 1: 11..' 1:1 91111111--1:1 .'1:1111: - .1'111111' 311 :1.1.1:11111.111111111 111,11 111111' 11'1 ,11151111111'.11--11111511111111-1111 11:.1 11115 XX'11.11 111111151111 1111-11 111111111 :1l1 1111 X111l1111'1 12115 X111:1111111: 1 ,1:-' 12115 1XX'111111:1'11 5111 111111 5111111111 1111 1111 11..5 '11115-1. 21-1111111 2:15 12111-1111 1111111 I111511- 11' 111111,'-1:11111 111111-'11111j.111111t1 ,1- 111 111 5111 ,11I1g '1111115 1111 :1111Qg,1,, ' 11- 'N1 1 1.:111:.'1 1111111115 -1--1111111111-1151-111 111 N1:111111'1- 1111-1 111- :111 11'1- 1111-:1111 1'11111-. 1111 1- '.11'1:. -F1411-1'111 11.1,.'H 1 '1:11 1 .1'11-111' ' 1 I-'111 I1 XX'I11111 11:1x1- 51111 111-1-11 1 4.13111 '1'11 11'ilX 11,1. 1'11'11'1I S1-1- :11.51111115 1111g111 '11.11-111 11:111:111-- H X11 11:11 2 1 111.11 11:1-'1 :111..11,11111111E11-111 1111 11111 -111 11111111 12:15 111 11111-1 11J1'11'11i111211111-1111111211 1111111 1-'1- -111111.11 XX'11:11 6111511111111 1111 11:1---11.11 511111 'X11I1 511111: 11:111 51111 111, 11111-1-:11'1'. f11111l 111111 1 1-'1-1N11111:111 'AN1-f, 5-1- S111-11 XV 11 111111 I1511111111:11.-.H 111151-- 1:1111-2 115111: 111 11-111 :1 1-:11' 1111 :1 1111111111 111111 111 151 111 5 I11I 1-11 1 11- 11:15 .'i1k.11'11.1I1 1- 11 111111 211 51:1:11-11 11l11'11 11 1111' 11111 11115 11 H1111 N1:1111111:1 '1'111'1 :11- 51111 111111f.l 111:11 1'111x' X1:1111111:1 U11-11 -1 1111 111 111-1 111111:111:1:1-. f1111. .'11: 11'111I1I'1I1I111111X11'1111211115 512111211 1111111 1 NIC 11,51 X11',17:1111l ,X1 111'11f 111115--11111211111 .11I11 1 1111 111111 111 X1 111 11111 N1-I, 1' 1,51 511, 1111111111 .I11:11111:1, 11111-1'1- 11111 I -115' 111'1'1'X 1-111111 1111-11115' .l11:11111:1 M111 1111151 1111-I 111-11111 '1111-1 x5',l11-111, 11-11111111-1111 111- 11:11':1115 1111 1111- 111111111 X11 N-111111111 1 I111 111111 1111 1'1z:111-5 11111111 11:111 11? 111- 111111111 S 111111 1111 1111111111 'W-'N-env' -' 5,-we uw... -wsvfzr 6 LVM IM W' If 'ff W f ' T12 I.,Lx11u1Iun ' ' 1926 I N mm 1.1! 1 01 1 In ltls lIIlI xt .X 4 ' I. Ill xc A X N Illtrl ,I l , es NJN 4 Q Y I N INN I N c INN K N NN mu I N ' .u Nc NN XIINN ' Y 1 N 1 II . I AINIQ I 1 1 x IJ I II N wx I . w I OXIIILII Nunn: I jllxl Il A iuxlns S- N AIIALQI I 1 N hx U 1 N I .ls 4 . I ' . I x :dh 4 1 . .mu J 1 x , N . , N I g 1 I NN E 4 ' x I I Ns num K . It . , pl mn If . . It I lv Inu mungx I u .1 mg funn .1111 X II ILIIIIAI f I lun N unix xx I0 .1 Inns gm oc dw on nm uhi be un f 1 wo I I NIAWIIII N . . N I I ,, 1 . tum +1 . '1 1 N mmlx N xuh me con ex I I N NIH QIIQ d xlIIL 0 N II ldl l 0 1 1 I3 Ill Illld OX PI NN I I 0 IOII Il .IN .1201 Ill . hu I .mn 11.11 ff AIIIIOIIIITIIIE le Illfflllt N ION 1. IIIIIIIIIN1 Hllls Q I ll IAIIIQ UII 1 1 1 IIZIIIIA 10 XIIOIQ I KX I K 1 x g-,1x1 qgll I ul 1 xI6x lv he I AIII f ff . I. HIILIII xtumhut '11 lm ue . , lv 4 .im .ms NUIIIP til JI und apus INN AIIINOII Idl X5 AN It OI UI! N 1 N 1 lIll4 III 1 1 W0 xx Ol ' N N - 1 IIIVNIIN sn 5. 1 . nu 1 1.111 1.115111 . I .1 My f ,, 'buf V 1 an 1 M fvwwx ff 1mw1w4 1,www4 if f wwf 4 1 wwf f If 1354. , 1 ' ,, . Wi, mn N., ffl' -r' ,. A. Q.. ,M by I s ' if 'f 'ff 'fw,f-w,- f w vw I .wa wx V : 54, - mmm, ,f,f'Q I ' 'xi , K , ,, I 4-xxx EIN -'Hur I I I , I ,I ' 'I , I ' I - . ' - ' .' -v- ' 2 , ,RI ' 'XI I ' 2lI'Q' pm aimng I ' 2 mg, A . III I- nh A'I:l'1'i 'lluf' . , , Ln, I II' , 1 I H ' NIV, IN-I I 1.', t'XIII'lIII xxhy you 2lI'4' Inn-. 5 ' Ifuy I haul In Le-I an I'1ir 4 I. I N ' V 511-, I'I-- 'l'h'I v.'I'll,'z' is not z --A1 Ia ble-. I., ,- 1 Ifzly XY -I, il uns I-ith:-1' lh'lI or pwy Rl aiullzu' fm' :I 1lu:'s Iim' -np:-. gf: I , , ' :ny you wr- not 'XYllI,'.' tht guy IIIJII wnwmk SNOW INDI NIH 1: XI IIII IIIuII. , 3 We U ICIGIVI' LI'I I'I.IC IWXIII Y 'If-XLICS - 3 . .. . V 1 . - . 6' I. NIT: I-I Iain- Un Intl ywu' LQIIIII 1-I: .'.'I I Illf IS the- Iwxl I.:xl III 4'Izx.'.' I Ilan- 'Hui 3 I vvwx' ' ght. I b'Ii+-vw I'II just start right mm uiih Q -. u'. eff ' ' l'Iz1.': No . Iimiuiiv. xu want to do all we- mm fm' jon. fix? 2, KI-4 1,-iv Us II+-rryl IIe- ' 'y, Iwre-'s Ihwl lI1i1'lyvI'ixw- f'v'IIIS I mu- yall. 'E I I II.-rrv Ke-A -, yul 1lm1'I h'uv to grip' ms- I IIllII'I he-wi il. lb' , , Q ' , . . . . V.. . I., 'Nas 32. 511: I 1- in II.'III Mwnag -1' or IhA I. 4' IIII III-rv 5 52,1111 ,- -ml x ,HV QU? dm 1 If-al In In-Ip put Ihm- ' nnuul UVl'l'.u ,IQ IME I .I' ' '-' NIV, Km-, uv 1-Au 'l use- it mm .'o1m-om- just IIUIIZIIUII Iititmf' WW: I. NIU: In 5 fm .XIIIt'I'If III I1i.'to1'y 'I' :sb WI wr- going. lo Iru' za IQ'.'I Ihq- mii - ot' Ihe- wa- -Ii. J. I.iIl l1'i' ilu I.+-ul Imp I II'lX'I' nh-r'i1Iv1l lu IIOI se-mi you out ut' Iha- IiIJ1':11',' 'my nnmw- thi: yvzu' 1: your be-Imavim' has bv -n so , und la I 'Iy. N32 if I,e-my Mix: II -rimze-r, I r 1I1huI I+-II zu Ii:-, I Ilan- he-I-11 111isIn-Ilzxvim. :III lhip pn-rival. Ex-I Ii. Mrs. Kula 'l'Il0l Ju: -II' 1, you mu Imw ull lhv :Iam-s yuu xvml the- V:-sl ul' WI? II 1 yn-'uf' gk ,lusv I im- No, 1 I -1', I h'uI muvh rzilln-r not h'1 '- th -nm, you :uw loo good Io HIM. 5432, T. MIL' 'j Q' ' 'z I I' I' ' M' ,' - ' I 'A Q' If I xulre- giving an prize- In 'iffy th- ' SIIII' .' 'I 'l L -I' 1' - I wo -s '- ln givl il In ,' u ww, 1. gf . - Yew, Miss II'ly. NH- z1IW'ly: M1111 - Izwk ut IZZZIIII in rmle-1' to Us-I In your -Iwss ' iff rm ' ,QM N. Mr. K 1 1 I 'IIII df-Iig.I I 141 to :vw that eww-1'5'I ,' in High .'1'I1ool 5 nlitle-mi :l QL., 1 -nl in the- ' I-sl, 25? I I H ' - w - - ,. gig .Xt the- lrlt'I1l :I 1 hc -, m' I' ' I In or mm-y. .yi -j .Im-k M. NWI' I the-y W'lIII In mwln- this umm-y I'm'? NE irq mu x1. -Awlg pm my ,xu -1 - ' 'rn f - mu' 'xiii , Viv' ERI' , . , .. , uh: AX, l z .I' .' Uh, R' '. I Iinint win to rl gnu. ,154 II' '. - Uh, it aIicIn'I hurl. YUII hit nw on the- I -' I, f 1 1 Q I ,, , . A I A-I :r.f 'Lf NIV. K 'I' , II A '- '- :I 'I I Ihink we- III ' 1 IJPIIPI' sic- .BI I 's ' Q65 III 'I IR-I-I h'uI Ne-Iliv, hw 1IiIIIl'I Y'IIP'iII it thwl w:1y.I IM LMT I-Xi' if! I I I 'Ii V' ' V, XVI - tire-v's HI -nv? I' 'Nz ' ' Ilf 'fi f - - ZIV' Qxfgg Iiwj Ie-II up a bI'1nI' pup.-1' ?lfIl'I' trying In writv II pm-m in lin 'I'.'I, Sh- III, I IH. 57323 xr Q- :I hI'mI' '-1'.'+-. gif Mlm' ' - I' 'I'h:- Islwmls of I.21II1..'I'IIOI'IIS ure- in the- I lr1r1'-ws. :If Q-,gg ' ' .' - Aw, I thougl II '-rv in Ihv I u'iI'if' flf'l Ill, 2 gf: I 1 W, 2 'W ' Q . . I NIT: K -II' Nw - .' - rlry 1iIs. ' iff: I Iis- I 1 2 II f' , NIA' II' NWI' '- x II -die-I ' VI' 'n,'? l Iirittle- II ww: '1 punisl - of rhe- CI1u1'c'I1 thlll m'uI4- ,' ll wut ' 'HIS-U Af? E 9.5 V V 'I'he- barb-1' h'xI vu! Ilz1y'.- hair' tcm :Imrt so who-n she- 1 lIII' mlms II In ' :I - , , ' :wi I, Wm-y Flmla, le-II -1 I ' -- g ml.-, Qilji V159 , 1' f fc wg ' ' Z '7 M ' M' 'T 'TT 7T' ' 1 ' 4 3 QKMQ Q, fx' '- f f'n I ' ' ,,Cf', ,'1 AM' , f- v MJg'i1v',,' W!! 4 4' 'f ,, 4 f'J!,fW 1' , -6W', f 'L f wwf f'ygf '.f514g: 4' ,344 gfnj , ,fwfftfi r , , I 5 I '. 2.x 111: in 4l11'I,1'x1x14iu11 192C .. ,..., ,. . , .. , I, ,.'. '.'. If -..'f- .f .., -M AM-.F 1 .an . ..',.,,... , .- 1926 1 ul Lmuxu HE SCHOOL ANNUAL IS AMONG AMERICA S MOST PRECIOUS INSTI UTIONS Q5 ON ITS PAGES LIE HE ARTISTIC EXPRESSION OF OUNG AMERICA LQ BUILDED IN O IT IS THE LIFE OF OUR YOUTH LQ IT IS A MIRROR THAT REFLECTS HE INSPIRATIONS OF YOUNG MANHOOD AND ASPIRING WOMAN- HOOD. Q3 FITTING INDEED THAT SO MANY OF THE YEAR BOOKS SHOULD SEEK THE FAITHFULNESS OF REPRODUCTION AND THE FINE EXPERT TOUCH OF THE CRAFTS- MANSHIP CHERISHED BY THE SOUTHWESTERN ENGRAVING COMPANY Fort Worth :: Dallas :z Houston 2: Tulsa 2: Wichita Falls for Thimffexrnqtun 4- 31?-Jifi' ,.1.fgx,fgx1:xy x...f5..f x,fx SAVE with SAF ET atyour DRUG STORE llllll :ummm :urns Prescrmtlons Un the quallty ot IIIKIPCINIIIS 'md '10 cg 2 C0lH1l0l1Illll1,L, 1 1 me na N me t 1 p lllt n yu s it y0llI Re xa S on 2 uw: mls 12 -2 L N in us 'lm monnpoundui onlw b the vat p 1 um uni ut Youn I'a1th ln REMEDILS You C2111 uw them xuth conhdency 'Ihex ale compounded flom the hlghest qual ltx lngredlentb and vull do fox xou what sou xmnt thgm to do qdtlSfdCtl0I1 gLld.ldllt00d 4 no Q 0... 1. 4 uf f D .0 , , ,,, bf , , ,,, l,l,ll,, lll lllll lllllllll llllll Ill Ill 'llll'lll l'llI I-I FITZGERALD Gonzales. Texas TEXAS QUALIFIED GG! M! 01 Q 4 Q 92 VZ? y v 4? ..h ,, , W2 2 fegr' ff. .14 fm. 1 , ,, n o , 1 2 , 0 lg 5 21 v 'fxxfxgf-rL4K141L1axgfxLfvfwLfrLfrL ' . 0 . ' . ' - - 4 i T' . vb' Q 0 I fNJfX.I' i n A Y. . . . . , .., ,, 4 A V, .. t , -, , ., , gf 1: YV-.-..- '55, W ,, , ' --QQLJQQ, '- A ' '.T..'LT-' ,-, -1- ,.... E32 iid 2, 2 il ..g x, 1 . fl ' 'D ,D X if . we 0 l I . W ' C I g U Q ' ' ' M' CID H ,- : , , A Q ' , gl A V 3: r . 'A . I ' ,' . 5 X , I - ' E. 3 . .2 5 2 2' ' . -' 1' '- ' E ' '1 4 A S' -A 5' 1 . , . w Q , . t , I L - ' . -. E . . . . 224 :Q sv , . . . , I ,, 2 - ' - ' ' 2 '. - , Y . . , , Y ' , 2 2 .. , c'ul'21 Ji' ' 1' ' I-1- is tl- 5 ' , he-ul I ot' tho 2 '- 1. E 1 . Xa Ya are :afv 2 ' ' ll Cl b-- -E A5 r'21 OI ,' tl - bvxt of 1ll'll.Z.' 2 '- :Q-al. 'i K - 'X' f ' ' - '- C4 -. Y 94 1 1 N. A .- y, A b D, E mag!! I2 ' 2 s. 7 I 0 1.2 : 2 -' '-'. . r--:' ..-1.-. --I 'Ill' ' F'-fn Hi 49 I O gg 5 7 2c G , ff I H! ,N 'f 7 2 f lx f 5 In 2 sf f r 5 I g,,,, !, r l 4 i 2 Dairy and Ioultry Supplies. Sporting Goods C 5 ,............-.,,,.M....,,,- ., .......... ,,. ...- ...,.,...... .5 z-,Www ,4z,':1g,.,...-,.z.,.f,t. 4-,5g,a. ,,, , ,, wi . .u , Y . ff? ' 4 W'o,M ., f -- vmrrvumr' v aim,-W' ,1--I W-qu--nv. 1 4 '4 ' Qxlxll K at X , Lv ,,f, I. I A A Q., f 5 X' if '-We J7'3'J f'i,.T1, zQ,,f5., .9'QT..: f.E.fLiii1f? I' Thx 'X fig, ,J i.i.f :fl. f?Qf7' A' J ' f ,Lf N VM rt I , ,, rwwn, Zw ,,.,....,,.,. .- ,, fi 5 rw if Q i ZF H RDW RE SERVICE I 1 i il stock of carefully selected ll1lE?S ol' natioiially'-liiioxrii nierchnndise and ' A record of 21 quarter Century of fair dealing and correct methods, and I J supplies that have been found to be best suited to the needs of this com- munity, constitutes the basis of our claim for your pntronzige. I We furnish expert service, including' estimates and inforinzition on any 1 E matter connected with our business. - CALL ON Us - BUOTHE LEWIS l , 5 , Q Hardware, Vehicles, Machinery, Farm Implements D i 5 l l l l Household Hardware. Auto Tires and Accessories , 'lin and Plumbing Shop 01 I- S AI lf R F tfonmles 'lexus ll lllllfl j V A L A V IU N I About the Inst need will be 1 11 -XIJLI Y SIN ININIINQ SLII The new ones ale exceptionallx attifictixe Then when iou tike a tiip xou ll need a. H-XT IOX SLII' C-XQI oi perhaps ei Tl LNB -Xnd then all kinds of SLNINIII TOPS X e ut alxxaxs I -XC I I TO SIIXI Y L HOSKINS MERCANTILE CO T fwfr' 45317 Y 32 it X rs wi 'ws- -N X X fox 'X N, Q. X .. - -,,,.c,..-.......-, I...-3 ,c.., ....:, ., ,,.....,i in I . I ., . .,.. ...., . . , -s..,..,,..i.,- 7:5 .fi i' l 'ERS wig .E , ' idol v j v N. E - t, . . ! Q - fi 3 - . a, f , Q: It 1 11, . 1 N , 1 '5 ' g. fi ' 2 ,Xi 34 M , , i lvl ' , . E as '. ,.. ! Q h Ja X4 ,.f - I I - : , s 3 5 ,E t I ' .A A X i . Q ' . 5 - 1 ' '. - . iifi . 1 A , Xe 'J ' s-2 , : , - , . 'E .U ' 1 ., ' '- lil ' ,.. -A 1, .4 - ' 5 -w 1 . r GLX, .H V 'N 3 ' ,Jr 5 -F' 1 4 Y' s 4., .' l f ' 2 ' . L 1 - v i - r . V ' ' A i , . Sm: . . ' ' 1 ,s , , ' U4 - . ' ' - 1 5 li' rv ' . ' ' I t V og ' 4 E i .U ' n' . me ' f. y kxii ' 5 .3 , n-1 Q-3,1 O 4 W . gps! A A4 - ' L Six? P ' 4 sn: I 1 . x fl 5 1 , ' , . :':z:- . 2 if A ' Syd rv X Q 'Z'--4' -- Egg . . .- , I gn ' A 4 . I in i Q 31: 1-1 if 5, V L we I . Y - 1 ,. ,i , . ,R 1 f .f 4 j.,W,,f' , '-M-, . rW,,.-S,.,,,:,T,....Y nj-4n:w.41mm, . 'w.7'31l'TlZWwmufvymau1fQfv f2 f' 0 . . N . . n W qw If Isl: x n U 4 ' ,I 'VM OWN w,,WWQ T. J. KNIGHT A I OOD l'l A111 'IO FRADF D HDEEDUEDDBDUUDDHUUUBHEUDDEEDDUDUHEDUDBDUDHEEBDDDUUUDDUDDED DILWORTH 86 ORTS WHOLI' S ALI' GROI I' Rs 0 I1 9 Gonzales 'lexas numzimnnuzucaznnmnunrazmmmzununumf or Economzcal Transportatson .1 SMITH MOTOR CO Phone 600 UUDEDEUHHBEEUUUUBUEHUUUUHDEHUUDUMHEEDE DUUDUUHUUDUDUUDEEHEDD 10 50 STORES LI -XSSIC IINI O1 SCHOOL SUPPI II S PIII AND M I I-XP I FOI I PN I'RY'IHINl POR C HOOI DUKE 86 AYRES INC 31 Stones nn Texas DUDDUDUUEEUUEEEEEDDHBDDEDUUEBHDUEUEDEUDUHHDUEEDEDDUUBDEDBDEM VSHIINIil'l'Il1Rl XRS XRI lil Ill BIIfK l I H 'Ines XLLKSSOIIIS THE BUICK MOTOR CO IOIIIIIPS llxu - -I'v MW '4 ' ' ,f ' EV? E lg MW ,,A QL? 15'X I , nr' i1,' 2-' 3 ,Q-fa X 1 ,f fx, au.Xs o. 'I . V 3 l I 1 1 1 1 V f, 1 A 4 , I ,.. . 5, fel' , ' 2 .1 J' ,Vi gba ' VW? 'N Ing . is .f V F ' 52 . - 1 15711 1 1V 1 1 1 1 1 l r - I 4m I 1 1 4 1 VZ. 21. ' ' M15 1 ' ' ' f - ' - . fi If Z 11: ,' h, .'L Lin? ' lm' 11 if sf. ' ' 1 K 1 3 HHHHHHHHHHHHHHHHHHHH! M My , . ' 4 jig? f ' ' !g1 5'-, I v R? Wi- if ' 1 fx l' x 11 l I ,ful . Q iv! 1. -- 5 . 1 1 1 2 ' 1,4 c 4 Q, F195 Q' V. lb T ,1? 'f. 4,-','Q 1 1 1 1 1 1 1 1 1 1 1 1 . an 1 4 1 41, : 1. I I 1 . 4 I I I .. gn, I 3 1 1' v1 1 1 1 , .1 1, 1 , 1 Q1 1 1 ' llifj? IAIH H I - I OI. 1 . In s ' L 1I,55 5 ,UH 1 f 1 1 1 1 ,Ku 1 v ,MQ A 4 I .1 1 1 A ZTJLI I Q' I 9 ' S Q f'1V -- - . . - .. . ' ,xi . . I . . . : 3 Ii - A yu e I ' 5 71,15 Q' y 1 1 171 1 1 1 1 1 1 rw 4 'Q Q 'A A A I I Z 44 1 iff 1 I v. f' , - , bm J L 2' I -, N . P - , ' Y Y Y I R15 WI ,L Ill ILD EM E' z f.! ' Q,y v . E.' 'JJ ' .'-4 '.'.' ' '.' -,.L fm, .X . , If yi! 2 f I1 e I . ,. I .14 1 . . , -1 . ,r ' 'Nz I ,4 ., .4. 5 'V ,,w QR: Tiffi- Vg? V34 !1W , 7LiL :13:' j,,,,,g, , ' , , 'A . ' -QV ,A V. H 'QV ,U - A- f V- -- -..,. ., ... .' V 2: p .l0,,fg, .3 g 0 , , Q ,Q-Ogg.,-, A A,-..' --,:',.-,kv .faxy 9 xg,,.:,. w.Y?x:4 ' ,nf ,. Y . A -.-,A ' Q 'I 1 1 'A 4934i'. 4.-M10 ' ' '. 'N ' J ' '- 4l,1'-.4.5'KXKn-4. 'v1a-AE'X' 'lVP'll?'!M1L77Q, .f. M Ulilfla 5 'Z 4 , fi AWIMWNW ' ff, . 4 , ,f f ,, ., ,... ,, .. s M- f' . Tm' gextngtun it '4i?:f1?1i'1:fffff,.'Qi:7 O glggifyfff-vw-M---W-Y 'T' 1, 1 9 1.31 ilf T1Z2l1f.1IC..TZ.,.,,...,.,,.....h,-,.LlI1,WI ,1,:,., ..,,,., - ,.,,, , :lil QQ ? Q? 22' ful iff? fill all Xl M4 's ,W tl: 4,32 1.9. Z x X .M VVU1, G1-gen, P1-Qs, Philip Welhausen, 'l'1'easu1'e1' Green and Shall, St?CI'0lill'l0S and Manag'e1'S TORNADO - FIRE - HAIL SOUTHERN MUTUAL FIRE INSURANCE COMPANY 1 YOAKUM TEXAS su mm or PHoN1 BEESON State Manager Gonzales Taxa-. Phone 361 P O Pox 603 EDD Now comea the se lson when the proud boy 1nd gnl 01 Idl11tLS vull Ind then books ood bye and step folth lnto OffIC6S of lebponalblhtx Your glft should be of lastm value as xx ell IS lpplopll Lte Ind thus 5 Ive ao a constant 1em1nde1 of the g,lV6l IIVE Jewehy the Pelmanent tlft THE JAHNKE JEVVELRY STORE mzazfmmmmmnnmznrmmmmn Mnlhnen y Ready to Weal MILADYS MILLINERY SHOP MIS L A KONPCNY Pxop WE SI'l I THF BFST H281 DED FRIEDMAN S BRANCH Gonzales Texas WHI' PP MOST PI OPLE TI ADF DRY GOODS NOTIONS SHOP S RFADY TO WEAR and CLOTHING one 4 -Xhjf' y1Z!nfi!Xf!'WW Wk f N...f' nnnmfwm f fx ll 61: X or 51, ,, 1 fu ffl ' 0 fl ,l w w w y , r w , w l K H H, s, H L H o 0 l 1 1 9 o Q a Y T I I v 1 l 4 . , , . I- . v T . . J ug:'l'ri2:2lZlfxjxhl'l'lil21,112:2ll2l'l2l'l'l2l2l2x2x2l:l'l l:l'l:l'l'l!l2ll2lZx'l'l'I'l'l:l'lr2l,l2ll l:l,l'l 13:21 0 1 . V . ' . . , ,' ' ' . 1. z. f 1 ,, 'z z P. aa, ' 1 -1 0- v 1 ' ' . w w' ' ' v in o kt C. .I Ii Y' ' ' fl, ,'.' I 2.i ' 'i',2 U 5 .O . . - . ' . If Q , K . s w' , , 1' , , I V l I . V nt . . . 2 , . Y 1 1 I I 1 1 1 4 JI .. . rugxiujx xr:121:12:212:'xilu31:13:21:lgningugngngngxin x'x:l::2l:l:u 13:51:13: :Zvi 12:21 lil 1 2.9 . , Q 9 f fl! , ' l A, , f . . 5 .I I . , . I l 1 n ' 1 1 1, I ' 5' 4 u U I 'A ' m. I L ,n , , X is ' ,YH 1 1 1 v 1 y ijt! K T K -.. A A 1 1 4 All A ' ' , f ' , Qfi MQ w l ga, P h 9 3 3 if gall' , y fl -.0 ,SJf'4fS.J'QNZF'-3,.'-v2n'of7 .auf quZ1 'a- o'o'o'.a's' 4'o' 1' u's'l'l fwxwfm':zumwmwwfwwwmwm fmwmmmmwm4W mMwfW 'V - y Tl11'T-111111111111 Q A A ' ' , ay ,-, ,. 1. v 1926 , ' - - , , w ' ' ., -.i.,.W. .lf There are few things in Life hetter than an Educa- tion hut that alone will not Spell A SVCCICSS. You will find that a bank account will he a great help to you. FARMERS NATIONAL BANK Gonaales '1 exab DDDDEUBBIDEDDEUDUHEUUEIDHUIZEEIJDEEEUHEJHEEDDUIHEUUEEDDEBEUEIZEDUUE! DON T READ TI-IIS V V KEEP TEXAS MONEY IN TEXAS su 1 Vu SOUTHERN LLOYDS FIRE INSURANCE C0 YOAKL N1 TEXAS L In BI-LLSON State Manager Tea Il ei E Y C T I 1 7 lr.-J 9 U O F V I 1- B lr I' -- T Y 1 1 1 INS TIG TII I - AT - I V 'T A 1 , 4 S If IC '1 W 1 1 I I , Gonzales, x' s 'mn f 65 - P. O. llox 603 15 'M6. i 4.1-Uv ' 'Auf f -' '. ' A Q' , Q. , ,, A - 1 I i-4, A -,-'fx . A ,.f ..x. : l ' -. .. C0 N51 O53 ,- 'J ... 1-4 IZICIIZIZIIIIIZIEIIIICIIIIIIIIIIEIIIIIZIIZIKZIEIZIEEI'ZUZJI EIC! F E SI-IULER GRAIN COMPANY I KIINI VH N 'II XR WOIVII S N I0 IR II x AI XOI xmxl H 86 M TOGGERY INS l X I2IZ!IZIIZIIZIIIIEIC!HIZIEIZIEIEIDE!IZIIIIIZIIZHZIIIIEIZIIZIIZIZIEIQ.:IZIIIIIZIIZIIZIIZIIZIISCIIZIIJZIIIIIZIIIIIZIIZIIJIZIIJEIIIIIIIEIIIIIIIIHIIIIZI BRIGHT MUSIC C0 EIIIHI EIEHJISEIEIIZEIIZIIJEIITIZIIIIIZIIIIIZIIIIZIIZIZIZIIIIIIIIIEIIJ Vluxlc al Melkh nnchxe ol LII Iumlx Planos Player Pianos Organs Phono HAIITWELI1 KENNARIJ faPQjejj'Ljgg1'gjj1jgen'S Mach nes RAKIION and Acne-wonles f0l1l lles Iexu EHIIEIIHZIZIIIHSUIZIIZIEIIIIIZIJEIISIZIIZIBIIZISEIIIIIZIIJIJ 282825 IIIEIIZHZIIZHIHIIIZIEIZIIZIIIIIZIIIIIII THE AMERICAN STEAM LAUNDRY MN M III III I INK SI -XTIOIN C W LOGAN IIIZIISIIIIIIIZCIKIIIIIIIIICIISIIIBIEIBIIZI If xou Coma I1 le xo LI I' US IPO PIII HLVPI t1'1dI IIIXXIIIQI6 mlm F-XXIII Y VK -XSHINI We handle IOOPI' R TIRI' S R N ,V . I y v N .qv-, it . AW, . . .. . Y -, . I M W f 1 I . rlwlllqx , r 1 qw wr w ' W . ' I A. Al - IN ' . C. .' 'Cr 'I'HI+I I'I.AI IC ADIC WII 'I Ili YOIT GIYI' YHA ,. , 4. .A ' . V , v v..v , - V Q XXII 0 INA. I II L. I af :Q 1233 -1 ' f' , f ' .ww ' bl-i Jie. Z, 'A 2 f-JJ. 15? Q 3 5 'E .193-21:1 -'-- - 1. P1 l-A -A 1 - Lg? I I I Q 1 2 .' z .- 3 i 1 I v 1 ' Q - . E I . . , I i I zz 1 S IC IC gg 77 E C I i THIS A , .' ' 'I'III'I j I v '1 UIICU j IIVII I . , '. S .' I I ll I -' O 4 LI1IIl.'I,,L'XII'lllIL'l1I Q, Y -Y Q I A 1926 ' B U R C I-I A R D 86 B U R C I-I A R D ,x1:s'1'Ic,xc l'011s 5IUIIIIH'I'S of Tvxaxs Alnstrzlcl Assucizltiml and :XIIIUVICZIII Titlv Associnlicm SL'I'lCIIIOIl SI-IIIVICIT' I Qil lC1Q oi' I f' ' IHC um ml Rlmh lom Iom 11 I Ill! 1 ummtimmmmmmuzmnzmzatfmrzmnzirszu I EIDE M. A. ZINT QI Staple and Fancy G RUCERIES 'J HZEIZQ' Phone 425 UEEUEDUEDEDDEBUDEDBEEUDEDD C. L. MANGUM DEDEEEZUDEZUIEDZEDZZHIDZE2 HU J D E HIDE D H E B H H H D E E U U H H D E E E E E D E D H U E U U IIARISER SHUI' A trial is :LII wll- ask EKLEEUEEUBEEBEEEDDEUHHHUEE , If ,f ...,Xv ,T PI I IIONIIN-XII N QUICK SERVICE FILLING STATION M 1g.,n0ll 1 G isolme III I BH LL NCH LANIDY NI hXIL AN DISHES MICHELSON BROS Icolm Ixx I I nel II u old BOTTLLHS OF We Make LOC A COLA ou1 own Ice CIQEIITI ,fi .xh. c . 1x.IInl ll+..Cf- .I.I. 5I.I. I. I I 1 C , I ', ' ' F: ' 1 I 1 - . z bi I'I - A - G: ',1Ic.s, 'Z'c:-zI+s 1 1- 'z 'as ' . I ' ' ' A . --J I I Aw I ' 4 L 41 , 1 X 1 1 I I A A. O l . , . . ,Iz - I,: - - - . 41 I I ' 1 N 1 , 1 J 4 l,l.. .??,??,I . I .Ziiiiiijil I , U ,,,,,.,.,,T,M.I,.,-,,iT..I ,,l, .61 ,, ..l. I.?l,ji1,fi.?.: I . - f ' L'l?iQI'94fK 7l'U9 'i-4Q '?'ff1' '77-Opp' . I ' ' 4 - . I 'f . . h H Ll'llLll,,L'XlIll1l.L'lll4 ' R' ' 'f A ' ' R 1926 A S -r ' ,As ,ff ' - STAI-IL BROS. Pioneer Produce Dealers Buy and Sell liverything' -'1'l:Y vs M STAHL BROS. GONZALES LUMBER CO INC Yellow Pme Lumbel, C yplese Shmglee cmd Geneml Brulders Supphes 0 Xlll Xlllltf 71 DEEDEDDEEDUDEDHUUDDEEDEEDDDEDEE DDUDEDDUUDDDDUDEBDDEDDDUDUDD GONZALES MOTOR COMPANY DUDHDDEDEEDDDEDUBDEDEEDEUUZDD G R KLUGE S M A I MARKPI -xlllllllllltil l INC Ol N FORD compln te lme oi 111 lumix PORDRUIN Phone 11 I I O, O Healers in 0 I 1 l '1 1 O Q 1 I x 2 L K Y .I ' .NY '1 ' Ge .li v' 51, l 2 122 r I' lr o Ill L .J I GICT IT AT V 9 l O I lf: A Al I V A YYY A I y A 9 ' ? ' 2 J V 'V V of Meat Iymlvl-S I' h 1 n e 4 I 0 I f I I' A oTlI1'IJXIN!1flm 54 U ' 'I PAIIKICII IJIII Ol,Ib FOUNTAIN PICNS AFJIJ PICNCILS SINKILIC Oli IN SICTS K ODA KS and T IA A1 GONZALES DRUG COMPANY I lenne I 1 I'1v the Dlug Nt0lC l4IRS'I 1926 u Ll li.-il 1lil11. it-iilil-. 1..l-1-ll,l. i-lliili. M-knnianh fhades fbfmoreponz' comfbrf liiillii. 1lil1i. -i ,1g.lil11.. Qillii-lil-. 1.11iTiiil. -111.1i11T. 11 -lil-iii. Q.. -4 x il ..- . , . : , 1 - .ll1 ,l-l. 0' ' r' ,L K- . I-f, . fi L h . w .m:i.l t 1 .5 i 2 ,, 'XX f' f ' x -I X Q-f 'f IQ' 3 'fu ' f 'r1A-..: '+w- . .111 I, V, ., vs: 7, ,.f. , , , . 'gf' ' h I ,M -1 I gn , hu - , 1 '. 'Q 15' f' 1. I 4 1 '-' ', 1 .4. VIVL, I EJ ' ':L 1 - - . 4 ' I ' 1 I Amo 5 I V T LAT NG PORCH SHADES keep 10111 polch cool and add mother loom to the house Robertson Sz Seydler I'llII1ltl1l9 I'l1Il8ldI IJlli:'Ct0lN I homes 41 94 KLEIN E BROS Ful mtule Deals-1 S FUNERAL DIRECTORS I st lbhshed 18 fi Dfu Phone 143 N1 ht Phones 98 md 108 Ixent I I fudlen I ll INSURI' IN SURF INSURANC If GARDIEN 84 COMPANY If ARM IOANS 1 onmles Texas x.2 N.., XIX .! El I X I 1 If I M S U , Lf, 3 II I, 1 gl I I S56 M i H A My ru? , 3 E 1 LU EN I I ' . . . , . L. C. I' 1', op, - E , . . , X, ue' . . ' .A O s I 5 ' '99 ' . ' . ' -. ' 1 -- I - . 5 I . is L 1 Y l EIL.- O I . I I ' w ' 1 T' U. Q . f Q v Y. ' 1 I 1. ' . fl . . 1 1121121121111 l::gl:,:2u2l l:l':l'l:l' I I I Slilfl lZl'l!lol'l'l3l '3l'l2 l'l:l2l l ' C, L - ' VV. L. iz 'dien, Jr. M n 1 w 1 u w nu L ,I 1 L f I L A J 1 w w ., wr 1 w I A .4 - . I 1 1 1 K 5 v 4 --. A-1 K1 ' - ,..:. -' .:, ' ' -.' ' - Q -V -1-v -- fu- -V -W---we ' - M win- I,'fxi11ntu1l H ' ' 1 .- w.-,..,',,.-,',.. ,- V ',,,i N -.1 ' N , ,,- W 5 'i'-il7 TFT f 'v' ', 1.1, tE?2s:se:isf?ssi5x J 4 O , .Q fs-ii 'k25fi'a?1ez2::'-.-gi--ff -- 4 r- f- 1Q35125151a5:5g5g5E31f1Q52-Z'ff ' .ijgl HAVE 'T fi' XX? Sell You 1 I 1:525252325-,g5vr.j'-55-f - -3 1- MADE T0 .3 Ez:-sflazii-QE??gQ'15251-fp'. Q '21 :Ev MEASURE 5 qiiiiliif' o :iv Y - yg ,j Logx-th Q- 1' xv i th I V .. :u1dl l'l' E ff -'1W 121122 f I : I C'l,O'l'lll'IS l'ONl-'IIJICNUI Qlf.-XI.l'l'Y, S'l'YI.lC For The Man Who Cures a tt 1 1, 5, DAVIS X M, g 2? L A ff .L qflpfi? A A ZW: 'Z' -A151 Tho Countrv Maxis 'l'uilo1 Phone 410 A 561 VILQ 'lhat 561 vea SMITH DRY GOODS CO Halt Schattnel SL Maxx Clothes Edwln Qlapp and Walk Ove1 Shoes Nlanhattan Shuts If we cm serve xou xu mll lpmecll EBI!!!EUCIEEDCIDEEZIDEDDEIBIJUDEDEEEIHEISDEEEEUEIDEBIHISDDEEDDEDDEIHDEHCIIHD with Dm Goods 4 MAKE OUR STORE YOUR STORE ,Q 1 l ' I 1 w O I I l U f O X1 1 ' W r . N1 ' '2 2 sl' 1' 'Q 2 ' 'atv it V O fi X 5-3 -W fp' on M X fn, We f' 2 www I '1 A xl 1 N 1 at nk ' U J - f U 1 13 g X x L, ,,. 57 X ,nf X flfxq, fdxj Oo iz M f-f .'1 4 w W4-ffzv, -f ,r M I .y Lllll1'l.,l'XlTIl1IL'llT 2 I, ,, 4, -, 4 wi? mf q'-,,y 4 .. +.!6 Q-...' 5 17 - m7,..hhf1, -.2 '- .' f , ff f ., ,,,,. , ...,,. .-,,,. ,.., ,.-,.,., ...- . ,,,,,. , .--, . , ,A + .al , Lv L Nirmzk-1.A::f I , H I I WM ., 1 5l,4i,,f-7 , 1. 1 1 Q- L ,,,,.,M M' U HONCE WELL DONE 1 BEATS TWICE DONEH Building with Brick e e Is Building for Eternity Time has proven Brick to be an iinperishable build- ing materialg it has stood supreme through the ages ' both in beauty and endurance. All over the World are I historic houses of brick as substantial as when they were huilt and growing in beauty day by day. SUNSET BRICK 86 TILE CO INC Conaales, Texas UIJBHIIIIIIIEIZZIEIUlJIJZ!E!a.IlIllI!SE!lIl2I2i'Illl4EIlJlI!.!IZlHlIl!3!:JlZ!,IZFDEIIZRIEUISEDDBIZIDIJEIIEIJDZIJ J THE PICK OF THE FOREST lor evtix thu xctei of construction in which lumbu ind timber is ustd xxhitliu it bi homr ictoix a ui e impltniuit xhtd oi othu huildin Valspar Varmshes, Devoe Paints Builders Hardware J H GRANT LUMBER Co 'g.!'X.,f'x-.4fK,l ' .XX 7 l I I X Y Y I N 1 ...- .. - 3- , , - , l L ' . 5 -I v r Z -I I I ' 5 kv - ' ' v ' x v 2 ' - 'K' if x y ' x x ' i x x 1 or 1 ' ' l'u'n H U' ' ' ' ' 1 ' 2 C . 9 C 1 hi 5 rs v ' 5 1 - ' ' lr ,..,. . v ' 4 , X ' 9 .Q 7 4' ll 'v ' 0 0 0 i 1 :fi ' . ' V. ' . 17'.TZf ffi'7is.?1f I 43'25 17f3?'u7 17'7ifT?-'357f 39f'1Q5'7',Q:f,' 7 lh'7333'7f1 A :ff A ,az-, 4 4 W.. ravazsmwxorvuuvetuwgvnrmhxwwr ' f :rf-fm .. . ' - -'-M rf- fn: 2 H.. .. .A Y ,ww 2. :,.- - . 1 . . -- vw Q A , ilu! Xiu! Xu. . 1926 BUILDINQ owNr RSHIP IMPRUVI 5 Y U U R C R E D I T He Uwns Hrs Own Ho ll rvt xou tvu stoppui to thunk vs I1 lt 1 pottrrt crulrt sl lttllllllt tlusc VS0ldN ll IVE' COIUQ to H16 lll ' ln 1lnrost lIlX conrmunrtx lr mr oumrslrrp hrs court to nu 111 1 ll ll rrrtu of ood cltrlerrbhrp ot ood mor rl Lredrt -Xnd thrx rs true oi 1ll uxatul burldlrr N no other poxv xsrons ne rther c uh nor bonds mem lS much to xou 111 1 credrt xx 11 18 tht omruslrrp of 1 honra REMSCHEL BRUS Burldmg Materral Dealers Phone 45 KIIIIEIEHIZIIJ DECIDED Your Vote 1nd Support W It -Xp11r1u1tul 11 M L POTTS Candld te lor JUSFICI' 01' 'IHI' Pl UP 1. D MCVEA I andrdate for LOUNTY T AX C OLLFC TOR U e electrorrj Gonzales, Texas DEEEUEUEUUHUDEDBHD S 1 OI' -X I N D CONES BARBER SHOP Ifrdres Work 1 Spcc rltw EUE UED BUHHU CURTIS BAKFR COUNTY TRP ASURI' R IONIAI PS KOI NTY U L clectrorrb v r . ,1 t .,. 1 1 h...-M Y Y W j 1' '1 f I J J ' me Q 1 K' 1 1 ' 5' 1 ' ' 2 2 1 ' 1 L' 1 1 1 1L- 1 . - - 1 . 1 1 4 , c . i 1' 2 t' -', 0 x ' ' '.' 2 Q ' 'I I 2 , X , U. ' ', 1 ' . ' U. ., , . x ' 1. I., . , l., 1 . A S K. . 1 z K. X gt. ?. Uh. R... K, X , . .2 A. . K. 2 ix. t. 2 . 12 I., is , 1 , .D 2 5. . . . . o 1 ,N 1 ru l 11 l ,:,l,:,l , 1 1 , wr w r 1 1 K L A vm In 1 lx -' o o 0 U N 1 ' ' .. n - 11 . . . , . . .. ' 1 A 1' 1 Y Y Y 1 .1 i 1 on 1 n 1 A A 1: A , 1 ' ll ' U 'IIE ' 7' . . .. J - , . . .. v Y H Y ' 1. 1 4 ' ' ' ' ' w r 1 1 1 v - - 4 -' I 4. 4 41 , J . . Q 5, - .. LJ, 1 . . , . ,.,.. , ., ,..,. ,.................- .,,,,,,,,, ,, , 1...,-..,,, ,,,, ,, . , , , I , affff, ' V, 'ff' q..wf-f',..M.yf1 'af .' .ummm ' Mm ,a murmur , ,ff 'zzz' 1, W 1 Y ' ' , case, ,f vi' , - ' +' fwffvf ffw f 'f V, A. uu...,.,.,,...,.,.,M.,.W.,,h,,,,,,-. ,, ,, ,, 0 19 2 6 MMM, , ,,. .,,, .A. , - ,, ,A,,, ,.,.... - ..- ,,,,, A A ,., ,, - ,,,,.,. A.., . T .. 5 1 .,.. f f- . ...1 -M..- ,,,. ,,,,, ,-,.f' V WHERE WILL YOU BE AT 65? Out of 100 average men at the age of 25 today 54 will be dependent on others 36 will be dead 5 will be working for a bare living 4 will be well-to-do 1 W1l1 be 1lCh You may be one of the hundl ed today but Whexe Wlll you be at 65? It depends upon how you can answel the tollowlng questlon Are you savmg systemat1cally7 One Dollal opens an account Wlth th1S Bank GONZALES STATE BANK 86 TRUST CO There IS no s bstltute for saf ty .f N. . . . . . . 9 ' A 4 1 , . . . I I . . . O f ' ' u ' te- 5 2 xv . ' . ' . ' . ' . ' . e,ff:X.t'.f ...-vwic--Yfzwhff:i'71Tf?f'l 2.7'Q?,l??'5?74?l'5'4'Q 2,32 11 I f,':I-wavik 45IL GiZ3 ' ' 1- 'C 'ff 'WF '1 f4 v' J 79 '. '- ' . 'F x9fK7'1 4?Y . . .- - -W f'i e'I 2I'iIL'I,,'fIII'lI1IL1'lI ' , ' 'N ' '. I 1.4 ,, Aixf 1926 ll H ' 1 -1-.- ,, ' a GONZALES COTTON OIL 86 MFG. CO. M:uu1factu1'e1's of COTTONSEED PRODUCTS Phone 82 UUUUDDDHHDDUDUBEUDBE EUUDDHHHMUUDDDDDDDHEDHDED j. C. ROMBERG SAM PATTERSON DUEEHEUUHEDHUEDEEUEEUEEHDHIZ' ZNEZUUZUEU Attorney-.nt-l,.nw Candidate for IUUNTTY C I I4 RK I onl iles 'lex 11 fl Q EICCUOIIJ SUUUDBEEHU DSU Yom Vote Vhll I 1 DR Appuclxted ln cnmouuc lou A C HILL Iandlddte for IOMMISSIONPR Inn 1 Phone 100 Subnet to Democratic Prim 11111 111 Julx IDU ENDED Vkoodbtock St Illdflld I emm ton Poltabln Tx pevnutels I X pus 1 lthl 1 D T PERSON Commelclal and Soclal PRINTING THIS ANINUAI IS I 1 ou om PRI as P h o n e 2 6 3 VlCt0l Stafldald Txpewlltu I lbbons 'In Supphes . . Pi 'M 1 1 1 1 -1- A A 4 Y' . ' 1 . I x 1 I 1 'i . , . 1 . I A' ' UU , 7' 1 ' A ? u .2 1 . . 1: 1 I , A U 0 ' I I 1 1 - 1 1 1 v 1 y 1 1 A l A 1 Q I I -' I 1 J uf I -I , Q. 3 1 - I A 1 . l l.l l,l,I,ll,I2x ll,l,l,l l,l,l, :,:,l lil l,l,ul,l,n,l,l,l,l,ll,l,l.l,l,l,l l2l,l,lt1l l,l,l,l Y , V I . I ' . f . 2 f . 1 g ' ' X . vf' .1 V ,,,',,,, o L 1 ' 0 O P, . . a 1 , X v 1 41 , , .1 , , I I I A I N A , L n I - K - . v .' 5 . A. Adding Machme , fi Q ,- My H ,,..Z.iJhV4v..f,7.:Z,4YC., ,A ff?ffT5f772Z'f'f'f'2'f4'fffff1'ff:fhrfo LI'l11'I,,vxing1tu1t . 4' 1926 Wy! L, --f.- .,., , V U WHERE YOUR BANKING INTEREST IS WELL SERVED !JDDUDEDUEUE THE HONORABLE history, standing and conduct of this institution has inspired the utmost eontidenoe ot 1ts eustomei s and has made them feel as it they had a soit ot a pi op1 ietaiy intei est heie they call It their bank YOLNC BI SIINESS MIQN will tind heie sound business counsel and depend able banking seiviee C OOD BANKING CONNECTIONS eaily in youi Cai eei IS a wise step THE DILWORTH BANK Conzales Texas Q W I W 7 . I I 0 I . I 5 . . V I1 N Y W LY 7 ' ' ' X 'I J J J n ' 5 -I N1 N 1 w I I O . I I I . . ' . C Uni llCOl'DO1'21t0fI J I 1 '?Zif f ffl' -ivfxffl f'f:5377:l 1' i177fV7 ?:'7 '5nuv.xv-1-ww 'rr , gwggq.-x-f -4-...,,I-.Z 1, 1' . ., . l A ' -- -I , S 4, . f W. ., ,. ,. ....m..-..--M--lh A A ...- . J lqilILxIqUxi1lEltL1ll ' N , . ' V A W' ' w 1926 Q, ' W .V -.,, M-. ,,,Mff ., XX iw, QM 735434 lyl. V4 nw- gn , , ,5s-m-- 1' f W' 'S' X tflf gs Q-,QS gc. 53,53 E' wwe: if M121 MM EYE PLUG Q ,yy X X slffif 77771 LM 5 ffff..--f R . I In Il, I 'Q lflhi' W a wr ff ff 1: -S N , I Q, K ,- Q- I m Ia,-. ' . A 31, ,' 4 Q , Q - , Y ' 1 X 5 IW! , f f 'Z'-1-' HX 1 , V '-if 5.1-2 2 4 1.3. -Q, 4 N f 45 I N f 2 X Q . I ? .. ff f 1 5 '-za' ,, s 9 ' fl S- FV , 1 7 5 is ' W Q, f El L f ' - fi .1 ,fy A' xx! , , E ' 1 ,- 5 x : 3 X 2 ' - 1 X 31 0 Q 0 A f ? 1' xx. ff ' 2 S 5 A fe' V it Q S- -- f ,J 'Af 'liiifw if .. gf Q1 E 2: 5 1 42 fi 1-- - : Q ' Q? i L Q


Suggestions in the Gonzales High School - Lexington Yearbook (Gonzales, TX) collection:

Gonzales High School - Lexington Yearbook (Gonzales, TX) online collection, 1923 Edition, Page 1

1923

Gonzales High School - Lexington Yearbook (Gonzales, TX) online collection, 1924 Edition, Page 1

1924

Gonzales High School - Lexington Yearbook (Gonzales, TX) online collection, 1925 Edition, Page 1

1925

Gonzales High School - Lexington Yearbook (Gonzales, TX) online collection, 1928 Edition, Page 1

1928

Gonzales High School - Lexington Yearbook (Gonzales, TX) online collection, 1949 Edition, Page 1

1949

Gonzales High School - Lexington Yearbook (Gonzales, TX) online collection, 1950 Edition, Page 1

1950


Searching for more yearbooks in Texas?
Try looking in the e-Yearbook.com online Texas yearbook catalog.



1985 Edition online 1970 Edition online 1972 Edition online 1965 Edition online 1983 Edition online 1983 Edition online
FIND FRIENDS AND CLASMATES GENEALOGY ARCHIVE REUNION PLANNING
Are you trying to find old school friends, old classmates, fellow servicemen or shipmates? Do you want to see past girlfriends or boyfriends? Relive homecoming, prom, graduation, and other moments on campus captured in yearbook pictures. Revisit your fraternity or sorority and see familiar places. See members of old school clubs and relive old times. Start your search today! Looking for old family members and relatives? Do you want to find pictures of parents or grandparents when they were in school? Want to find out what hairstyle was popular in the 1920s? E-Yearbook.com has a wealth of genealogy information spanning over a century for many schools with full text search. Use our online Genealogy Resource to uncover history quickly! Are you planning a reunion and need assistance? E-Yearbook.com can help you with scanning and providing access to yearbook images for promotional materials and activities. We can provide you with an electronic version of your yearbook that can assist you with reunion planning. E-Yearbook.com will also publish the yearbook images online for people to share and enjoy.