Franklin High School - Dial Yearbook (Reisterstown, MD)

 - Class of 1931

Page 1 of 156

 

Franklin High School - Dial Yearbook (Reisterstown, MD) online yearbook collection, 1931 Edition, Cover
Cover



Page 6, 1931 Edition, Franklin High School - Dial Yearbook (Reisterstown, MD) online yearbook collectionPage 7, 1931 Edition, Franklin High School - Dial Yearbook (Reisterstown, MD) online yearbook collection
Pages 6 - 7

Page 10, 1931 Edition, Franklin High School - Dial Yearbook (Reisterstown, MD) online yearbook collectionPage 11, 1931 Edition, Franklin High School - Dial Yearbook (Reisterstown, MD) online yearbook collection
Pages 10 - 11

Page 14, 1931 Edition, Franklin High School - Dial Yearbook (Reisterstown, MD) online yearbook collectionPage 15, 1931 Edition, Franklin High School - Dial Yearbook (Reisterstown, MD) online yearbook collection
Pages 14 - 15

Page 8, 1931 Edition, Franklin High School - Dial Yearbook (Reisterstown, MD) online yearbook collectionPage 9, 1931 Edition, Franklin High School - Dial Yearbook (Reisterstown, MD) online yearbook collection
Pages 8 - 9
Page 12, 1931 Edition, Franklin High School - Dial Yearbook (Reisterstown, MD) online yearbook collectionPage 13, 1931 Edition, Franklin High School - Dial Yearbook (Reisterstown, MD) online yearbook collection
Pages 12 - 13
Page 16, 1931 Edition, Franklin High School - Dial Yearbook (Reisterstown, MD) online yearbook collectionPage 17, 1931 Edition, Franklin High School - Dial Yearbook (Reisterstown, MD) online yearbook collection
Pages 16 - 17

Text from Pages 1 - 156 of the 1931 volume:

.lui-pr f m' ,, --If .- 1: '1"'!2"' ,- : IIN! HY' nr mn-our 'WA'-4Hlxf'N ,., Tw-.-gg Drs,-cw'-.U Q .-un x iithrtgi 'af ffq Mbxsvf ,A Dx! I KL. f +1 gfaf , , X3 'TX f f "Saw .ww fzw .----M.,-4 'yr---A 4 X A X455 w ,..,.. .------Q ...Q-A f flfr4 502' J'14rx, fa-dale.. YKA, J ., I ' '4 ' If ., 'A XM , ,.- A, I A flj V 3 f f I' HH! ,W '- ,ff ff" 1 "Q , .gy , F r A , -T3 ii., LkJ, , . 1" p M, 51 x 1 er A N , ' k U5 f "' ff , ff f 1 WV QL 39, 1 , ,f , ,Q V I" ' jfijaff ' 1 fQW . fix 2 'N Q.,., 4 , ,ff f ,, "I if" ,' L M, ' xy, .,,. ifff i V f 'jj n 1 4 ,M V J, , I M, i y' - I A .1 ,f' ," ' X , ,algsyy Q , 1 rf ., , ' 'fi 1 flf . . ' , 4 :Z ff H fffr Nfl, : ,wif lf, ,. A O -1 f. .V I lt 1 i , VI... ,f If ' I x V x ,gf I Y , : , N. , f V f, rf, X , . fx! gif! ? V Q V 52 ka --,..,.X ..,.-...l.T' , 4 ' A ., 53? W ,,:t:.:S Q I f f , ' K kfff i , - 5 "QT ff 2' X xxx' 1' f -2 i I 9 ff X L. ' f if A . -f W--vi ' 'gr P 'f Y 1 1 '1 I 1 , -5 -4 , 4 ff f f' Sf' 'gh . A ' 52: if If JE f A Q H f wif A M-H , S V .A ,,,, , J f fr I 1-, . , , -Z X , 1 ,X ff f -' 'Q , A "3.,,,...... M. .'z 15,-iq: lf' JP' ' . V 4 ,Cf M..,- , P J ----Md ai- 4-6 yn , ,!' YS' -1 'S -.1 Brin tredrrun IU U'o'U0U U U'F' U0U U6U0Wlf10U4U'UVU0U ' x 1 FWZ lil IPVIFYV PIWIHVZI 1"7 fx nf IIIIFHR' KYIHIUW Qllllll! UR IWIIII DFWJ7 KY OD IU.. Dtbltltt out Wal to out xbvwox a Tlx a -mxtttt apprttlat IOII ot tbtu work, Clntu ha - nent bun an 111 wtamt mont bl tow -Imhtb 'z.C1l3LllWLllLLUtUlJ6llJWt, wen given lt, 'Llllltb tbt threw, goot nature tbw po-wt Q - Chun prt -Lute mabe out thool Daw www 'Clmr tftortw mam out ' 'mlal a amass' w. gummununnv 1,-. I GK C31 4 ' ' Ph W' WH H"fff1lyl,,y,u rl W lk ' A, . mliul l T xlmkkttk Mkt ' I . V 'I . 1. . ,. -J1,,! 2' p r Qt ' PT 'rxrv .Q A' f , fu ur' df XM' K A I I M ' " "1 T f T 'WI e . - 12 'Q I '5. Q , ...S I' "" " 1 L ! ' ' Q' Q Q1 t 1 , v 5 .. ,, 'U E t f a ' t ' 4 H 3 Chat amy one of tbcm baa t 5 ' Q, Q K' N. , x H , , I31 1 a a 11 a V 3 ' , . . A 5 f ' ::'sf, 5 A - 1 4 , V ' 9'-x N! 0 1 t l. ' - i A , i' - ,- . ,v t i t - , . I ,, . i t 5 a 4'J"y" .v-law M 1'-"' ' 'Ti ..,,.,. . ,f,' ,.... TffTT.QgQ,M ,... if.fT'7' 1 . 11 ' P "' 4' f 1 ' 25 I5 , 1 ' . 6' .4-2, Our Honorary Adwsor 1 Our Admsovrs EIHLL X Pak ox Pg l O Ihvxmxn S. Hysox O , , mn " ' .. . S a e 'ire l'FIl1P1lID1D Jfoul mar: bam xm lim 21 llto. ot lov :mo tual Z1 lite tull ot IWHDDIIU. -f IIWOIIGIJ LVLIV mllu, LIHNNIIIHICN '10 ULFIF, 3511119 INLIIIOIILN bappv muh pa -mm mm amor' 3' 111 N l O 0 .My - v 4 ' yo 3 ' 4 my : Emo now may this book, " -' Q ' Q x sh , s .. M Ez? ' ' is 1 6 Contents rg 4 '15 Q f X ff Ks X 1 Z D9dlC1lIOn Foreword D111 S iff Board of i1dl1C'1IlOI1 ind Superusors New School f D d1C'1L1on Faculty School Song Semors unxors Sophomores Freshmen Acuvmes I I lterwry Arhlencs Alumm if 7' 7 INl1sce1l'meous 1f:xcf1111ges LIC! MM? I M Pugf Stl 7 4 8 5 Adw.rt1sunu'1rs 2.7 X X ii X. Qi .., ,X alla.. S f ,1 ,I 'O 1,V 1 1 :TW ffifa M H M I f V3-x , U if--f , - -. .mg f 7 'H ' ' f I , f i :gs K , f ,, X f 4 4' '?T?'Er' er' ,J ' f , . . T' - f - 4-5 F1329 y?,1,'N.E-if X x 6 iigjjuef. l 1 :1 8 - H: , , 27,7 ' Q 2 . . 10 ,U K f Q ' 1 ' . , , . . , 11 Q 1 12-15 ' My 1 16 ?f . l if 1 -66 if 1 A 67-70 71-72 Q ' 2' 73-7 N ff 7 77-8 XX f f .1 4 . 89-9 Q0 X 7 K . , , Z Smisms 96 99 FX-- 7 ' - Y " A 101-110 - - xv...-,, ' 113 1-QWX N 'g'i'f1.'.' 7 1 I A 'f.'-LLz"c3L uvlf,-j..':y1 ' K I 1 5-1 I4 ?i:..5:7:' X 7 , ,, ,gf . 1 , 1 . ,D-X K ,1- ',.1d. ' 115 5 y .- , , 4 ' ' . f , X X . - I x . f ' 'a"s,- ,A 1l f -,. 77 f7 , Z4 -ay. Yr' S-Q. W5 U 1,141 f"ff 7 "J, 'i-2.21 4- X ' .-71-Q . .ff 7 fi--.-E:-1 '9.."-. -2 x f V ,,f' ' ff- -r 2 f' ,.:z'! ----r X vi .N ' .- -- - --'1 ,avi .14..,, vi E. . h, , ia ,- ., - ..1 1 f 4? 5- .4--"U f.,f:-- ,f M10 ' .' A ' 'f Il DMI Staff 111 lllfl 111 1 111111111111 'II IIIHIIN x x 11111N 1111111111 111111111111 1 1 NIa11 x 11116111111 I N I1111111 N IIx1111 1111x1xN I1111x-ox 1111111111 l'1l1f111 11xx11N Nlux A111 11111111111 I XIX llllll IHS Hill UIINN 'N II1x1111 11111.1xx lI111x Lx I uxwx li N xl Nh N XNUUI15IIXFI'I PRUIIIX Nlilb N l'1 ll 111l111111111111 11 'wk 11X1 I 11 1 1 11 Uxxlx NI11111 1 1 111 1111111111 1'1l1I111 111 XX1 111 111 5115 1 I11111 IIIII 111 N11 s XXIxN 1 N Xxx1N1 Page Lzght I I C H1111 - 'lirf lim" l'1:,x1,1. II11:-3 ,xi-1 'I' . 'sux W1 ,. I Ii 1 5 k'11,x111.1:s S'1'.x1.1.1.'1:s III11l,ICI' 1' 'su IC .I Q.-113 IP ,-... 4 I . I',1' . , . 'l'I.' A1. .111 ' Kf ' ' tim' . 11x 'I' . 1 J . A In i -1 .- .. II1 'I'II W.x111:1,1. III11I,Ii.' I' 'I.Ii.' El. ' .' . ":11 D1 " 'Hy 113 .I1'l .'l'I11'.1 I'l l ' l'- - -' Q I lZ.kISl'l'I'II I'-3..x1Ixx H11 14:11 ' 11111 BIA ' lf' v11,1-1 I 1xx'111111 IS1-1.111 l'II.l',AII-I'I'lI " I 31111 .'l',lAl'l.l!f lL'1l1'l111'.x AIH1l1l11' 1L'1l1'l111'x l'111l11'1'I11.wx '111:1'1N1-1 S'1'.xNs11'114:1.11 IC1. ',,x1s1:1'11 ' Jus Iixpx I"1'1,1.1-:11 I NI-lI,YN l.1-311:11'1' 1'11Ix111.11:s . 111,1. I'1.,x11x',' H11111'11 l.1'l 1' ll'-Il I:'l'I11'.1 ' .I I 'x ff If 'xl I ' '11 11x BI.-1 ' .' 1,1:v l'I1..1x1x11 I "" .mx I 113.xx111' II111'1:111, I'Ix'1-11,x'x I'l.x1'111.1'1'z BIA ' IS1111 111'1111'1' I IIAIIl,11'I"I4I-I Hx11'1'11 .I. -3. . '11 .Illl 1' IC11'l rs 'VII 111I111' l:'1I4f rs 'ff .I 'Q11.' I"11. .' ' S111' :.x11,t 4 11' . " IJ11 '1'11x' ' J 111111111111 111 11x 1 1 1 I11x1x I N N1 1 111 I rl 1 hX 111 x X 1111 N11111x1x1111 Q I ll 11X xkhk 1111 NX111111N Board of Edmcatwn of Baltmmore County S XII 1 I NI Num NINKLR Ijlfxll 1 f I ulcstrm xml x zalzrwr 5Ill110XXN10lYlt N1 uc UISII I lTOIlNXllf I xx lttlnm ui Imam x utr ll xxx If ilxnr n :Iv :fluff 1 and Nlljllllllfflllf IN HN 1 1 1 lffrmlulrf 0 1 N FRXINHRN XXD IIPII NI II' Xl II S Ilzylr Nflwol Izznzrny I-Illlllllllll NI IULIT-. N1 lx NI Xxx1ECRuL Aux I QREXXE Hum! Hum! Ihxxlf, In JESSOP I' xnxx I' una BOLHNLR Pagf X me Dram Nth Dedlzcuttwn IRANKI IN long dreamed of by residents of Rcxsterstown and neighbor mg communltles IS at last a realwatlon A capaclty crowd of more than one thousand taxed the 3L1dlfOIlLll1'l to overfloumg on November 71 1930 when the formal dedlcatory exercises for thus splendid bulldxng took place Nlembers of the Board of Education County COITIITIISSIOFACTS former teachers and prlncxpals of Franklm and the school superintendents of the county and state were among the dlSf1I1gL1lSl'lEd guests of the evening Mr Ernest E Wooden presldent of the P T A pres1cled and lntroduced the speakers of the exenmg Mr C' G Cooper superlntendent of the Baltxmore County Schools Mr S M Shoemaker presrdent of the Board of Education M P J Hoen member of the fourth cllstrlct Mr Frank Gwen County COITNTIISSIOII er Mr A S Cook former Franklin prlnclpal and now State Superlntendent of State Supervlsor of Hugh Schools Mr A Beane former principal made brief remarks concerning progress ln school facilities the memorable work of Prof Z C' Fbaugh and the late Mr R Russell ln connectxon wlrh Franklin of the past The formal presentatlon of the new bu1ld1ng was made by Mr Shoemaker and lVlr Wooden accepted on behalf of the communlty vtxth very approprlate remarks At YIFIOUS mtervals durmg the program most enjoyable muslc was rendered lu tht Glee Club Nlrs Guy Harden and Mr Kent Bellows IOllOXNlI1g the CXCYCISBS Elle YCOYLS of VISIIOFS Nl1O Cl6ilI'?Cl I0 EX'lI11lI'lC fl"lC l3L1llCllI'lg 'Ind Kl1C CQLIIPXUCFII XNCYC COl"ldL1Cfed fl'lC SCHIOYS O11 'I COl'T1plCIt, YOLIY of IHSPCCUOII Nlav all of the pupxls and patrons ot the neu Franklin as well as the old appreciate and use thls as thelr own 1116111 n Q l . . i -. -. 5 " CEN-- 9 1 N t ft ', I - 1 1 4.4 I . 1 Q I ' ' ll 'I - 2 a 7 -' 7 " 7 . . , h . . ., A , Q h . ' I . . .. . , . l , .. . . . , ' . K ' , r. . . , , . . ' t - . H 4 , . . . . Schools. Mr. R. S. Hyson, present principal of Franklin. and Dr. S. M. North, L , , Q . V . . , . 'f A ., 4 I ' - , Q . . an 4 K , K 1 - - , I . L K I ' - V - - K , 'K V l 1 . A 4 , . I 1 b ' X' ' , , .. 1. , r . ' . '1 L 3' 1 jr, .1 111' Bra 1... oo Teachers on Parade Q 1 111111 LY I 111111 1rS on 1 111 1 1 e 1 1 111 111g ll 'XI1r1l11ng n111r1ly L K1 fl IS CILII PTIHLI W I 11 511111111 111 gre 1 As l1e knows l11s I11S1or1 H1 m1gl11 gnc us 1 d11e 'Nou Il1lS IS 'XI1ss S1 ell bl1e 5 gentlc 1nd SXWLCI To l1e 11ugI11 sl1or1l'1'111d by l1er Is 1n unexcelled 1re11 XX I11 here 11 'Xfllss P1rSo11s Steppmq 1lo11g AS 1 loxer of muslc Qhe keeps UIUC 1111l1 1 song X111 Gr11 so pulre XX'e need 1,l1Sses to 1111114 Cl 111 1l1o 11111ll sl1e1 1111111 le1r11e1 Sw lknous uery IIIQFCI usl look 11 IX'I1ss T1p10n So full of 1llure 5111i r er XX e could 11111 C1es1r enelure IXI1 IXfI1CD0l11ld ls 11111 T l11m we must on H1 IL aches 1111 boys X11 '1lDOLlI 1l1e cow OI1 1I11s 15 lXI1Qs HUIIL!1l11U9F Init cl1oel11ulI of C1eer 11111111151 rl11 S1 'INS un ilu s11s I1 l111eS 1 Ql11l1es1e1r1 111 eornns 'Xlrs Reese I IXUTI 15 1 1 11l1 her 51111 1 p1r tl HELIX 1 1111111 XUFIIXI s oc IXI '1 1 LI ll 1 1 l1111,1 l70LlLlll4.l not 11111111 KIIIICIIIXJXN 5 ICPOTY Q IS l I9 All So Qm1l1111N 111el uolly IS our pxofeismr I I11ry1l11n1, O ogy 'XI1 lXILICl1lK'LL c1me 1l11S ye1r Ido co1cl1 1l11 I1o1s 111 gsm fX11d 1s they l151e11 closelx Nluch l1'1s been le1r11ed from 11m N4lSS Cox 15 nom 1.ppro1cl1111g 1 1 1 l11el1 1 bln Q 1I1e one 1 ho XNTIICS 1l1e 1111 sl1ps XVl11cI1 demde our 111e 'Il111 111Ll11rs l1'll'T!C I9 TI1on1pso11 uery one Suppcwes 1 1 lu LIXCS Il1y1 cs 1 no SlTl1ll Closes IXIN, ol I1 re I9 IXI11s QICTI 5, Axec l11r 111rm lion o1r XX11l1 her 19 1 1e1Cl11r Of Fr1111l1 me C111 1 11re FX I1111 s1eI11s 'Xlr f'ol1ur11 Upon l11r11 1l1e11' gl111eee stop It 1' In 15 tlu le11'11eeI g1111le11'11n XX I111 IL 1rl1eS ll'lCl'l1 5l111p 'X s 1111111 15 coml Ig IDIITIPIIHL 1111l1 51111 11r gy 111 l1sses 1 11l1 1er -Xre I11pp1 1nd 11re1ree our prLS1111 1e1cl1er1 I111e m111l1ecI I1 I5111 mon 111 comxm, 11e1r 1 1 1 ur 1c1e mrs 1 1l1 erues II 1 1l1 1 go 1 1 I1 JM W YILC 115 YT'I'lF11 4 1 INI 1,1 1 zo 11 1 XS ITIS K P U lp,III1 1 N51 s 11111 11rIo 11111 P IU 1 11 llfl O I 'CZK-' 1 I , 1 J X , Ulf ' clfo' ' CIM .l11.Zl 1lc nt r. XXI.-11--, N ' rl . Io 1' sw? XX" I 1 " ' 2 A p, rude of o ' 1. 'l 1rs, 'I'l1.11's . ml. 1 1 ' 1- 'I 'I' ' ' li Se -. I 1' 1 f ' ' '1 nl S1 -.1l11s '. ss l"I1ss. "I 1 -. -. l 1 1:1 l .1 . 1. , . ' '. . . j, Slxe J ' , 1 11I A' ,N - A ' 1 ff I . 1' . ' . :- K U K . y . 1 1 ' ' X H 1 V If 'A A I , ' ' ' A XX' tl . very ' ga 1. A Q ' 4 11 - - ' ' If: CI1 lay 1 1' H 7 xi B 4 - ' - ' - ' ' l- I1 . .. .I ' 1' ' ' , . 'l 1f e - ', ., . ln' 1L'.111,' ' .0. V. . b 1. :,M1 h K X K. . las: . '1 7, Fxw 1,-cl. A I "" XVI 1 , 1 "Ie 1 11' , . ' ,1 . X H I U x Hf' A I ' ' ' - 'I4l1ej.1'- o A 'l11, -cf '.I :H M " U' U5 'll V l' XX' I 1-11' In-lp v1-'1 e 11:-11 lere, II11' . ill ' 11'1Il1 1111- XX' ll lu' X I-4111-3 1'xY1.l 1 '1l11- 1.1 . 1- lr. . 'l 1'1'l 111. XX' - 1111. 411- l.11'l4 1 rlc. No I . IS fXI1ss I.1!l1ll'l', I,l'FlI.l s 1l1e p.1r.11lv 111ll C me . '. . IXS IIVHI 115 IIIII bv. 11 L' klKI Ill ,l Iflf 'I'l1.11 I1e k 1 1 5 I - I 111. Sc ' 1 '. I1's lmn seel Cfl.11'l Ill' S11111l1 IX' 'X ,f 1 ,-f X XXX!! x 1 X "'N"s2'-silky, if tltifg TfQ.nEl?R 011 47f P- F 'v ,- -Ur 1 jf 121 P"a 04513 ltr ,B N11 U1 FaC111t3 1 1 I I 1 1 I 1 1 ' 1 1 1 1 1 1 I1 I 111 1 X X I 1 X 1 1 1 1 Il I 1 I1 11 I l 1 .1 i Y - 0 C K 1' 1 1 1111111 S111'1111, 11Ii1',11C'1'.111iN'1' 11.111I1X115. 111x1Y.l'1'1'11111'I1111 11, 5, 151, -1111111'N IIH111111 ,111'1.11l 1", S1'1'1.1.1,, 1'11'1 l'1'1111-1,111 lI1,1,1',1,11I1111111111111.N11111'1111111'1 1 1111X1,Y1.11'411X 11..11..111I11x11,11 1 11. 11'1'Ni1-1'11 1111151.11111 11. S. 1141111'1-1111.1 111'11:11'111111' 1 ,11, 1'11111111111:1 .1. .11. 1'11111111111:1 l111'11 111,11A1f11111111111111w A111,'111111'1111'1 1 111 11-1111-11 A -11i'111I1I 1.,1'111.1:1'1:x 1' S- '1"1111N I11'1'1f11'N 11, S. 181 111 111N1111111' H111'1l'11 111111 511' 1111" ,1I11111111 11111.11 1111 , 'N 'X 1. , '1"'-'y1-1-1'-- 'X' 11111.11 11111.11 11131511 1 11. 1111-11-1'11.11:11'1'1a11111 . 1 , I WI! fl, A. ' .1.11.11111111'111-11 1111 .1 11111 A 11,xll' ll'-XMIM 111111'.111wr 4 . l 1 1 A 111:111.11.N1'1.1:1.1x'1. 1 11, 1111l11'11111 X It 1. I - H11111111, .N'1'11111'1. 1f11x11 111111 "X 'ULUWI I fl! 1f1l1111111l111'.1 M W I 'IH' ' -I My 11111N 11, 111'1"1'1QX111.1'I,1i '111-'lv'1"1'1'x'V ' E 1 13' 15,,W.1,,,. .1. 11. 1111-111121 xN11N111111.f1111111 111 1 lH,f1M.!, ,N1'l1111'1 I 1111g1g Ii, l,V1,1'111,11 11'11.1.1111 11.11'111,1:1.111: 1 11'1'x11-V11 411g11'-1'1g11111 11. S, 11vJlN1I111!'11111 1'11111'1l1" 1,1-11,1 X,11111,1, .1,11111111l1I1ll'.x' I 1l1.1.1. .1,1xx1,1' 111.Y.'1.I11 .11111111.1.11Q 1 11. 1':E11'11IiIIIl1111111'U'1'- 11, 1'. 11. S111-11131111111 1.11111 1 l'1l11:11'111 fg'1111'11111111, 1111-11 I'11v11.111'111 f','11111111111111, 1:11111 111111 1'1X 11111111111 111I.11111I.11i .1,'I1 1'1J111,11I1' 111-I1'111C'1'111'IX'1' 11111111.11.1YX1.-N'11'111111 11111111 1.1.1-11.1,1,111111'11:,l"1111'111111 lf 1111 1111 11'1NN1i1:. 511111111 11'1'11111 Xi.11.11. 11. 1i111:X1111. 7'111'1'1!11111 111111111111 1C..11x1.f..N'1.111111111111 1111.11 1: 1N11111.11,1"l11V111i1111111 1111113 11. S1.1,1Y. 51.11111 11111111 111111 1'w1!.1N 11. N1 '11 111 11'1-11111 11111 X 11. 111111. l"1A'1'111 11'1'1 111 11,1111 1,111,1X, N1 '111111 11111111 1111 XIQ 13, 11111 1 11'1N. l1'1'1'111 'Iv1'11'1y1 1':41'111f1i 51111'I.1f1. l"11'.11 11111111 11111,11:11'1' 111l1111Ir. l"11111'111 111111111 .11111,1. '1'1:1'111'. l',1,1'N1 111111 AK QX s l 'WS l Awww? X X K' xmww ff Q! ,tmk6 M FRANKLIN HIGH SCHOOL SONG VUL' sung no prwtse of Princeton Of V1ss'1r nor of Yile We ruse no college smndwrcl No college rnme me hull But where the mwples shwclows XX7lth n1tures lJe1ut1es throng Is Frinlclln Alm1 Mater To whlch we reuse our song Chorus Here s to the blue 1ncl crtmson Shout their pr11ses hugh Ever flow out lylnner Proudly tn the slay let the song re echo From the woods 'around And the souncl of triumph From the hills resouncl And to her hills ln Autumn Xvhen le'twes 'tre nd incl gold Wfe chtldrcn come from summer In forest 'md 111 mold And when tn soccer scrtmm1ge Ancl ltlfe 'incl joy run freelx As merrtly ue sing And nom thi! x tntcr s oxer ln 'worlc 'md pl1y 'tgitn Xve smncl hy her lurtght colors And meet all foes lllce mtn In sport incl pliy or stuclx Tht sptrlt IS the vtme Tt do our duty hmxely Anil plwy 1 Ml!'H1ll1L g1me I if -.X ff " 'ix 5 1, i if 3 1 'fr I pun Q. Z-E nwff H 's 1 M Ill Min 001-,111 ra A xxx ft' X, I ' an ' sA'- -f 1 . f , of sw , A fe! 1 Al fn". I' -543 ,483 x If I , f fb t , ' X Q I ff f ', - 1 '?:,J.xfs:'-1 'K K Y ij-1 Fay! K-1 :ww f . Y I , ' . ' . , ' l ' ' El yy . , E A . Y . y In .O Q I 4 , K' ' fflij s g L r 1 X , . V 44 , , . ' ft gf II. X ' n V f f xX X You hear our voices rung: , sc ,C ' v ' 1 , A III. , 'H H Q : , K V' , , ,m p as-E., ,577 L ' ' ' Q ,- f , - ' ' ' .. . f-5 ,f I ' 3 f . ' '. h . f' 4 't 'O I' t , ' , ,Q fi, . D 9 f I Q, i 23.35. -Lu i, f "fi-gf fi ' ,5.-.,.5 g1?'.:Ff'f' 1 V ,Y-'-P KB' Sz ff-f'fa.- ' , ,t IAEA? X wr- X 1 ig, hx 5 if , ' -QA", .J I? 5- ' -1' ' ' T. . ,df if f lguf l ' 1 ATX A ,1 1 1 , 1 1 :Sm rm' nw 4 mb To The Graduates FTER four years of assoclatlon ln work and ln play as teacher and pupils xt IS rather dnfhcult to wrlte for you anything that we have not talked over elther m the classroom 1n assemblies or ln dally conversatnons However I want to express my appreclatlon to each of you for your loyalty your co operatlon and your whole hearted efforts to make my work with you a pleasure In the western part of the Unnted States Colorado to be exact as you cross over the mlghty Rocknes you come to a spot where the dralnage system dnvldes one part flowmg mto the great Pacific the other mto the Atlantic This ns called very appropriately the Great Divide On une 18 the class of 1931 will also d1v1de each go1ng hrs separate way through lnfe some to make only a short journey before Jommg the Eternal group others to make the complete Journey Some w1ll have a Joyful peaceful passage others a rugged struggle that w1ll take every ounce of courage to wm Let your llfe be like a mountam stream gathermg strength as II courses through the rock, m the end bursting forth 1nto a mnghty stream that helps to make up the great oceans You have all the her1tage of a great people the ldeals and words of count less men and women who have gone before, you have the IIISPIFHIIOI1 of your parents who are rejoncmg wlth you at th1s tlme and you have the hopes and wlsh es of your frxends you have optxmxsm courage and the relxgxous tramlng of your successful happy and useful lxfe m thls wonderful country of ours Do you realize the OlJllg3Il0I'lS that you have mcurred through these forma t1ve years? Obllgatxons to your parents your family your state and natlon I am not thlnkxng now of the fmanclal srde but of love faxth servxce cmzenshxp and duty You are needed to help swell the great army of young men and wo men who are wlllmg to stand for the rlght to take an actnve and an mtellxgent part m cxvxc affairs and to prepare for responslbllxtles that must come when those now ln authorlty lay asxde thexr tasks The Great Drvnde goes on eternally separating thus person for this partncular work thus one for another task It IS hoped that all wxll become mxglaty factors rn CIVIC rellgnous educatxonal and economnc groups Your lxfe ns your own May you hnlsh wxth few regrets few sorrows and a feelmg that you have done your best Your pI'lI'lClp'll 'ind teachers MlSl'l fOr each of YOU 'I lift? 'I dyI13l11lC lxfe 'I llff flliif Vklll lUC'lSLlI'C Llp IL the standards 35 lard ClOW!1 the gffifebt Tedflflef of all H1118 SlI'lCCI'ClX RAYMOND S HYSON Prmclpal I ll I'Ill17 fr , Y' - O - A ein-- Q ' 1 a 1 V V ' V . 7 7 9 , . . I J , Y 7 Y , . , s 5 , . 4 , , youth? above all, you have your OWU f:lflT1 bellef in yourself that you Can flnd 3 Y Y , ' 7 7 , Y Y 7 L ' V' K h N . V t X I I , ll!! :Ill ll hmm 111' ii The Staff 5 Farewell 'I MMIII YLQ IS O I W III! IS IIOX All FL lrlit I1Igl"lIl1'l5 COINS tht. Cl IV l1'l5 gOIlL l5Llt pOIgI'Fil'lf 111811101185 llflghl' OH All O If IS with the Dl'1l me IDFLSCIII An emblem tl'11t x Ill never IL In the tlmougluts of frlends of Franklin Hlglml Editor 5 Note Xxllx sou iclxlsors in L lssmltzs true H mu 11 A ony xour nest D11 up IO our R inn BUY. And lf lixs met the test Your ceiseless help and coopemtlon Him nude the Dial go fhl'OL1bll So I Lan onlx expless mv '1ppI'6Cl'lUOI1 x murxnurxnb Mrxentlx l tlmn xou 111 X111 O v , J .jr 4 X lllf sux , gl ' g 'l :. it sinlas in tlw wp-st, ls il seal 1 the dal' l 2 , v K 'st. d 5 . ,. .. ,K ., V , A glowing seal on the scliool days wc've spcntg , , K V- , d-.Q Y 1 ? X H: L' ' I' .1 7 . K Cl nlzx. 1 2 ', It lqvyd '-.. 'lllmc 'gl l lds cd . l ll - BV' ' Y .1 " H K lc V' 1 P will' :Bi K Class Song In 1 school vw. hold so dear We ve wmtclud the years go by We ve trled to keep her name ever To make her honors llliilt the sky Classmates dear me entreat you To keep her standards raised To dear F H S be true And see that she IS alu ays praxsed C CHI' Pralse the rooms Pralse the halls the teachers who ve ably guided us Praxse the teams Pralse the games Praise the Sportsmanshlp that they taught to Praise the plays Pralse the songs the pep vnth whxch they endowed us Pralse the hours Pralse the days the joy whlch they brought to us Pralse Praise lraxse Class Poem We care not whether the road be rough Or the ladder we chmb be weak Cause our arm IS always to onward press Untxl me reach our goal The Peak Few are our number but great IS our mlght And to our colors vse vull stand true And herald the echo that soon me ll be there Wltlu 1mb1t1ons and ZIIIHS carried through At last me ll come to the top of the hlll To look around o er the great mde world And non tht thousands who are lolloumg on Wltlm the spxrxt of knowledge of south unlurled t htm that ue must rest an 11 5ut soon ut must journu on mtv Am x e sax to all our trxen ll tht oss tn xr s ml 31 Cr Donlld Qth I If I If Ltr , , r ., ' x K . . , y V , I , L ' A 4 . , 1 , t , 7 . . . , ' 1 A ' L I' . . . .' ' us. 1 . J 1 ' . ' . . ll l , , K v ' r ,T 7 ,r t 1 I ' W A V tt Y vw V ' 1 l l 1 . . x I ' g l 1 C I 1 KS n ' ' . A . K ' K -I . , , L R V L '- y " . b ' A - - 1 l V l I 's - t . ' ' ' . 'l le. . d v .. I' . ' ds "Hr l - B 1 4 d G lq L ' f ew." 4 . ' ll'l,' 'l nf I Y'fl'rfy .1 ltr Bra as THOMAS JEFFERSON JOHNSON Balnmore Maryland plum flu 1 mf unl Inu I E of en wonder what would have become of our class during the past three years without Tom s cxecutxv abllxty to carry us through our trials and trlbulatxons COMMERCIAL C115 So cer 27 Z8 Class Bascetball 27 Z8 Class Ba eball Z7 Z8 Class fraclc 21 28 Varslty Trac 28 Z9 30 31 Var slty Basketball 29 3.5 31 Varsity So ctr Z9 30 31 Varslty Baseball Z8 29 Student Council 29 Vice presxdent 30 President 31 Cla s Presxclen Z9 30 31 Science Club 27 Dial S aff 31 Dramat :cs 30 Athle 1C Assocxatlon 77 29 3.7 CARROLL PAUL MARTIN Uppercs, Maryland P1 ffl ll nf lllll srl IIIISSINSIUN me IIIIIIQ p usubla lllf0ll11Il1Slll1IllllS u ll gnu! mimi 2150 AUL n ver becomes ruffled when he ap pears before in audience but often ruffles ohers by h1s dry wu: As home room c axrman and reprcsen atlve Paul has m t approval no only of his classmates but of his teachers and principal ACADEMIC 'C If Cla s NICE president 30 31 Student Councxl Represen auve 29 30 Vxce presldent 31 Prcsxden 31 Home room Chairman 31 D a S aff 31 Glee Club 30 31 C ass occer Z8 29 30 31 Class Basketball 9 T 31 IS tory Club 31 Englneers Club 31 EDITH AUGUSTA BEALL Stevenson Maryland Il Il H1811 1 Ill n 1 In you IHIIS 1 of 1 s r fo niu s HIS polxcy Ede certainly has carried out as our Edltorm chnef In each of the four previous years our dxstnngulshei member has found xt her duty to perform the work of a leader COMMERCIAL Clas Secre ary 30 31 Class Treasurer Z9 Franlclm ournal 30 Suden Council Z9 30 Home room Chalrman 29 30 Hxs tory Club 31 Glee Club 30 31 Dial Staff 31 Athletxc Assocxanon 28 30 31 Operetta 30 Dramaucs 30 Welfare Club 30 31 Athleuc Pageant 30 Class Fleldball 29 30 31 Class Valley Ball 29 30 31 Art Club 30 Page Tu enty one O 1 ,I SIT II. Q 4. Sf? 1 Tu I V yu ' 1 ll I 11 zriu if. I . , . . . I I. 1 Y I . y , I '-- r 1 Q - 1 v Y , I ' , -. 5 v 1 v , I . .I , . . , I 3 'R Y 1 Y 1 - s v 1 I 1 A 1 , 1 1 NI , y , , , . , I . . , I Y - 1 . , I I . I , , , I I " ' 3 U 7 . , I . I . I Y ' Y 4 . , I I. . . . . , ' 3 ' L Y Y ! Y 31. rf ' 'mf :vs I ' ' P 2 - . li ' ' ' e . , - nh: '. : II ,. I . , , I . -' 1 v v . ' ' ' . ' ' ' . ' Y I - 7 . I , I - , I ' 5 ' Y ' . ' . ' ' . 1 1 . , , , 1 C , . , . I R! 9 9 ! 3 . . . , 1 28, 2 , 30, 315 raclc '29, '30, 1 5 H - , , , , 3 . Y If Ill 1 Ihi1I I lr flu ' uw-ll, I rl fl: il Iu Il'.Vl'lf,' yu: mum! mf ll'Ill'I' il I . .. ., . . , , .- . I ' . ' . " t 3 7 1 , , . , J 9 I I , , I - , , I - 7 - 7 7 1 y I Y , I - , 1 , , I - . - , , , , y , I , I . , Y 1 , . . I - , I , Q , . . , , I I - y v , V , , I , v , , - TT ltr Btal ELIZABETH LOUISE BEASMAN Relsterstown, Maryland Ilusu' htr soft assuasne wwe appllfs ff EASY 15 one of our dependable s pranos and we cannot forget the parts she has played tn operettas as well as dramatncs It seems qulte strange that such a smger should be so interested lh hxstory but you should nottce Llb when Mr Hyson tells about Charles I Yet whether nt ts htstory or music we know Beasy will not dlsappoxnt us when she launches mto her career COMMERCIAL Treasurer 30 31 Good Cmzenshlp Club Z7 Glee Club Z8 30 31 Sctence Club 27 Operetta 29 30 A A 30 31 Treas urer A A 31 Varsity Fleldball 30 Home room Secretary 30 31 Art Club 30 Franklm ournal 30 Class Basket ball 30 31 Class Fxeldball 31 Pageant 31 Dramattcs 30 Dtalstalf 31 GEORGE MARSHALL ARMACOST Upperco Maryland II: lnous 11,1111 s uhat and that .s as high els Illlfllllllljxll' u lt can ly O look at Marsh one would thunk he was the most serious person tn the class But no mdeed Marshs dry remarks are the source of much amusement especially French class In Glee Club he has proved tn valuable for he IS one of our chief tenors Best luck nn the future Marsh 1 ACADEMIC Latm Club 28 Z9 Athletxc Assoclatlon Z8 29 30 31 Glee Club 30 31 Hxstory Club 31 Engineering Club 31 BLANCHE LAVINIA ABBOTT Owings Mxlls, Maryland Ull llllslllisx ru Hz full! uf qht Is not In quzstwu but to prom our might ES that smllmg black hatred g l Blanche Blanche IS a fine stenographer and we expect her to go far tn the bust ness world She mxght even become a wrtter for her wrntcn English ts of fine qualtty Blanche sets her standards hugh S e s busy conscientious worker and always achieves that for whlch she ts strxvmg COMMERCIAL A A 79 31 Dramatlcs 30 Home room Sec retary 30 O ' 00 -.- .. p 1 x .'n 1 I 1 .1 . . . , . . B H 1 0- , , Y . .Q - H .. ,, . - l ' 9 . .1 H V . - , , , , -- . , , , , , , , , I - , , 7 1 7 7 , , l 1 , , , , - - , , ' . ' ' ' . - - 9 1 , , , ' 1 1 , . I - J , , 9 3 - v 1 I - s , , , , , , - , , - , , , - 7 1 - v, - Y. Q 7. ' T .. H - - , - .. , H D , ' m , . ' li 7! , . A , , , - . - , , , , 1 r 1 G x 1 I A 7 ! 9 Y Y , I - - , , . 1' .' 4' ' fit , Y , , - nr ts ' v ' s . h 1 a 5 1 . . 1 . . . . - , , Q - - Page Twentyetwo 'CON 1, 1111 Bra EVELYN GRACE BAUBLITZ Owmgs Mxlls Maryland Illllllll 111111 1111 11111111 I111111l1x 111111 111111 I I dll UU llllll 1111! O you hear some laughter? ust a glance m that dxrectxon wlll reveal a very dark haxred brown eyed gxrl whose pxerclng laugh can always be heard above all others Yes Evelyn IS mdeed happy go lucky And can she dance? Well you should watch her at lunchtxme Her sunny dlsposxtlon wall l ways be regarded among her oher sterllng characterlstxcs as one of her greatest assets w are sure COMMERCIAL Sclence Club 28 1-llstory Club 31 Dxal Staff 31 Dramatlcs 30 Athletxc Assoclatlon 9 31 Glee Cu 1 EARL ELWOOD BEAM Garrlson Maryland 1 llllllll I11l111!s 111 hu 11111111111 11s1 1 11I1111s 111 11111111111 ff ooP A BOOP A DooP 1 what 15 that queer nolse you ask? Why thats no nolse that s Elwood and hxs sax lroadcas mg the latest jazz Elwood lS one 0 our mos versatlle classmates for he can do nyth ng from playmg basketball to tootxng the sax He has taken a leadlng part nn our Glee Club operettas and orchestra All xn all he has been of great value to 31 ACADEMIC G1 Club 30 31 Orchestra 29 30 31 Var sxty Socc r 31 Dnal S aff 31 Class Soc cer 30 31 Secretary of A A 31 Oper etta 30 Student Councnl Z9 30 Class Basketball 31 MARY ELIZABETH BENSON Upperco Maryland 1 I 1I1sf'1 s most 1r11II1111 11111-1 HAT blue eyed curly haxred mxss IS our Meb Who could take Mary s place m playmg the accompaniment for our Glee Club and assembl1es7 Meb excels ln day dreammg and nt has long been a dxsputecl ques non as to what she sees when her eyes take on that faraway look Perhaps she 15 seeing v1s lons of the school room over which she hopes to presxde some day ACADEMIC Athletic Assoclatxon Z8 Z9 30 31 Lam Club Z8 29 Orchestra 31 Hxstory Club 31 Glee Club 30 31 Page Twenty three O 1 Y E I . 1 V A , .I A , H 1111, 11 K ll 1' ll '. , I . , 1 A nl' 1 ' ' ' . - . .. . a- . . 7 ev 1 1 . - , . . 1 , , I . , l . . . 1 , '28, 'Z , '30, ' g l b '30, '3 . I Will 1- 1 .1 1 IIII, Uf 0111 '.", l11".' '1' .1-' ' ' I." B - - A - 1 I A 4 . ' T 7 . 1 I! 77 z' ' . ' f - : ' , 3 5 A 11 - H 11 ,, . . 5 7 ' . 1 M , . I , 1 1 . - 'L' A 7 ,Y A ,I 7 Y 2 g : 5 - , . . . 1 l 1 1' 1 I -Y - Y 1. 1 3 1 1 Y "It 1'i .1 11112111 .- '. -' 1 .i1'." I Y! 7? - , . 7 ' - .1 ,, - - , ' . ' - ' ' ' 2 ' 3 . . . , , , . y ' , , , 9 I , 1 A 1 Z S ' 'W ' s . v 1 Y 1 ' H ltr Btu mt, LILYAN IRENE BECKER Owtngs Mills, Maryland l :ut uzll b uzll 1 ff IL takes thlngs as they come always ready for anythm Oh yes we must add that she does her share of talkmg and gtgglmg She ts one of those delxghtful carcfree personages who hlde thexr wort-nes from the rest of the world We are sure that xn the future Lllyan will be very successful as she ts a regnlar little worker when she once gets start d Best of luck Ltly Ann' ACADEMIC Gee Club 31 Latm Club Z8 29 History Club 31 Dramattcs 30 Athletxc Asso c tlon 28 Z9 30 31 EDGAR PAUL BELT Relsterstown, Maryland Britt! late than 111161 HERES Edgar? Dont worry hell be here Look for hlm an hour after the destgnated ttme and then you won t be dxsappomted Well he may come late but when he finally gets here he I5 sure to make up for the t1me he has lost We are sure of one tlme ln the near future when he won t oe late and that is when he IS climbing the ladder to success COMMERCIAL Class Soccer 28 29 30 Varsity Soccer 31 Class Track Z8 Z9 30 31 Dramattcs 30 Varsity Track 31 A A 28 29 30 31 Class Basketball Z8 31 Glee Club AGATHA JUNE BERGE Relsterstown Maryland Slu may nlfuzn some lnqh dfglcc lu I tuus 1 1 I same ff GGIE IS a blue eyed lass who may not be makmg a great dnsturbance but a glance m her dxrectxon wxll probably reveal a mschtevous twmkle m her eyes Ah' thcres the source' It xs most natural to see Agatha with Doris The two have gone hand nn hand through the years at Franklm May ILIIS friendship prove valuable In the life that ns before them GENERAL Glee Club 30 31 Athletic Association 78 29 30 31 Latm Club 28 . CCE!-f " VI 7' 12, " bf." ,, . . Y S' , 1 . - , H - H e . , - . l 7 . ' 7 Y . ' L ! Y 7 y , - 1 , - 7 9 ' - - , , , , la , , , . , , , ' I .' . , I 1 ' 1 Y , . - - ' a 1 , , y , , ., , l , , , , Y , , , , - ! Y Y 9 f , - , I , , , Y K 1 ' ' Y 7 1 , , , , I , , , '31, . 7 1 ' 1 - 'fl A I 4 3 A 3 Y Bn! .s "I llll' rwnuiz lu' .' ' "A, B." 4 ., . , Q . . . , , . . A. . . , . ! 7 " 7 ' H , 4 1 1 , , , , 29. Page Tuenlyefuur IQ, 111' :BIG as-13 ALLAN MYER BROOKS Relsterstown, Maryland I uzll 11r1rr uzth Ullllllk rmpossz E en rf! llu bfllcr of tum AN T you ge your trxal balance nn book kccpmg Go to Allen for he can gnve you some very valuable asslstance Yes 11' xn all Allen 15 our best bookkeeper and he 'always manages to keep a month or two ahead of the class He says he 15 gomg to work for hrs father next year so we can see a prosperous future for the Brooks Department Store COMMERCIAL Class Basketball 28 Z9 30 31 Class Trac 28 29 30 31 Class Soccer 28 29 31 Varsity Track 30 31 Glee Club 31 Dramatxcs 30 D1alStaH 31 A A 0 MARY VIRGINIA BROADFOOT Dehght, Maryland fomr' and frzp 11 as you go On the hght fantasize loc AP tap tap' Could ever anyones feet move more qulckly and yet keep better tnme than do Ch1ckens7 Of course our Chicken has some cherished dreams for the future and though we have little knowledge of what they may be we know success cannot fall her COMMERCIAL Ahletlc Pageant 29 30 31 O eretta 28 8 2 30 31 Class Fleldba 1 Class Baske b1ll 31 Dual Saff 31 Glee Club 30 31 Welfare Club 31 Varsity Basketball 31 Hxt Ball 30 EDWIN LE ROY COLE Fowblesburg, Maryland Happy am I from fare I m frm 11 hu :urn t thru all c'nnlf'ntuI him If ES Ed 15 happy never does he seem to have a care ln the world-except when he cant get trxal balance ln bookkeepmg 'md thus happens very seldom Ed has ta rn an ln erest m music so he has joined the Cvlee Club thus year he really has a good bass voice you know and often we hear hum sing Oh Ka herma COMMERCIAL Class Soccer Z8 29 30 31 Class Basketball 9 31 Spee all 9 Track 28 29 30 31 Dramatics 29 30 31 Latm Club Z8 Z9 Hnstory Club 31 Page Tumzty yhc 'CON 0 1 1' E' -. 21. if Y . K , , 1 1 11 I C ' f ' ' ' . , . . , ' ' Y K A 3 , ' y . 1 1 1 - ' 1' 1' 1' 9 , lf 1 Y 1, 1 ' 1 Y 3 ' 1 1 301 1 I 1 1 1 I 1 I 7 ! ! 7 - 1 1 1 I 1 g , . . 28, 29, 3 , '31, 7 I 1 1 - - 11 - 1 11 ' 7 1- 1 11 - 1 1 I ' ' 1' 1' 1 P ' 1 1 . 303 Dramarncs '30, '31g Art Club '30g A. A. 'Z , ' 9, ' , 1 3 ' ll ,3 g A , o ' 9 I 1 1 1 I V 1 I ' - Y D 7 ' 1 I 1 1 . . , , 1 7 1 1 ' . nu: 11 11 1 I 1 1 K - 11 11 ki g t . .v . . . Y -L , , ' ing " , I ' H. 1 1 1 1 I 1 1 1 1 1 1 1 1 1 1 1 1 28, 2 . 30, g db Z , 30, 315 1 1 1 1 I - 1 1 1 1 1 1 1 1 I - 1 1 I - Y Y Y 3 Y 1 .bm Ai ANNA ELAINE BUCKMAN Plkesvllle Maryland If Lnoulrfqe be Ihe mari. To know ther shall SIIFIFC URLY lnght haxr slum not so tall and al ways neat as a pm thats Elame On would naturally expect such a descrlptnon to apply to a gurl who ns fond of dancmg and m this case xt does Elaine ns one of our brnghtest un all subjects but ln commercnal work she excels COMMERCIAL Class heldball Z8 29 30 31 Class basket ball 28 Z9 30 Boys Opererta 30 Pag eant Z9 30 31 Art Club 30 Athletuc Association Z8 29 30 31 Dramatlcs 30 Glee Club 30 31 Dlal Staff 31 Franklin ournal 30 H15 ory Club 31 Welfare Club 30 31 GROVER KENNARD COOK Pelsterstown Maryland Uzih my qzutar 1 II .strum your blurs auuu ff OOKIE IS right on the job with hxs gultar and smgs your blues away How ever has abllnty doesnt end here Draw Prmt' Can he do these? Well I guess Isn t his part ln making the Dral a success? ACADEMIC Engineers Club 31 History Club 31 Latin Clu Z8 Z9 Track Z8 29 30 Oper etta 29 30 Dramatlcs 28 31 Franklin journal 30 Art Club 30 Student Coun cll Z9 Class Soccer 28 D1a1SraFF 31 Atl'1let1cAssoc1at1on 28 29 30 31 Glee Club 30 31 Orchestra Z9 30 HELEN VIRGINIA CROUSE Owings Mills, Maryland If :mul mllcd Tml lrruis fo H llfll fullul Siwcrss ELEN ranks among our more studlous members She xs seldom seen without a book for nn her studnes she faxrly shmcs Helen expec s to major nn math when she goes to Goucher In the future we hope that ln counting up her frxends she wxll not forget to add ln her old classmates of Franklln ACADEMIC Glee Club 30 31 Athleuc Assoclatnon 78 0 31 Lxbrarlan Z9 0 31 u dent Council 30 31 History Club 31, Engmeers Club 31 O ,xv IKM- 1 ' . . lv . Q 1 I I A Y A Y Y - C ' ... ' ' e l I I 9 1 , . , - 1 1 1 r , ' - , , , , Y ' ' . ' - . v 7 Y 7 , , , I , , - 1 1 1 5 - A 1 a v s I ' , , , . , - , , , - , , H 9 3 V . , U .L . . J , - , , , , . ' Q " ' I r. u C gy . . . . . . . . , l I V , . ,. . . , . xt wzth these talents that he has ccrtamly done - , , , - , , . . , , , , , , b , a , , 9 - , , , - , , , - , , , . , , , , v 1 ' I I u I 1 I I - , , , . - - , , , , l 7 7 7 3 , , , , Y I i Y ' Tl ' ' . I 1 ll' '. 1 ' ' I ns . , . z . . ' v .. H . . , . - , 29, 3 , z , 3 . 2 51 - 1 S ' . . , Pug: Twenty--six Ax B SHARK JAMES FREDERICK COLWILL Plkesvllle Maryland Rf plrnvm! vmfzl for n 1-Ind ln fhf lllfiflllllll :nfl Ihr ns! 0 the rlny ZLIII frlltf mrs ff ztsrl RED IS just a happy go luclcy boy who talces great delight ln being a tease If he IS not teasxng someone then hes arguing wlth somebody else But all m all he s a good sport and 15 well lllced by everyone ust thmlc what would happen rf there ever were a class mmus a tease or two COMMERCIAL Cass Soccer Z9 30 31 Class Basketball 30 31 Track 29 ELEANOR BRUEHL Relsterstown Maryland Do as you uouhl be done by Iorgft and forgzw OW true' Elly IS ever wlllxng to forge and forglve No malice does she hold agallst anyone No lndeed and as a result her enemies are few and her friends many Ou: petite lille features m dramatncs rho operetms and ns a regular member of the Student Council In addition to these extr1 actlvltles Eleanor has proved a very capable manager of the Lost and Found ACADEMIC Councll 31 Pageant 30 31 Operetta 30 Dmmatncs Z9 30 31 Latm Club 78 Z9 AthletlcAssoc1at1on Z8 29 30 31 History Club 31 GEORGE CARLISLE GROTHE Relsterstown, Maryland Ha qmnf tllflllillljll In hm! murh uit uns Ill shy about u ng LUE eyes brown hair and a quiet manner thats Grothe Hls carefree way and re1dy wxt are two of his greatest assets Hes 1 good sport a brxght scholar and always ready to help wherever hxs servnces may be rendered In fact he IS well lllced by all who know htm 31 IS predicting a successful future for George COMMERCIAL Class Soccer Z9 31 Class Basketball 29 31 Class Track Z8 29 30 31 Glee Club 31 Dramaucs 30 Latxn Club Z8 29 A A Z8 Z9 30 31 Vars1tyTraclc 29 . . , , , r ' , 7 1 - ' ' - , ' . . , - , . . I , , 1 a 1 v . . - , , , , , . ' 7 1. , . . I ' s 77 : . ' , U . H - 4 . ' 9 . ., . . . . . , U ,, Glee Club '30, '31g Dial Staff '31g Student ' s ' , 9 , , - 7 y , , - 7 K 7 7 7 , , , - - - y , , e , , , , , , , . , , . Hr ' ' rr 'I .' 1.'i l Aff. B I + R Q , U ,, - 7 . 4 . K I V7 . , - I . , . . . , , . , . l , , , , , , , Y , , , , , , . - , . - , , , Y 7 Y Y , y 7 , , - , ' ' Y 1 7 Y 7 '31, Page Twenty setfn ltr :Bra ...1 A 'C K P11111 .Tu VIRGINIA GERTRUDE CAULFIELD Woodensburg Maryland Thu! Um 11111110 mrmbr-r zs most care we 11111 11111 of us must hmllzly agree F a :ruth Ginny certaxnly doesnt bur den herself wnth the task of worry There ns no need of her worrym however when xt comes to English for her abxllty to use the correct phrasing 1nd the concrete word xs un doubteclly one of Natures gxfs Of course we all know that 1 few pranks will creep Into G nnys cuxrxculum for v1r1ery 15 the spxce of llfe ACADEMIC Science Club 27 Glee Club Z7 Latm Club A A 7 Z DONALD GRASON HAMPT Upperco, Maryland 51117100 19 the perfect herald of joy ONALD lS one of the few people who knows when to speak and when not to No n could ever accuse him of was lng words And let us tell you somethlng hxs lb 1 deep dar: secret Donald IS a racllo bug No only that he fairly eats up physlcs He has the dearest little dlmple and the sweetest llttle curl whlch make him the envy of every single g1r GENERAL A A Z8 29 30 31 Class Basketball 28 Clas So cer 31 T ack 29 30 28 29 Science Club 31 Hts ory Club EVA EILEEN FULLER Pxkesvxlle Maryland 1111111 fllllll 1 not nh an fl s 0 rlmnsz lt 411 0111111111111 MILING dark eyed Thats Eva Her llght splrxt 15 most con agxous for all nn her company have a good txme She pos cs es an undying Franklin spxrxt and an am lation to becom 1 nurse No matter where he m y go for her tr'un1n we feel sure her F characterxstlcs which we know so well cinno be overlooked so we can predict only success for her COMMERCIAL Cl1ss Basketball 78 29 30 31 Cl1ss Fleld 28 9 2 3l Welfare Club 30 3l Home room Vice chairman 31 Dramatlcs 30 D1-11 Smff 31 111111 flyllf Q O .. X 55 'M' , Q me - sv 1 v 1 1 3 1 I gy. . , Y K 3 I . ' 1 - , . . , 11 5 1 11 l - L vr l - 1 - . , 1 ' 77 . , . , D . 1 1 1 1 1 1 1 29, . . 2 , 28, 9, 30. nl' ' .1 ' ' . o e ' :' ' , . 'G' I 1 , . - . : , . U , . . . l. 1 1 1 1 , 1 - - 1 1 1 1 1 ,313 I s : ' g r ' , , , '3lg Varslty Track '28, '29, '30, ,315 Latin Club 1 - - M ' 1 9 ' 9 - ,3l. . . , S11 " 1' A1 ' 'I' 'x os' fr' 11.', 11' 1 5 1 - A A t 7 f 4 2 1 . 5 a . ' ' g, .ne 1 ' ' , ' ' , . 2 , 1 ' ' , , . . ' . . 1 1 Q 1. , , , , . - ball , 2 , 30, '3l: A. A. '28, ' 9, '30, I 1 F ' 1 . . . , . - 1 3 . . 5 . V 1 Tmsnfiam T FRANCIS BREAM CLARK Garr son, Maryland Lzfe 18 not so short but that thfre 1.5 tzmc fm courtesy ERES proof that good thmgs come tn small packages for although Frances ns small ln stature she makes up for n. m other ways Frances possesses the most umque giggle but she xsnt all foollshness Can t you just see her standing before a class of lxttle tots who gaze admxrmgly at their favonte teacher whxle she tells them some mteresung lnttle story? ACADEMIC Gee Club 30 31 Latln Club Z8 29 History Club 31 Ath1et1cAssoc1at1on 28 Z9 30 CHARLES HUNTER FREENY Stevenson, Maryland 1 Illtlf nonsrnw nou and thin ls rflzshtrl by the uzscst mrn UNTER xsnt all nonsense not by any means' Hes proved quite an athlete just glance at hxs ECIIVIIICS Oh yes Hunter qulte often furnnshes the horse power for Guys gasolme eater and we must say that he s certamly been a faxthful fellow ACADEVIIC Varsxty Socc r Z9 30 31 Varslty Basketball stty Baseball Z9 30 Athletic Assocnatlon 29 30 President of A A 31 lce prestdent of Student Councll Z9 Glee Club 30 31 Dual Staff 31 Class Soc cer 28 MARY ELEANOR POWBLE Upperco Maryland mnru hunt you all Zhf day H Black haxr black eyes wlth xmps m em red lips n everythxng Woulclnt Mary make a charmmg senorxta" Wfe must not overlook her talents either She can draw just notice her handword m our Dia She takes a pencil a lme here a curve there and presto' we have a magxc drawmg ACADEMIC Latln Club Z8 29 Glee Club 30 31 En glneers Club 31 Athletxc Assoclauon 28 29 30 31 Class Basketball 30 31 Operetta 30 Glrls Welfare Club 30 31 Dual Staff 31 History Club 31 Art Cluo 30 Franklm Journal 30 Q' 1 , ' I' 1 I ' , , t , , , V , , A - - , , , , , , . . - , , , , 7 7 7 7 31. . , 1-1 , ' . , - , .1 - ,, , , . . L A A , , , . . 7 9 Hs ', , 7 , Y 3 ! 29, 30, 315 frack 28, 29, 30, 315 Var- . , . , . 7 y ' , 9 I . , I . , , . - , V - . , , I , , , . - , , 7 3 ! - , . 9 A ,. I , . U 4 l . , . . . . ' ! A , . , . . , . D . , ' . . . . . , , 1, 5 1 - y , , , , , 1 1 r : ' . , , Q . . . 1 , , , , A , f , Y Y Y 7 Y 7 , , - , , , , , , , . , l . , I . ! 7 1 . - J , . Q Page Twenty mug ltr 4 ra I GLADYS GENEVIEVE GOOCH Relsterstown Maryland To lzlte a thnzg 18 to do tt ue!! O we dare thunk of the Student Councnl wxthout Gladys as nts efllclent secretary? Never' But we know her good secretarnal abxllty cannot be overlooked when she has left dear old Franklm COMMERCIAL Home Room Secretary 28 29 Home Room Vuce chalrman 29 Representatlve Home Room 30 Secretary Student Councxl 30 31 Secretary Athletlc Councll 30 31 Varsity Fleldball 30 Class Fleldball Z9 31 Class Basketball 30 31 Glee Club 29 30 Dramatxcs 30 Dial Staff 31 Welfare Club 30 31 Athletic Assocla n Z8 29 GUY TYSON HARDEN JR Owings Mills Maryland I he in It 110111 qu 9 Ile IS a member of 1' H S OU be ' Guy wlll be there and fight and root for Franklin Basketball season comes and Guy goes nn for everythxn 111 But Walfl Guy has us down when xt co nes to history fo well he just can t be beaten We wonder lf Guy will excel m this at the Naval Academy ACADEMIC Varsity Soccer 31 Class Soccer 29 31 Glee Club 31 Hxstory Club 31 at nn Club 28 29 Dual Staff 31 Athletnc Assoclat on Z8 29 30 31 OLIVE GERTRUDE HOFFMAN Upperco, Maryland ll t or u qw' lf 1 ll bad one T would be foolish to 'ask Olive wh1t she likes most at school for everyone knows xt s 'athletics Olive 1115 won awards for het 'achievements m thxs actlvlty and everyone lnows why she IS wearing that Fr1nk1m I' Per hmps we shall see her ln the near future teach mg the rules of these games which she knows so well COMMERCIAL Athletxc Assoc:-mon 28 Z9 31 Cnss Fne ball Z8 29 30 31 Class Basket a 28 Z 30 31 V1fSlIY Fuel ba 30 31 Varsity Basketball 31 GleeL1ub 30 31 Dramaucs 30 O ei N Y E' -1' Y , , . , , . - . , . . v ' 1 - 1 y , 3 . - , , f , , 1 . . , i . , , , , 3 , , , Q , , , - , , - , , , , , , 1 1 I - - ' , , tio ' , ' , '30, '3l. , . . l A. , s , ' t cs., EZ :. ' , . I. 1 . A g A nt. . 1 . V . , . 4, 3, . . . I ' , 1 g ' , '30, ,313 Class Basketball '30, '31g Track 129 '30, - , I 1 I 1 2 QL - - v Q - s ' , 5 3 - J , , , , A 3 7 ! ' II is just as rwsj n f rn A :I Ubi! is , C - 1 4 I L ' ' I I y L r , I 1 - Y 'ld 7'-' ' ,' .'30,' Q '- . , , , b Y , v , 1 Y v v I' - fd- v 9V v 1 ' K , , , A , I - , ' , I - y ' 1 7 ' Page Thirly TE ltr Bw st, CATHERINE GIBSON HOLLINGSWOR I'H Relsterstown Maryland Tlzfrf 18 always sonzfflrlng to bc thanltful frr OT alwavs does llfe go along like a song stlll Catherine can see the brtght slde and be thankful that the sttuanon IS no worse Wherever her services are needed she most wll lxngly offers them Especially anxlous IS she to help when the task calls for a good seamstress Catherine expects to become a nurse and 51 extends to her an excellent recommendatnon ACADEMIC A 0 Glee C u Gtrls Welfare Club 30 31 Engineers Club 31 Class Basketball Z8 Z9 Class Volley Ball 31 HARRY WILSON HOWELL JR Pxkesvxlle Maryland He uho lure uzll sec What Harry zs gmng to bf O one can tell what professlon wxll claxm thxs blonde l1cl for Dxd you hear that banjo stram" Of course' Rlght tn Room 9 Harry 15 entertammg a chanung audience wnth his banjo Harry takes great Interest m Glee Club and really has a fine bass votce Such talents we are sure will carry htm safely to the top of the ladder ACADEMIC ee Club 30 31 Track Z9 30 31 chestra Z9 30 31 Class Soccer 30 31 Class Basketball 30 31 Operetta 30 Dramatlcs 30 En meets Club 31 A A S Z8 29 30 31 Frmklm ournal 30 Latin Club Z8 29 DORIS EVELYN KIEFFER Relsterstown, Maryland 111111 Dnrzs 111111 hrr cheery smzlr' Brzgllffn for others' nach uearu mzlf D ID you say you heard a commot1on7' Well then Dorxs had nothing to do wxth 1t for never an out of the way move will thts qunet maxden propose By her no one ns sllght ed and her smxle IS so compelling that you feel just a little kinder toward humanity Doris contributions of llvlng maternal ln the Biology class have been very useful and xnterestlng ACADEMIC Glee Club 30 31 Athlettc Assocxatton 28 Z9 30 31 Latm Club 28 Z9 Page Thrrty one 'Cal O - X - 9 I Y 1 7 Y , . - , A. . '28, '29, '3 , '3lg l b '30, '3lg V . Y y , - y I I 5 , y y 1 v l , , . , 1 , 1 l , y y , GI , ,' 9 . ,' 501'- , y , I y f , , , y y f 1 n . v I , , , . y - l Y . 4 y , . 'y 0 - ' 1 , , , , - J , . , , . , . ' 7 Y , . . , . ,. . . 1 , Y . - - - 7 y 1 Y 7 Y , , . - y y , y , - I ?- Want ami t l. EVELYN VIRGINIA LEIGHT Fowblesburg, Maryland I qnml unrri IT as mon Gaul as nn 111 our HO IS that gentle brown eyed lass? Oh thats Evelyn one of the quxetest -md sweetest members of our class Oh oh w1lt a minute-do I see a twmlcle xn her eyes? I thought so Lllte all the rest she ln clulges nn those school gurl glggles When E gets hold of the pxano at lunch tlme you just feel un 1 dancmg mood whether you want to or not ACADEMIC Glee Club 30 31 Latm Club 28 29 Ath letlc Association 28 29 Dua Staff 31 Hxstory Club 31 Glrls We fare Club 30 31 EARLE HERBERT LONG Rexsterstown, Maryland II fs such a frwnd and such fl smile' Il huh mal.: thu 0111 uorlrl a plan 1101111 ulnlv OOT TOOT' A tram has just arrlvecl fellow hops off to ,nom our crew Though arle just enrolled m anuary 1931 he has al ready won a place xn the hearts of all Earle has taken a special interest m agrxculture and we feel sure that m the future he will be suc ccs ful m further work along this lme GENERAL cxence Club 26 Radio Club 27 28 Dram atlc Club 28 Z9 30 31 School Paper Sta 31 EDNA EVELYN LOCKARD Relsterstown, Maryland S111 15 nluaus srhrmlnq srlnnzm 70 Inzqlatnz nfhn prnplf s rlrmms HAT quiet girl wxth such darlt eyes and be wxtchmg smile IS Evelyn Loclcard IS dxg n ty m Itself but that doesnt prevent her from havlng a good txme Goodness no If you feel a little under the weather go to her for she can surely give you some pep Shes 1 real sport and a friend to everyone We are sure of her succ ss ln whatever vocation sh chooses COMMERCIAL Athletxc Assoclatxon 30 3l Dr-amancs 30 Glee Club 30 3l O . is 4 X SE -1' I 1 ' - v Val , . , . KY V!! ' I . ' Y , , , - 7 , , - 1 ' -7 , , , Y , 1 A - , , 30, 315 l s I V v , - v 1- , , , , , . T from Thurmont High School, and a young E A -. J 1 ' , S ' ' : ' ' . ' ' - - x 1 y y . I 1 , y , ff ' . A' r '-n 1 I. '. D I ln , 'n I .' 1 la f , 7 s u Q ' ' , ' ' ' v Q . , . v , v 1 1 S y , , . Page Thirty-lu'o fl ltr :Bra .fm ANNA LOUISE MYERS Upperco, Maryland To fhusr ulm Luau flue no! no uolds can pam! I thus: uhu Luau thu Annu all uords are am! OUISE cinnot be palnted ln words But she can however be called a valuable ad dltlon to our class She will we are sure make a good commercnal teacher for her Hne talks on vocational subjects have proven thxs Everyone hlghly respects Anna Louise for she does what we can say of few others practices what she preaches COMMERCIAL Ath'et1c Assocnatnon 28 29 31 ee Club 30 31 Dramatlcs 30 31 Latm Club Z8 Z9 I-llstory Club 31 Home room Vlce chairman 31 President Girls Welfare Club 31 D1alStaE 31 CHARLES DAVID MORRILL Relsterstown Maryland lu :mf ls fha 1 ll uwrllf hobby 1 Pal cz' LL thls ns qulte true but the memorxes that 31 wlll hold of Charlie will make a more impressive picture for we wlll see a tall Y smxle In athletxcs he has always been a ready stand by and has never faxled to boost for JI ACADEMIC Dzal Staff 31 Glee Club 31 Engmeers Club 31 Laun Club Z8 29 Dramatncs 31 Athletic Assocnauon 28 occer 28 Z9 30 Varsity Soccer Ofhcnal 29 Speedball 28 29 Track 28 30 31 Basketball Z8 29 30 31 Track 2 30 31 Varsity Track 29 30 31 Basketball 28 DOROTHY ELIZABETH OSBORN Relsterstown Maryland ll url on hu laps mul soul ulihm fur 1 I8 S t h 1 IIIIIII mul sunny as har 9 1.5 ERHAPS some people would term Dot as being qulet but we who know her realxze that thus ns not so To be sure she can be sernous--sometimes Dot ns always ready t help no matter when she 15 called upon and we know she will never regret what she has done for us at Franklxn COMMERCIAL A A 28 Z9 30 31 Latln Clu 2 Dramatzcs 30 D1alStaff 31 Page Thzrty three 'CGOK l O AY -. .. x ' '41 1 - Q 1 y u . ' 'II' l., . A 1 xi, 1 u 1 n L 1 3 1 - 1 1 ' - , , , , 1 . . . . , , . , ' , '30, 5 G1 1 , - , , - 1 1 1 5 y , - 1 v 5 1 ' - . , , - . . ' 1 , - , , . 1 Vvry Ik: ,' riff, Fo' lk f ' " ' 's " 'l ' ". A ' , lad with dark wav hair and a never-fadin , - , ' Yi . , , , , - , , , a 4 y 9 f 2 . 3 1 1 s - - V , , ' , 29, '30, 31g S , y , , , , ,319 - v . r x . r 1 Y 7 Y x n I v 1 1 1 , ' v l a Y v . . l , y , 1 , x , 99 7 Y Y I 7 , . Y ,. . l., I. . ,. .y, , Hof lm 1"' ', .' .' ' Jil". A I Y 7 Y . ' Y . o Y y y , , - , , - - Y , , , 5 3, 294 , , ' 3 9 ' 7 D .. 111,511 C 0 EDWARD FRANCIS JOHNSON Baltimore, Maryland Somr people are fort-cd in -mule .some zwhzwe 11 smzlr unrl u forlunutz fru. are born amzlmg ff DDIE xs a shxmng example of the last mentxoned Dxd you ever see Eddle wnth a long face? If so somethmg un usual has gone wrong Eddxe delights ln watch Bealls Express make Its daxly trlp We wonder why? He 15 a good student for hxs marks are always commendable COMMERCIAL Ath etlc Assocxatlon Z8 Z9 30 31 Track 9 30 31 Class Soccer 2 31 Latm Club 28 29 Home Room Chalrman 30 31 Student Council 30 31 Operetta 30 D1a1Staff 31 Dram atxcs 30 31 Varsity Soccer 30 Class Baske ball 30 31 Glee Club 31 ANNA MARGUERITE KLINGELHOFER Rexsterstown, Maryland NNA IS one of our quxet members but we feel that she has many virtues whnch have remained unsung Everyone envxes Anna xn her commercxal work for who would nt be proud of that speed llmxt she makes m typing? She can always be depended upon no matter what as set before her and her rehabxl lty we are sure will not be overlooked when she has obtamed a posntxon as secretary COMMERCIAL Dramatxcs 30 A A 30 31 Gxrls Welfare Club 30 HARVEY FRANKLIN LAWSON, JR Relsterstown Maryland Hn 1411111 LY 1411111 but hu butt 1.5 .snudl 4 II our Inlahiuf number he did all ARVEY IS right on the Job lf you have a task to be performed Never a more wnl lxng person was assxgned to hns allotment His duty and his only was turnlng on the ra dxo for dancing No one but Harvey ns al Iowed to mampulate the radno will ever rung nn our ears ACADEMIC Ath euc Assocxauon Z8 9 31 Glee Club 30 31 Engineers Club 31 1a1 Staff 31 Dramatxcs 30 0 . x 'Ike- A . . I ' , . 1 7 ' Q! 3 !! 3 ' ' ' I . - , 1 ' - - v 1 1 1 , A ' 1 7 Y YY y , , Y , 28, Z, , g 9, 30, , , . , , , , , , . , , , - , D ! ! , , , , . , , 9 1 7 - - . , . - , , , , , , v y . v . , , . Silrnve is ll true frivnd who never betrays. Q . . y N - H . , . , . . . . . - y . ,- , , - . . . , . - , , . - , , . . 1 I. , . -- f' H- A '. . y . s, ff ' ' -A 1 ' 1 f , , ' . ,. . . , I ' ' 4 H , 12 , n3O' Y 5 , 9 1 9 D . A I , , . Page Tlairty-four V"P Ax ltr Sikh NOAH EDWARD PARLETT Plkesvllle, Maryland llulrf the most of yourself for that zs all there LS of you HAT would Mlss Cox do wxthout Ed die to keep the typewrlters ln good cond1t1on'7 He has always been her rmght hand man and lf ever a typewrlter re fuses to percolate just ask hum for he ns bound to find the cause of the trouble If Ed dne should estabhsh a typewriter hospxtal af ter he has left Franklm we know he wxll make a success of If COMMERCIAL Class Soccer 28 29 30 31 Class Basketball 9 T ac Drarnatxcs 30 A A 28 29 30 blee Cu 30 31 INDIA VIRGINIA ROBERTSON Hel Mig froulas are fLlll6'T far Ilan smzles of other mazdens are 'OTHER Bobby ' And what would we work or fun and has a smile for every Indra ns an earnest worker and she has cer amly proved her worth lh any undertaklng Indra plans to be a nurse just xmagme some eager llttle patient s joy as smllmg Nurse Bob by enters hxs room scacterxng her ever pres ent sunshme ACADEMIC Athleuc Assocxauon Z8 29 30 31 Larm Club Z8 Z9 Glee Club 30 31 Hlstory Club 31 Dramaucs 31 Operetta 30 Glrls Welfare Club 31 DONALD STEWART SCHAEFER Relsterstown, Maryland m u 115019 am putzfnt o pfr orm HE more the merrxer and Donald IS just one more who has added to our four years of happiness and good fellowshnp Poor Don has developed some sort of eye trouble and we notice that he wmks qunte a bxt especxally nn the presence of ladies Donald IS another of our standbys m Glee Club for he possesses qulce a bass volce Don expects to go to college and we know he ll carry on as a true Franklnmte GENERAL Athleuc Assocnatxon Z8 29 30 31 Glee Club 31 History Club 31 Page Thzrty five 'C If O -. 2? . ' ' ' , . W I I ' U . ,, . . ll - .Y3 ' ' , . .. W V - . 7 .. . ,, . . . , , , , , , 5 7 7 7 328, 'Z , ,30, ,315 r lt '28, '29, '30, '3lg - , , , , , , - 7 ' ' Y 1 7 l b ' , 3 . LA u -JI v s '- v ", l. ' .. . ' 1.7! q IN .1 H do without her? She's always ready for y . onc. ' ' I . . . Q , . , . ' . . U ,, . . , - - . - , y , , , - , , , , y , , , - 1 1 v 5 , , . , I , l 1 I Y I , y 1 "s, -ft v 'l A 7, - If. r . 1 , 1 r f . YY 73 if I ,, . . . , , . . Q. H - D v .7 If YY , 1. - - H 1 . - - , , , , , 1 1 1 I 1 , 3 I - 9 , . O 'x 1 1 1 1- ' " ' " ' . W - .Q - H -- , ' ' ' - 2 . Y! ' 77 ' - ' . ., ' v , , I s ' ' . .Q - 1, A. .'Z,'9,' ,'9 .A.,3l3 . - , , y , -, y 1 Y y a , - 1 ! Y ! v y 1 , s I .1 , s is y 1 ' 5 . Th, - , K . , .f' Y - ' I , . , . l: ' . D A ' . ffg'f 1-ff-. f:'- 'tr fs 1 - In K V' T , , , . I I V . ' , i . . . . t , D A Q 'W Q . , v y - - , A y g . . , 5 31. 61683 YV ltr Bra! ss Page SARAH ELIZABETH OWINGS Thr r-lmrart HEN ture mxss Of course the athletxc rea ons for the fact tha sport Relsterstown, Maryland rr of our thmltmg l1lIIl711ll1P9 Hue nnfurf of our Meals we thmk of Lxb we always pxc 1 llght haxred blue eyed carefree wxth an ever ready flashmg smlle Lab IS noted for her alacrxty on field but perhaps one of the mam her achxeved success m athletics xs t she xs always an all around good COMMERCIAL A 8 2 30 31 Manager A Varsnty Fneld Ball Z9 30 31 Varsxty Basketball Z9 30 Class Field Ball 28 Z9 30 31 Class Basketball 28 Dram ancs 30 Dnal Staff 31 SHELDON SHIPLEY OWINGS Rexsterstown, Maryland 1 nulflzsf 'manners and thf qanflesf lzrar rnifntul anrl 1111111411 to do his pull HO IS that qulet sandy hatred boy count mg the returns from the cal'eter1a'? Why that s Sheldon and he 15 one of our bes bookkeepers too H1s courteous attxtude and hxs wllhngness to help others are only a few of the sterlmg qualltles he possesses We are quxte sure that any class would be proud of a oy like Sheldon COMMERCIAL ramatlcs 30 DOROTHY PEARCE Relsterstown, Maryland lump stzrann mm 111111 Ullllfllllh nu :mf mils mm 1:1111 murns qrou HIS lxttle verse sunts Dot to a T She IS small to be sure perhaps our smallest member but this fact does not lessen her worth She has proved to be such a wxlhng helper durmg her two short years wxth us that wnth Franklin formlng the background for her career she cannot fall to achteve success ln this great world COMMERCIAL ramzmcs 30 31 Gnrls Welfare Club 30 31 A A 30 31 Hlstory Club Thzrly szz 111' Bra L11 WILMA CAROLINE ROHDE P ltesvllle, Maryland 1 unr 1 Ill llllllllf 111 11111 EED any help? ust consult Bxlly She can get you out of dlfFlCL11C scrapes Yes she 15 among our throng of trlcksters When xt comes to her achlevemen s they too many to state but condensed to a w words she 15 an all around gxrl ready for un or ready for work ACADEMIC Class Fleldball Z8 Z9 30 31 Class Basket ball 28 29 30 31 Athletxc Pageant 29 30 31 Secretary 29 History Club 31 l.at1n Club Z8 Z9 A A Z8 Z9 Home Room Secretary 29 Home Room Chanr man 30 Student Councxl 30 Dramatlcs Z9 30 D1alStaff 31 Secretary A A 30 Presldent A A 31 MARION PRESTON SCHULTZ Upperco Maryland 1111 I1 If fl 1 NY one hmshed those Solxcl problems You bet' Here s ack on the job wlth them all He sets h1s standards hxgh and after a hard rough cllmb reaches the top Has cheery d1spos1t1on has kept us all 1n good hu mor for four years so we hate to thmk what we w11l do wlthout ack ACADEMIC Class Soccer 28 29 30 31 Class Basketball 9 Trac 31 Latln Club Z8 29 Engineers Club 31 I-l1story Club 31 Class Track 28 29 31 Ath letlc Assocxatnon 28 29 30 31 HELEN BECKER RUNKLES Relsterstown, Maryland 1 1 1 1 I 1 111111 Tlal III Illlll 11l11r1 'll llllx 1111111 F anyone cver needs some person to gxve a report m an assembly let hum call upon Helen She IS ever ready no matter when where or how We feel that whatever Helen may undertake ln her career she will be a grand success because among her many sterling qualmes we find that outstandmg one-help fulness COMMERCIAL Student Council Rep 31 A A 31 History Club 31 Dramatlcs 31 Dlal Staff 31 Welfare Club 31 Glee Club 31 Page T111 'C K rt y seven O ' 1 x' ' 3 Q 1 1 E sn' is - tl 11 ' I II. N 1 N 1 1' - 1 ' 4 T , are fe . I f - 1 1 1 1 I 7 9 Y 7 . 1 1 1 1 I - 1 1 1 1 1 1 1 1 I 1 I - 1 I 1 1 1 1 1 1 1 I 1 1 I Y 1 ' ' ! 7 1 I . I . 9 I 1 1 I - 1 7 1 1 I - 1 I 1 1 1 - - 1 I - 1 , . . . Y U7 t 1""s ll 11'iIl 111111-'s my. - 11 . 11 9 1 111 11 - I- I I , . I 1 1 - I . - - 111 11 1 1 1 1 I 1 1 1 1 1 1 1 1 28, 2 , 313 k '28, '29, ' 5 , , I . , , I , 1 1 1 1 I 1 1 1 I 1 Y 1 Y - - - - 1 1 1 1 1 1 1 - , .1l11l." I11' .v11r' 111 l'4ll'I 11: ' 3 ' . 1 , . 3 I . . , I , I , . , . . , ' . ' ' . ' Y 1 1 1 1 1 I 1 , . AJ Q 'COOK . ltr Bra! ETHEL MAE SCHAEFER Woodensburg, Maryland I me and cheer and happmess Thu: three are idols uf success HO ns thls trxm young lass with such deep brown eyes and cheery smile? Why that s Ethel No matter when we see Ethel or where she s always the same She has that charming smile ready for everyone whlch we are sure will carry her safely through any dlmCUlIl9S that may chance to ruse after she has embarked on the sea of hfe COMMERCIAL A A 28 29 30 31 Glee Club 31 History Club 31 Dramatlcs 30 Welfare Club JAMES EDWARD SCHWARTZ Plltesvllle Maryland Bfqnnf dull nur' Begum from me' AVE you seen Jim? If not ask Fred for hes bound to know Fred and James are two of a kmd They both take great de light ln teasing and besndes thus they can really dlp xce cream However lm xt seems 15 especially fond of dancing This fact makes hmm qunte popular with all the gurls He 15 nev er seen ln a bad humor We feel sure that he wxll carry thus happy dxsposmon wnth hmm wherever he goes COMMERCIAL Varsxty Soccer 29 30 Class Basketball Z8 Z9 31 Varsxty Basketball Z9 30 Class Soccer Z7 28 Dtamatlcs 30 Track 21 Z9 MARY JANE SIBLEY Owings Mills, Maryland 4101111 uzfh Hu :am or a dau ull sunny lmnu Sllllllllll Sub' sy flumlly und funny ,TIS true Sub xs one of our wlttxest mem bers and as she wears a continuous smnle two rows of even whlte teeth are always gleaming Dan mg ns undoubtedly her hobby for each noon hour she appears ln the Assem bly Room wnth Pearcxe her falthful partner ACADEMIC Hnstory Club 31 Dxal Staff 31 Athleuc As soclatlon 28 Z9 30 Operetta 30 Glee Club 30 31 Athletic Pageant 30 O W A 3 A I 3 I U , ' Y I I Y- ' , , s 1 v 7 . r . - ' ' 1 l ! 1 Y ' . ' ' . , , '30, '3l. 9 H 3 W I f , I? ' 17 l - . . Q . , . .-, I ' I 1 Y ! 1 1 1 , 2 , , . , , , - , , . 9 I 7 Y , , , - , , . - 7 8 7 y , 7 , , , 2 , , so, 31. A I .- . . A I 3. Q. -I , ' . . 'H' ', .'1 ' ' t . .. . H - - - I . - . . . c' ' ', , . 1 Y - . r , , , , , , , , , , . . . , . 5 - Page Thirtyveight ltr -I ta SQ! MARY ALICIA SHOEMAKER Owings Mllls, Maryland ll 11111111 quml ll nlhers lmnls the 111111 uzth ltght ARY IS known for her gen le clxsposltlon and kxndness to others She ns never too busy to lend a helping hand where it IS needed And what would we do without Mary xn our school plays? She can pretend crymg to perfect on but we often wonder nf she does nt L.se an onlon to help her ln put mg xt over She IS bound to wln ln whatever she undertakes ACADEMIC Pres den 28 Dramatlcs Z9 30 31 Pagean 29 30 Class Fxeldball 28 29 30 31 Class Basketball Z8 9 30 31 Class X olley Ball 30 Glee Club 30 31 Oper etta 30 D1al Staff 31 History Club 31 WILLIAM ELWOOD SHAFFER Upperco, Maryland lt does Lts uork LWOOD has been wnth us durmg our four years and nn all thns nme he has never been known to refuse aid to anyone H has served hns term and an excellent one xt w as dxrec or of the Franklin Savmgs Bank and who knows? perhaps his tralnmg here may be preparmg hum for the dnrectorshxp of a large bank COMMERCIAL Dramatxcs 79 30 Athletxc Assocnatxon 28 Z9 30 31 Glee Club 31 D1alStaff 31 ANNE MARY SLONAKER McDonogh, Maryland Xothznq so lmllllllll as LIIIIIIIFSS Xulhzuq so 14111111 us plant HERE IS Anne? Find Janet These two buddies are inseparable at all txmes Anne ns a fine planlst and often plays for those who lxke to dance at lunch hour She certamly helps to enlxven the blue days of our class Mfe feel that wherever Anne may go she wxll carry her cheerful spnrnt whnch wlll wn for her true frlends such as she has won at Franklm COMMERCIAL Athletnc Assocnatxon 28 29 30 31 Glee Club 30 31 D1alSraE 31 Page Thzrty nvne 'C K O 1 K. .. ,. Y E' 'I ' ., 1 1 1 1 -I 1 1 I . f A 1 f 1 1 J ' . - 1 , ' . . ,. :, . ,, . . , I s 3 . ' 7 7 7 . - A ' ! 7 3 ! ' 1 1 . - 1 1 1 1 I 1 1 1 1 1 1 1 1 1 1 1 1 2 1 1 9 1 1 , 1 1 , 7 ! ! ' 1 . 1 1 , - 1 1 1 1 Hl"lIl'IllIlltlll' g,'1r111r 'irleul and holrl fusl to it till ' 1 ' 1 - .77 9 7 I 7 Y . e as- . I . . v . , , I . . . , 4' 9 7 ! 1 1 1 . 1 , - 1 1 1 1 1 1 AA ' ' , -7 , .' ,, . . 1 l I . .., ' ' , . , . ',, YY I - 1 i ' , 1 - 1 1 1 1 1 , 1 s 1 Q i 1 1 . - 2 1 1 - lil! ltr :Bra rs., CHARLOTTE EUDORA SMITH Glyndon, Maryland Urzqmallfu rs simply a mr 0 1 sh zu s E are very proud of our Bobby s abllxty to wrxte When If comes to wrltmg short storles the rest of us take a back seat Who else could have showed such orngmallty xn wrntmg the prophecy? Charlotte is also a nat ural born gnggler we re afraid that her af Hnctxon sometnmes leads her into trouble Oh well laugh and the world laughs with you rctorts Bobby ACADEMIC A 8 30 3l Latin Clu Z8 Hlstory Club 31 Glee Club 30 31 Pag ean 30 31 Dramatlcs Z9 30 Home Room Secretary 30, 31 CHARLES WESLEY SHIPLEY Pnkesvnlle, Maryland lhmlrs math his 'llllllll Cannot fml suwzss to 117171 HARLES IS one of our noted orchestra players Oh yes' He uses great skull m drawing hxs vlolm bow and to be sure the results could not be better We know that xn the near future we wlll hear this name an s one of the world s greatest vnolnnlsts COMMERCIAL ch stra Z8 Z9 31 A A 28 9 Track Z8 Z9 30 31 Clas Soccer 30 31 Class Basketball 30 3l Dramatncs KATHERINE HASEL STANSFIELD Relsterstown, Maryland In hzr upprurunu sh: Is uluuus ma! Nl: u as uh runrls us mlmul bt llllll RIENDLESS9 Never' For Kitty mam tanns that congemal way whxch wms for her a great many frxends Although no a regular partxcnpant she IS exceptionally fond of Physlcal Ed In addmon to her charmmg ways Kntty has proven her abxllty m musxcal nd lxterary actxvmes ACADEMIC Glee Club 30 31 Operetta 29 30 Dram xcs 28 9 Dua Staff A 28 29 30 31 Latin Club 78 O X CEEKM' t. ' ' 1 '.. 1' t f ' f fum. ,K ,f.,"Y W Q. , U - - , . 1 n - vv. . 1 - A . . . ' . U ' Y . H 7 7 , C U H - s 1 , A. . 'Z , '29, , , y 3 l3, , 29, - , . , 1 , 1 1 n ' , , , , - , , l ' Y 1 , 1 7 Y I u In Yr' .1 1' I l I I U 1.1 - C v , U . . 1 Y Y 1 . , . - . - nounced over the radxo or nn some publxc place a ' ' ' ' . Or e l ,' ,l 9 . .' ,'Z,'30,,3lg , , , , , A , Y Y 7 7 B Y , , , v , - , , , '30. .':' 'i1..s1- .' .-- 1 ' , F .. . U - I ' . t , - H U - - . H . ,, ' , . . . , , , , , , I Y 1 I 7 - . , , . at ' , Z , 3lg l '3lg . A. ' , , ' , ' 2 '- , '29. Page Forty Q 11r5Hta mm LILLIAN MIRIAM STANSFIELD Relsterstown Maryland H11 11111111111 11 llllllf 01111111111 r1lI.s 11111 fl 1 I 1111111111 111s s111f11s1 111111 ll ulnus ull 111n1b111111 ES us true L11 15 the most fanthful mem ber of our throng Never a cross word nor a false act wnll any remember of L11 han A kind deed she IS always Wllllhg to per form Also one mxght see that m dramatxcs and mu c her name often appears GENERAL Athletc Assoctalton 28 Z9 Dramatlcs 31 Glee Club 31 Latin Club Z8 29 Orches tra 30 History Club 31 FRANK MARVIN SI-IUGARS Rexsterstown, Maryland r thr 111-111 s11111 1111111 1111rI1 n 1 1 III 1-1 llllf :fa fm 11011 HATS Frank or perhaps Boob 15 well known to all Thls member of 31 surely finds the funny things ln ltfe at all r mcs l-le will settle down some day and when he does we shall see the more serlous charac tcrlstlcs 1n hum which we are sure he has ln abundance COMMERCIAL Class Basketball Z8 9 Class Soccer Z8 Z9 30 Varsxty Track 30 31 Dramatxcs 30 Dual Staff 31 Operetta 30 Ath1eucAssoc1auon 28 30 31 H1story Club 31 Glee Club 29 FRANCES ELEANOR STEWART Arlmgton Maryland r 111111111 H1 111s1111l1 ll 1 1 1 1111 1 1111111111111 ff IS IS what one would term a good sport She ts always ready to help matter whether tt concerns lessons or athletics She has her heart set Lpon being 1 nurse and of course shell make a good one' Good sports can usually attaxn success ln what cver course of llfe they may pursue so we wlsh you the best of luck Sxs COMMERCIAL Vars1tv Volley Ball Z9 30 31 Class Volley B 11 28 29 30 31 Class Fxeldball 28 30 31 Athletnc Association 28 Z9 31 Dual Staff 31 Welfare Club 30 Franklm Bank 31 Student Councxl 31 History Club 31 Dramatlcs 30 31 Art Club 30 ' 9 " " ' " f ' fin 11. lfllf 'A '31 s1..' il'.w .'1' 'f 1 I 'Ip- f ,'.'. 1 . Y 1 - 11 -11 - - 5 3 ' . . . , , I . , D ' , A 1 17 v 1 3 1 5 ' 1 I 1 1 , . L1 11' 'Q ' ' ' 111 , .1 171 f ' 11'11 1 1 l ' ' . Y T if Vilas I 1 - 1 J . ' , y , . 1 Varsity Soccer '31g Class Track '28, '29, '30, '31g ' , 'Z , '30, '3lg 1 1 1 , - 1 1 1 1 1 l - 1 . - 1 I 1 1, I 1 D I , y 1 9 1 291 1 1 , 1 1 A 1 1 1 1 1 '31, Th ' ' " 1' In ' ', H ' 11111" .1111 11 111"" ' . il. S .. 1 11 ". ' 3 no S 1 7 l S 1 Y 9 ' . , . 11 -11, , . - 1 1 1 . Y 7 7 , y , ' 7 y 3 , yy 1 1 l 1 I V , Y a 291 . 1 5 1 1 '30. 1 ' ' 2 ' . '31g ' ' g ' 130,1 3 - 11 3 1 , 1 , J , . Page Foriy one 1335? 11rgBta ROSELVA MERLE THOMPSON Re sterstown Maryland Nut foo snbrfr noi loo quu HOUGH Tommy dxdn t jom us untll we w re ophomores she soon became a per mancn flxture and one we couldnt do wthout She has contributed much to our musxcal actxvmes and has been a real standby on class teams In fact she s an all around good student ACADEMIC A 29 30 31 Class Fleldball Z9 30 3 Class Basketball Z9 30 31 Class Volley Ball 30 Varslty Volley Ball 30 31 Glee Club 30 31 Hts ory Club 31 Athletic Pagcant 30 Dxal Staff 31 Franklm ounnal 30 Art Club 30 WILLIAM WISNER SIMMONS OWIDWS Mllls Maryland Tllnlmzi IX buf an 14111 1111811 of ihouqllf CULD at be possible to find a more can tall mg tease than Bull? And yet does he ever fall to render assistance? No Bull IS indeed a loyal friend one whom we wnll no soon forget Our Doc has a real Franklin splrxt which we know he wxll carry w th htm always after he has left our dear old COMMERCIAL Class Soccer Z9 30 31 Class Basketball 30 31 Track 29 EMMA ELIZABETH TRAINOR Plkesvllle Maryland 1 11 1 1 I t4 slulflou rr ll :In um prrfrrtmn ff IB has been wlth us all four years 'md dur ng that txme has done much for 31 She takes great in erest tn 'athletics and everyone knows she deserves the many awirds whlch she has gained Then too we must not forget that Lnb 15 one of our artists to whom due crednt must be gxven for her sharc of th dmwmgs lh the Dxal COMMERCIAL D1a1Saf1f 31 Class Basketball 28 Z 30 Class Fxeldball 28 29 30 31 Volley Ba 9 30 Varsxty Fleldball 30 31 Xarsnty Basketball 31 A A Z8 Z9 30 31 Dramatxcs Z9 30 Frank1mIIourn1l 30 Art Club 30 Welf1re Club 30 31 Glee Club 31 O I F., X "5 -1- 5 Y .Y ll , - .'. T .1 YY Y Y A - - - f . . .. , ' T Y , ' Y Y Y Y . Y Y Y I A- - Y Y 9 , Y 1, Y Y Y I , I n 1 v 1. y . Y Y Y Y Y I - I Y I - 5 3 ' 7 Y I - Y I Y Y Y J . f . Y , . D 1 VK! ,z. . . 7 ' Y .Y - ,Y - . . Y Y '- A I Y, Y, . . Y .I y Alma Mater, , Y Y I , Y , Y Y Y I , I Y Th' 'ur' uvrk nf ar! Is zu 1 .' ' f fl ' .Y . I , . ' v ' . ' t ' . ' , ' ' 1 1 Y. . .Y . . 2 . A ' 4 . . I Y I Y Y . I - Y Y 9Y Y . , , . Y I - H Y7 t . '. ' . ' ,I . I - Y Y , Y 7 ' v I 1 Q s , 5 9 ' ' 9 9 1 I t I t . I Y I Y . I ' , Y C I Y Page I'orty-hro If! 11rgBra .tm JANET LOUISE WATSON Owmgs Mllls Maryland Ii luzr zu ymnwlf belzew in otlzrrs HO ns playing the plano anet r Anne? Everyone knows that both can really txcltle the lvorles In fact they both seem to be Interested m the same thmgs except ln hxstory 'ind then anet just can t h de her enthusnasm when studying about Kmg Karl l1net has proved to be a loyal frxend to all and what could we wish her but success? COMMERCIAL Athletic Association 31 Glee Club 30 31 Operetta 30 FREDERICK WILSON JR Re sterstown, Maryland S u buf sun 11.1118 the II 1 RED ns one of our most steady classmates If a problem IS dlfhcult he pegs away at xt until he has conquered the elusive sub ject He may be slow xn speech and manner but he IS not slow m learning By the way Fr d has rlsen to a new fame this year for he can act anyone who saw htm ln the play Pen rod can vouch for that Keep up the good work Fred ACADEMIC Athle IC Association 28 29 30 31 History Club 31 Engmeers Club 31 Dramaucs MARY ELIZABETH WOODEN Woodensburg Maryland nn: 1 1 f IS Illlllhl fur EARLY every class has nts mghtmgale and Mary IS ours We just couldnt manage wxthout her m operettas and Glee Club for she has taken part nn them ever smce she was a freshman Not only IS Mary a talented singer but she IS an excellent student especlally m hlstory 31 hopes shell always go through llfe with 1 song on her llps ACADEMIC Latin Club Z8 29 Athletic Association 28 2 30 31 Operetta 28 Z9 30 ee Club 30 31 History Club 31 Dna1Sta1-I 31 Page lor ty three 'COOK x' ' 37' -. .. W I 1 1 1 fill' K .',, J. ' . ' ,... ' ' ' ? J o ln . 4 . vs - , . . . . , . J , YY Yi K ' . . n. , . . . . . , . , . . ! 1 Y , , . i Ulu ' .A 'P " .' '1c'. H 4 ' Q! Y! l 1 . . y . . . , 3 v . . .1 9 - - U , . , - - 1 , , . , - 4 " 1 Y 3 V . I - , 1 I A . , , . '31, I To lp 1 ' I4 '1' ix in Inv' hvr, In num' hrr In - A 1 Y 7 . .. A 1 1 , e - Y , . . V v Y , - - - 1 , Y , y , , , 1 , 9. , : , , 9 G1 v s . - Q . - ' y 1 y y ' . A r ra HBIW RUTH IRENE WADDELL Eccleston, Maryland To brqm uvfh ihr bfflllllllllfl 18 my any Thru nnproir slmrhlu :Inu bu rlau LTHOUGH Ruth has been with us just one short year she has mdeed proved her worth to our class Is nt possnble for us to enumerate all the things that she has done? She ns an A student m everything from English to athletlcs And as an orator she cannot be beaten Whatever Ruth may choose when she leaves Franklin we wlsh her every success hfe can afford COMMERCIAL Dual Staff 31 Hnstory Club 31 Glee Club 31 CHARLES ROLAND STALLINGS Glyndon, Maryland fhmlu mnnnryfs nzrvly 'llllh his hombonr To 11rq4 the uounqfr onrfs to play a frm fone NDEED Charles trombone does talk rlght out and beckons for nts weaker brothers to follow In operettas Charles abllnty has added to the success of the productions And what would we do without Charles to play hxs part on the basketball team? Again he found favor tn the eyes of hxs classmates for he re presented us ln the Student Councnl ACADEMIC Student Councrl 31 Athleuc Assocnatnon 28 Club 30 31 Operetta 29 Soccer Z9 Basketball 28 29 30 Varsity Basketball 31 Track 28 30 31 Varsity Track Z9 31 Engmeers Club 31 Latin Club 28 Z9 Dial Staff 31 HELEN GERTRUDE WARNER Relsterstown, Maryland flllllllfllf 18 lnghfr Ilmn mlrllmt If KINNY has won a place ln the class of 31 that would make a large gap were she to forsake us A joke she can take wnth a laugh but you may be sure the yoke wll be on you before many more mmutes However humor :sn t the extent of her posses sions Oh no ust a word about some work on hand and she IS ready to t-ackle 'my task ACADEMIC Latm Club 78 Z9 Athlenc Association 28 Z9 31 History Club 31 O I -Q' A , , -H ,D ' ll YY ' K ' ' 1 ! - , , - , . , , , - Q 'ul l ul I .I .1. l V I l ' , , . . . , , . - 1 . - - - 9 Y 7 '29, '31g Orchestra '29, '30, '31g Glee 7 , , 5 , 9 ,. g , , , . - . 7 Y 1 , , , , , , - , , , t 1 , Y Y - , , - 30, 9 9 , t I . , , , - S 'L ' , . , Y . . , ! J . , . . . . . , l . . . , ' 7 Y 1 , - , 4 y 9 Y ' Iuyz l'ur!y-four hr Era 'COR DOROTHY ERMINE WOODS Glyndon Maryland 1 s nas Il mu 1111 f ns mrmu ulmzlr 411 1011111 ll ff HEER UP' says Dot Dont be blue But woulcln t you think a gray day goes wxth the blues? Yet queer to say such a cheery gurl encoumges Gray Heres the mystery unraveled Colors make a declded dnfference to this cholcy muclen be cause not every color can Hll her strxct requlre ments Keep smmlmg Dot for th1s IS a good cure for everyone s blues ACADEMIC Glee Club 30 31 Dramatlcs Z9 Latm Club 9 30 31 Home Room Secretary 31 Dlal Staff 31 Pug, 1-mlyfhc O 1 .. Y :Z 5 "IIrI'."' Ulu' .fc I1 - sr 1 nn f'7"'- luyxg Tfl .' l I I " -' 'A ny, H H U Q. , . ' Q1 un , . . - . . . . C. Y - . . ,, ,, . . ' 7 7 , , , , - , , - , , , , ,28, Z 9 A. A. '28, '29, ' , 3 5 , . 9 ' - gf -i ll - ill, .i. H1111 I-'url ll Aff .- A ,- r-1 1 ufv, sf COMMLRCIAL Rumi Hom ix 'v' ' "- Fill Page forty fight The Hustory of U1 We te all mxghty proud of our history And belleve me folks lt s plain to see We entered Franklm I-hgh m 27 Wlch a band of one hundred and eleven We lust can t forget that Memorable Day When nearly all of us lost our way Headed by the Junlors Sophs and all We wandered axmlessly through the hall But after a whlle we assumed a class prxde And for the top we all dnd strlve To play a falr and wmnmg game Before us there were two great goals To make the teams and the honor roll Although we were only Freshxes you know All of us to the operetta dld go We enjoyed lt thoroughly twas a great success And to us brought a real happiness After th1s the days sped swlftly by And before we knew xt Commencement was n1gh We took our part wlth much good cheer For th1s was the end of OUR Freshman year Page 1'Ulfy nine 9 , . . 1 . . , . 7 7 ' . . . , , . , . . 7 7 9 7 In work and play 'twas just the same, . 3 7 . . , , , Y 7 7 Jaxx Sikh A N 'lC'lIlOl'l dns Ind just begun So l'I'1l1lxllf1 ue left for rest 1nd fun About ninetx returned in 8 To knock once more 1t f'r1nklin s gnc But one big Clliflgk ue d d perceixe Our de1r Mrs Reese Ind t1kcn her le1ve Miss Russell li to come this p 1ce te te An she surely did rioxe 1 lOX1l friend As Sophoinoies of I'T1l1lxllI1 High We 1ttained 1 ste1dy 1nd rapid stride My hon we worked for good class te11ns And such true spirit you never hue seen Not only in pl1y did ue succeed But in bCl1Ol'lI'Slllp too ue took the le1 Before ue knew it the operetta had come And me took much pride in Miss f l1L1I'XlJlObbOl1I Another affair to which we did go W1s the Athletic l 1ge1nt 1nd Minstrel Show Due to the efforts 1nd xsork of our gaing We put this 1ct ox er with much o 1 lung During the rest of the wear ue h1d 1 hne time And in fin1l ex1ins uc really did shine When the Grand Finale rs as once more nigh Proudly me mfirched with flags on high Rtidy tO SPLl'ld lYlI'd l'lI'l1Cd X3C'lIlOl'l5 In 79 1s uniors me C'llI'l!. o trx once more to min some tune In our cl1ss there xeere more th1n 77 But non me d 1rrix ed 1t the Gre1t Dieid QOl11t of LIS Sfllllx to 'lC'l QIHIC l0I'L llll OIl1LI'S Ill LOH1lHLI'kl1 XSLYL IHILILSIL IUOFL Right 1xs1y ue settle down to our task And throughout the xe1r our grit did mst eterinined to exeel in nor p 1x 1nd fun e upheld the siirit of o nl UTS X 1 L I 1. Il HL of LIS I1 NS 1 11.181011 IIUIUI Illl tertilsx es lr no I I Y I'0L1d to b UIUOF: if de 11' U l!"lI1 H1 I I 1 - 6 I c:x , , M . X ' Y ' A V, , l ' s A l I s s e ' .7 ' C , ., g , .' ,, ge . ' -1 ,l. - i -nd. d ' - ' - f ' 1- ' . '. K A JK 1. K A 1 V. - " " f.x". Amidst happy friends and kind relations! XWU1' , . nu- . , .-K1 ,, . ,d ,. XV- 1 - , Y i ld A' . To the' Scni , ve' gay ' th 'ir annual 4Hnii'. Ani o - ' K ii. , rd 'NU 'Nz .V e-x . 'd tire-.H ,Axli ' I I. YL' I' YllIIlL'd lli Li Xkl ll I EFI!! I' e- J . fe ld 1 e ki' . I must not to get ne bought our rings too And with them came much joy and ado Then the days just sped along And so did x t with joy 1nd song In Tht lnortidors me won much time lor tht 1ud1encc thought they were really I1 Spain Ant now I mustn t forget to tell Tint in COl1lII1tI1CLl11Ll1f music we 'tlso did well Proudly me unlors marched in line Glqd that again tuas vacation time And received 1 surprise we ll always remember Although our new building ww as not quite complete To dwell in her halls ss as really a treat In our class there were nearly seventy two And all ol us knew what Wh had to do lqo edit 1 Dial is no easy task So we tried to select a capable Staff We all caught the spirit and did our best To mike the job 1 great success In sport 'md play we also stood by Iqhen soon the unlor Senior Party wis nigh You can be sure th1t we Seniors went And our time indeed was quite joyfully spent Before we knew it Christmas had come And now mas time for some more joy 'ind fun The old year 30 seemed to roll right by And 31 found us biclt it dear Franklin High During the next six months of our high school career Though quite occupied-we had much good cheer. To Mt. Vernon we went on our class trip in May And in truth we spent a wonderful day. Then came the time when we had to say good bye To our friends and loved ones of dear Franklin High. 'Twas an occasion sad and yet quite dear For thus had ended our Senior year. Now our life work has just begun And we all pledge allegiance to dear 31. Pill va Q x 4 F 4 I8 st mx HER , A r l . ' .U 7 . 'K V ' 5 , I XII' 'V I L 1 . I , K ', , . , C I C - l ' ' ' As Dignihed Seniors we returned in September S r I Q C 1 f . ,, . .. . Q . . , . . ' . g C I I I g Q I I I I 1 v 7 v I I 7 I Q I 1 A . K I ' 5 7 7 . , . fr' I"V7zfn1if gs! IIE' B13 as-as COOK lust lmctgme Blanche Abbott bCll'lg bolsttrous Marshall Armacost talkmg to gurls Evelyn Baubhtz w1thout her g1gglts Edlth Beall wlthout a friend 111 the world Elwood Beam bemg unpopular Ellzabeth Beasman wlthout a htstory of Charlts Lllyan Becktr wlthout overdue books Edgar Belt wxthout a nall hle Mary Benson not helpmg at enttrtammt-nts Agatha Berge wxthout Dorts Mary Broadfoot betng a wallflower Allan Brooks wlthout a ltne of blulq Eleanor Bruehl dumb struck Elalne Buckman belng back In bookkeepnag V1rg1n1a Caulfaeld wxthout Ethel Frances Clark hurtnag anyont 5 l'4lll!1LS Edwtn Cole staynag awake Ill Englxsh tlass Fred Colw1ll not teasnag someont Grover Cook be1ng bashful Helen Crouse not studytng Mary Fowble not bemg 1 tomboy Hunter Freeney 1n short pants Exa Fuller wtthout her Jewelry Gladys Gooch not SSIHUIYIQ a bowllag con est George Grothe not m1sbehax1nt Donald Hampt bcmg a Htrt Guy Hardexa benag tall Olive Ho1fn1a1a not trvlng out for anx x ars tx teams Cathertne ldolllngsworth bemg und1t,nthed Harry Howell not playtng hts bamo Edward ohnson not hclpmg othtrs Thomas ohnson not belng our prtsxltnt Dorls KICHOY wlthout Agatha Anna lxlttagcllmtxftr hung no: x arxty lawson 11 ut d mg 1111 lg txng TL lvclyn Lockard stayxng home from school Earl Long back at Thurmont Paul Marttn lonesome Loulse Myers w1thout her good d1spos1t1on Dorothy Osborn walkmg home from school Eltzabeth Owtngs bemg a poor sport Sheldon Owlngs belng dlsorderly Edward Parlett hung on tlme Dorothy Pearce wtthout a wtse crack Ilidli Robertson wtth an I don t know H1 h1s tory class XV1lma Rohde bemg clumsy Helen Runkles not helptng others Donald Schaefer betng a blonde Ethel Schaefer not blushmg lVlar1on Schultz bung a pOllllCl'1l1 Elwood Shaffer wtthout h1s Slde remarks ames Schwartz out of I'I1lSCl'1lCf Charles Sh1pley w1thout hls flddle 'Vlary Shoemaker not starrlng 1n the school play Frank Slaugars keepnag qutet for one mtnute Mary Stbley not dancmg w1th Pearcxe XX71ll1am S1mmons not bexng a pest Anne Slonaker w1thout the Chevy Charlotte Sm1th wlthout her w1t I.llll'lI'l Stansheld not busy Kathtrmt Stanshtld wtth hu ha1r messtd u Frances Stewart not takmg gym Charles Stallmgs not belng a gentleman Roselva Thompson bemg unmtelllgent Ehzabeth Tramor wtthout her permanent uth XVaddell wtthott her southern accent Helen XX arner bemg stout mtt XX atson wxthout Anne rttl Xx7llS0I1 ln a rush hlarx XVondtn XIll10L1I htr SIIXAIHQ, altxly Dorothy YK nods wnthout somtthmg Gray 1:1 Illfufu . nk I 6 Q - A X . iw . t A . 1. 1 L 1 A A 4 -1 L 4 , K A ' 'wK , V K ' K A K 1 4 A 1 ' t . . ' t 1 A , . -. I ' K ' ' K . , A L A 1 YA Vx Y K A A A K k ' 1 ' .A . 1 'A 1 A' 'A - 4 .A' K K 'A . Ag 'A L " W AA A A A 4 'Q ' . , K t , A A , 4 A t A Q ' A ' A K. , A , A A AK t AA . K A K n . K K ' Y K K' 'KK ' KY K K . I. K . . .K I 'A - A H KL 1 A A . - K I L . . . ,. K.. A ' A 1 K L A A x A t g ' ' A . Q . A A A I A 1 . 'A A . 'A1K I . . A " ' . K Y. YK 4 K . V. Y, I t . 'A K 1 ' . A At . . K A K K K K . ' 1 K 1 f' s K' t pl A t I Y 1 X' 'x 1 X' . 't L A . L . K K A A 1. K . K . . V . K .KY .- K K . . . V t ' 4 Y ' t K . "1 LA 'A A' t 1 K - t . ' ' J I. , '.' 5 K ' ' , , . .' , 5 -K gs . ' ' K K K H. .. " 1. ts K' 4 ' 111.11l1, , V- ' - v' - ' v' Y . a l' t, Evelyn Ia-'tht h- K' ldv. 1 " V - 1 'A . 'I fl 'A KA K All :ii -sul rug: 0043040 0 1' 9 mfg Puf I fly r' H v X ' 2, Q55 A g , -ml ix I 7 A Q2 x ' Q f , 45 , L K A V I 'X I ' i 56 "i ' -lfzrzff' Want jam: at Class Prophecy T was a sultry evemng cooled only by rnfrequent little breezes Luke my fellow passengers I had sought the deck because the cabm had become un bearable But even here II was hot enough to brmg smothered protests from persprrmg passengers who lay lnmply back m thenr chanrs For a moment two I stood debat1ng as to whether I should take the chair next to the lady the red hat or to apply my small amount of vxtallty to the effort of gettmg the ra1l The hat declded me for I had only to look at that glarmg artxcle attnre to see at least It seemed to me that I saw them the heat waves evolvmg contmuously from II and toward me In a state of utter exhaustion resulting from the effort of movmg I clung to the ra1l and when at last my head cleared I knew that I could stand xt no longer I recrossed the dlstance between the rall and the red hat and followed by the sympathetlc stares of my fellow passengers I passed on to my cabxn She rose wlth queenly mot1on hngh 1n her domam untll at last she reached the mlddle of the heavens and there she settled amldst the downy black clouds The arr of mystery that centered about her was mcreased by the soft, lmpenetrable darkness that was relleved only by her sllvery radlance Moon, I murmured What secrets you must know What mysterxes you mlght solve lf and here I stopped for the moon had become all at once much brlghter and I knew, by 1ts strange appearance that somethlng unusual was gomg to happen Slowly the moon grew larger untxl at length she resembl then I sat spell bound 1n my chaxr as across the face of the moon a scene ma ter1al1zed' As one scene qulckly followed another wlth scarcely a pause be tween they resembled the pxctures one sees nn the Penny Arcade and I won dered what hand of fate was turning the pictures for me It was a beautlful room that I beheld and as I gazed more closely I saw that lt was an artlst s studlo Beautiful plctures were placed about the room and a man whom I knew to be Grover Cook was crltlcally examxnmg a plece of work that was yet unhnlshed How wonderful ll was to behold the beautlful plctures and then to reallze that an alumnus of Franklln Hlgh had created them' A busy personage was mtrrored next A woman was sortmg and glancmg over many papers on the desk at wh1ch she was sxttlng Each paper was headed Vlr gmxa Caulfield edltor Everybodys ournal It was an easy matter then to recognlze the Vxrgmxa I knew as the busy woman at the desk W1th swxft busmess llke movements a nurse and a doctor worked to lessen the suffering of a llttle glrl The nurse I saw was Frances Stewart and as the doctor turned her head I recognlzed Rozelva Thompson What poxse and pre cxsron were shown by these two women who were workmg to relneve the suffering of humamty From the calm unruffled seremty of the doctors ofhce there was a great change for the scene was one of excltement and bustle A store was pnctured and from the number of people who were hurrymg to and fro I gathered that lt was Pugf I' lyft r, 0 'CEN-' . . . . . . A or . . in ' ' ' to . . . 7 . . of l 1 l 7 7 ' 1 U lk wk nk . . , . . . , . Y 7 ' KK 77 fl ' , . ' - 11 1 1 1 1 1 1 , 7 ' 1 7 1 ' ed a large, clrcular screen upon wh1ch a picture was about to be thrown. And . y , . ' ' ' ff ,, . 1 1 ' . . , . . . ' 1 . . . . U . . , - - - i - in 1 J 11 , ' . V- 7 . ' I 1 . . , 1 ' ' ' - , , Y V I Y I , , . ' V , 7 . wif f fur 1 ss Sith a prosperous one Allan Brooks was very BHTCICDIIY waltxng on the customers and If was wlth true skull that he matched some mater1al for a dear old lady A group of teachers was assembled in a room whlch I recognlzed as one of Franklin Hxgh It was evldent that a faculty meeting was being held for I saw Mr Hyson addressmg the group I quickly recognized many of the old teach ers that I had known but there were new ones too For mstance I saw Helen Crouse and Eleanor Bruehl slttmg together Over near the window there was Evelyn Lnght and near her was Mary Sibley How glad I was to see old frlends Books books books Everywhere there were books' And rn the mlddle of the room surrounded by plles and piles of papers was Guy Harden the noted h1stor1an at work on his latest book He was busily correcting papers whlch he handed to has able secretary and stenographer Elizabeth Tramor The work went steadily on untll II seemed to me that I could hear the papers rattle and the typewrxter keys clnck Goodness' what a huge axrplane that was' Huge and strong and the ev1 dent pal of the two men busy at work upon lt Marshall Armacost and Edgar Belt were mdeed soarmg hugh along the vocatxonal road that leads to success' Again I beheld a doctor s office The sign xn the wmdow read Dr Becker and as the door opened and a patrent emerged I caught a glxmpse of a unxformed nurse whom I knew at once to be Ethel Schaefer Here were two of Franklm s alumnae who had realized thelr llfes ambition Thomas Johnson and Elwood Shaffer were earnestly engaged ln checklng the books before them ln the followmg plcture and upon the desks at whlch they were seated were the stgns Public Accountant Surely these boys were reallzmg thelr greatest ambltxons for the dllxgence wxth whlch they kept at thelr task could brlng only success A beautlful scene next greeted my slght It was hlgh upon the mountam and everythmg was clear and bright I could almost smell the pme sweetened alr Then I saw a group of men all of them well known clvll engmeers They were deeply engrossed ln their task whxch I thought must be very pleasant since It was 1n such a wonderful spot In the group there were Marlon Schultz Fred Wllson and Harvey Lawson I could see no more as the xmage faded slowly from my slght How brlght and cheerful was the room whxch I now beheld It was a very modern beauty shoppe owned by Evelyn Lockard There were many lnstru ments around the room and among these was Evelyn very busxly at work upon one of her patrons Surely a more cheerful worker for the task of makmg people more beautiful could not be found A group of nurses passed along the street to the hospltal where they were to begun thexr days work They were a laughlng merry group and I recognized many old friends among them There were Agatha Berge DOIIS Kieffer and Lllllan Stansfleld A llttle ahead of them I saw Mary Shoemaker Helen Warner and Charlotte Smlth It was a happy fortune I thought to myself that had brought them all together llke this The next scene was that of an office ln whxch two glrls Dorothy Osborn and Anna Klxngelhofer were typmg Here mdeed were two alumnae that Franklm could be proud of I :Jr Iwjtyfzle O 1 1 'coexi- - 1 , . - 1 1 1 - . . . ' I 1 1 ' ' 1 1 ' ' , H , . cz 11 ' 1 1 1 ' - 1 - - - tr 11 1 - 1 1 1 4 1 , . . . . , . . ' 1 - ' ee ' 11 - - 1 ' 1 , . Y . ' 1 , . u 11 - 1 - 1 . . , . . ' 1 1 . Y . . ' 1 1 ' 1 1 ' 1 1 Y . V . . 1 . Y . . . 1 ' 1 1 Ji, , ' ' , ' . .tt hr 551:11 at A glowing sun hung low III the West but the gurls and boys on the held next pxctured drd not seem to notxce lt They were hard at work gettmg ln trlm for the struggle for the champtonshxp It was then that I beheld Hunter Freeny as the boys athletic Instructor I glanced about for the girls instructor and I found her why xt was Elizabeth Owings' There were health and happtness galore ln thls scene of action The two gtrls who were typing away ln the next vlsxon would have won a prlze anywhere for their rate of speed These two glrls I knew to be Eva Fuller and Ollve Hoffman Across the room a man I saw lf was George Grothe who had been workmg wlth a puzzled look ox er his books now arose and went to the door marked William Simmons Real Estate Agent It was a happy comcldence that brought this group of Franklmltes together' Flames and smoke were reflected ln the next nnage' Crowds of people scores of machines and fare trucks added to the confuslon Newspaper reporters jotted down notes and rushed everywhere Foremost among these I saw Elwood Beam and Charles Morrill The scene was awe msplrmg yet beautiful and Franklin ltes were rxght 1n the IHICISI of tt What a large library' Goodness' where dad all of those books come from Wlaat a Job lt must be for the hbrarlans I now fully recognized them India Robertson and Gladys Gooch to dust arrange and take care of them all As they made the dust fly two women whom I IITIITICCIIHICIY knew to be Dorothy Woods and Mary Benson entered Both carried brief cases and books from whlch papers protruded From the warm greetlng they received If was not dlfh cult to see that they were frequent vlsltors to the library The faflhel' IHS ruddy COIHPICXIOH and stalwart I'-lgllfe PI'OCl31II1Cd l'lll'I1 3 l:3I'lT18I' laid dOXNI'l the fafln lI13gaZ1Il6 Wltll 3. Sigh HS he WHS IOld the HLIYSC that I-Iowell Denttst The nurse was Evelyn Baublltz the patient Donald Schaefer Ir was a typical ofhce that I saw next There were many desks 1n tt slgnlfymg that tt belonged to a large farm Among the gurls at work I saw three of my old fI'lEl1dS anet Watson Ruth Waddell and Dorothy Pearce Efhclent was the dCSCflpIflVC word that CBITIC IDIO ITU llllnd EIS I XV'1ICl18d CIICIH WOI'lil The next picture showed a large bank Behind the wmdow was Frank Shugars cashier while near hun was his assistant Sheldon Owings All Jokes were lard aside now and they were deeply engrossed m the1r work Ar the end of the room a door opened and Wllxna Rohde whom I took to be the private secretary of the president of the bank came out It the 6H'lClCnCY of xts employees had anythmg to do with lt this bank certainly should prosper I just caught a glimpse of an ofhce but xt was long enough for me to recog nue Edwin Cole seated ln the other room and Elaine Buckman commg into the mam ofhce I gathered that she was private secretary to Edwin Cole As she passed the stenographer Blanche Abbott she gave her a cheery nod and smlle whlch were war1nly returned Here w as earnest co operatlon Wlaat a pretty line the children made as they stood one behind the other before the teacher In charge Cnc by one they passed mto the next door and now and then I caught a glnnpst of the diligent school nurse Catherme Hollmgs worth And then I recognized the teacher It was l'rances Clark' lucky children 11:1 r Y, - 0 -. . tix-- I. - 1 ' Q ' , ' 7 C 1 ' 1 C Y 'V . I I , V - , v 5 7 ' 7 Y 7 7 ' 7 n y - he was next. Both of them then disappeared behind the door lettered "I'Iarry 1 77- i ' 7 . ' , ,l , , - ' ' . . . I , S I , . , . , . . , . ' . Y , . 7 V . . I 7 I I , . . . r 'A A , A ' I ' 1 h . 4 l . - , I 1 - V 7. 1 . , K . , . K , t , 1 I ' I 'l. 1' 1"1fYj'.sf,l' whffmf I mm Ah' Thls was a plcture that I was very glad to see Here were Edith Beall and Eddie Johnson working quxetly ox er their books or accounts The breakmg up of the class of 31 hadn t lnterfered wlth that frxendshlp A tall man stood before the mlcrophone and a gasp escaped me as I recognxze hum Imaglne Charles Stallings as a radio announcer but here he was and a wonderful success too Fasclnated I watched has lips and could read them I gathered that the featured artists of the evemng s program were Mary Wooden so prano Iahzabeth Beasman soprano and Charles Shipley renowned vxollnlst just had chance to glance about and fand Mary Elizabeth and Charles before the scene changed sllghtly Oh' there was Earl Long as the f3dlO operator Certain ly thls was a large and happy group ot old friends Several men stood xnslde the nearly completed bu1ld1ng whlch would be an ever endurlng monument to Fred Colwlll Edward Parlett and ames Schwart7 who had helped to construct xt Another man jomed the group and he led them to a corner of the bulldlng where he pointed out some wlrmg Wlthout a doubt t IS was Donald Hampt the head electrlcxan From the large letterung P Martin Lawyer on the door lt was very easy to see that Paul had rlsen hlgh ln the world In hls ofhce were Anne Slonaker the able secretary busy at her desk and Helen Runkles stenographer at a cor responding desk But then how could they help getting somewhere ln the world when they had graduated from Frankllno g1rl Mary Fowble was lookmg around the room and jottlng down notes She must be the lnterlor decorator who would do the room for the comxng ball But why was Katherine Stansfleld working away so dllxgentlyr' I looked closer and perceived that she was designing costumes How like them to choose vocatlons that would keep them always near each other Busy hands fluttered over the many typewrlters m the next scene I glanced about and saw that the room was at Franklxn And the teacher why lf was Louise Myers' How gratlfylng that she should accomplish her ambition A strange hght w as now comlng over the screen It was a pale green light and a beautlful one It sparkled and glxttered and was soft all at once Then across the llght flltted a fagure a txny graceful flgure that danced and fhtted about Surely I must now be seeing Mary Broadfoots dream of ambltlon But now all of the light was gone and I sighed' Was there to be no more? However the light came back It surged into peace and remained for a mo ment brxlllant and dazzllng And then standing out ln rellef agalnst the hght were the buildings of Franklln High It was a noble plcture portrayxng Franklin In all of lts dignity' Then the picture was gone The moon lost its strange look and became Itself once more It started on its belated ascent ln the heavens It was much cooler now and as I awoke I was delighted to hnd that I was no longer feeling 111 For a moment I could not place myself as I had a xague feeling than I had lost somethmg I was then that I realxzed that I had dreamed of the moon and everythlng' Wlth a slgh I arose and went out on deck Ar the ra1l stood the captaln looking out over the horxzon I wondered as I stood there lf he were beholdlng the same scenes that I had Laughing shaklly I took my chalr and began to ponder over my dream 111 INV rn l O CESK'-' . ' . 4 . . , I K A ' - It l ' C q A 3 s . . . , . . , . ' . ' ' ' n' - I 4 4 1 , ' t , 1 - 4 , ' , I ' 4- ' 7 h' , ' ' , . ,, . ., . . , . , v v 1 s K ' ' v Two irls were sittin in the lar e ballroom, which was now uite bare. Qne . g g . g . . v 9 V V ' ' ' ' Y ff 77 ' . , . v . . K K K K ' u C i-.A ' V 'C ' V ' ff HY ' ' , 1. ' . . 3 ' - . i ' . h , - K - 1 ' C 4 a wk bk as . . I t ' . . . . . . , , , t 7 'I I I "luv K Nl 'I Zgrlrvnv my V153 'N Ziff 01' R 'i had .o""" ,J 1 Iidllkllfl. Hlgk fchv wer .700 JJWJJ 6422 be Q,-if 4 gaffwz ffm 1725 Maw .-sf, fff ,Z-LSVJ7 was ri? ff! 4935 ,-95 fini' Q' QMQQ B6l7jd77ZZ!? Ffdilfiflll H26 wel! known fzgjzizm wzjizdw J7merzca2z pafrzof yfa ed an R618 000 pap! J Zerffown one 721 hi urzng Zfze mf WW Revoluiwnary r 7755151 cs "V JAM Hlsfifqy E 'V E nlj E 67726 jweetzes Ffanlrlzfz Hzgfz CQQIZ 5 Our Dpf gap R 9 me fhrlll of 0, LL 6117726 f X X w W!!! be yzng id' ia 774125 zzz If UW Kfiyle zzfzi 547' ,af I I- f I HF ' ' QAQZ-ri sf I vile' :ff FJ? +A -Qf"Y-- . 'N ii, ' 1, ,,:f.-'pq -- - 'Ya-wrf.'1,f'vv W. fur- 1, Dfw -' , -' X mm. ' 'L .9433 ' ,ul - J: gr -"':' 5:1fgf,vf , i f . 1 gisfg qfff , 1 3. 753515 Q 1' 1 1 ,.4.fl.Q: iff, '- if , , Z .ig T- -'3F'r f'? -" JU- In ' - 7' ' -"'f6'-'L y N -5'-X 4 x "H fig.: ,.' - ab' 4 'Q - V2.9 1 - -4 1 -- , W f f ,N 1 +P ,.'. .1 .- w' , . 3 4- 1 34. -Q-3 V fi - , ,- x V g . jf' AQ Ag ff ' I 5 4 L f - ' ff' ' L13 '- ' ' V? F , gi: , E:-gi' . 17 '75 ffm! I I 5' I ,' -' 'IP' .'j'Q',M" ' it-5 , V il, I, ',lyfr,,:-LSA ,. 7 - -I " 4,'Q,,-. :' Aw- 4 . W V' :.'f.... -' '1"'f-W .lf , mi' , -sf. -'.'fff I? J' " e A b,-with .wmv ,L M,-v ,IQ V ff If f ' .Q f - A, ' if .44 " "" 7 , " M! 4 . pe ,- 'lis . -J 'ri cf. 'lfffs .W ff-.uk ' 'Sir' 4 ' r- , J P j my v WZ Q X ' G. I arm. ln 1 ' 1 - - f - EE il 'J f- 5 ' . f - QL? RNIB -. v i . ,f f' 6 f'X1..1y, W K ' N , rr . rl X ,W - - 4 3 - x . , , X. A 'go ff ' K 1' " ' - v dp If f I w C77 . A ,, ' D . 1 4 X n - 11 . g., ' If lg -X un KJ ff , 4 52-QF X -fj ' I -A 1 A I F' 47 I Of M, ' f vmff x gf -'-1,-f ' x X ' - X ,D E 4 P IS fl 1 1 4. I T1 1 11' ll 1 If 1 111 11 L LIS Q 14311311 CKFL111 xv ll 111111 fllf If 111k 1111111115: I L 1 11 1 11 11 w 1 111 m S 111x1 our A m 11 T S 11018 511117 l f1'1rC,11L,11 Qlllf YUUQI 1 11111111 1111 SL 1 1 11511 1 L18 1 1s1111N 11 our rn 34 1 11111 pr11p11'1y 11 ff 1 111 1311719 cc 1r1 1 1 1Q XX 1 1 md T11s11me111 B1q11eat1'19d to the lll1I0l' Class 111 111111114 ue 19111111111 our 11111111111 111 1 1 S111111rS Bequca hed to the F1Cll1Iy r Hyson -X 31 Ford 111 rQm1m1r111C1 of I1 C195 of 31 1ss 111111 100 LCDII1 Ns 1 11e1111ss 1 1 1X11ss H111 111111,1er Ano1111r Q1111111 111111 IPPFL 'Xlxss 1-71111111 'N11ss T11111111 -'X11o11'11'r C me I9 prom S1111 18 N11 Q Cru rs 111121 -X good 111 11111 111111 'X r XY1111 111' Sorne 1ur1111"r 11111-111 1111111 1 1 111 s 11111 rx S 111nL, lr S 19 T71 '1n'1 Y 11 I1 s11m1 ggmcs 1ss Q 11r111111 A m0C111 911.1111 111 111 1111r1rw r C11 111r11 X 11111111' c 1sQ 111 S1 IW W 1 r r 11311111161 m 1 1111 1 11111 C. mx '11sx S1m1 LXCL 6111 'X 1111 N111 1111 Y' 1171111551711 1,1 C1l1'1f 11111Lg 111 Ixllfl 11:11 IT1L1 1 fur 111s 11111105 F1 11111 A 131-1-12 rC1U111 K 155 111 K1111 k115r1119S I1 11121 1 s or cry 138 COX 1471 lr 0m1l11' is 11 K 14 L1 ll fme YUUYL 9111 II 1 S 115 I71i3x111K If v94T0u.-b1c ,f 111 Q , 11, 11111 111. ,s 1' O11 - 11-11411511111 N1111- 11111- V 11 -1. 411.1 T11 1y- 111-. 111 111111111111 15111 S11 111. V111:g- 111 R-.11 . '11. f ly' 1 15.11 W1-. .11111 S1 - 1117 X11 ylf 1. 1 11 1 1'1'1 ' 111314 111 1511 11,10 11 .1 Ll,I '1' A' 1 171 A11 1' . 511111 17L'111lI 1 ,1 11 1 ', lv 1 1x'1'11'11t ' 1 5011. 1. 11:111 '11c1-. 111111 .111111y, 1114 1.'1l,' A' f 1 ,1 V11 ' ' '. 11 111' 111' 411111. , 11 .1'1. amd C1 1 1. 1 1115. 1 111' 1. .1 ' J ' T . T11 1 ' .1 ' 1 -1 1 '1 1- 11 1X1 . ' 7. 1 1 1 . - 1 rr N1 S. 1. YA 1 1111 1 gg C1. ,, 111111 V111 11s 11 f -, . 1 14 -. .1 'L' 1' f 1 -' 11. '- C111111 S11z11cc5pe.1re as wc 11nv1-. 1 1 , ff 1 I -WI . 1. . L 1 1 N1 - . k 111. g '. 5 1 1 1 "1 A Y 11 - 1 C11 H1111 s 11 - 1 315. 11 1 +A g 1' 11.111-1.11 111. 111111 1111 1X1 ,, -: 11 - , 1 1 - ' . 1X1 f 11 --f S 1. .. ' .11 11 1114. 1X1 N11 . - -A far 111 KFY 111s .14"r11'111 '31 111 -'1, N1 , 1' .11 1 1 -l1- 11. , 11' S. N1 '111 , -S 111 - ' 1. -1. . 1 - Q 1' V1 , .1 1 . M11 1. 1-rf - 11 1. -1. 1.1 f. . ,- 1 1 1- . -1 xx C1 1 '. K1 Q .' -A1 11- S c1.1,, 111:11 w111 11111.1v1' 111 111711111 113 'vN'P11 ns 1-21 11111.'1', N1 N1 1-111 -'11- -S1 1 ,.1. 111-111s .11c11 ns '11 1. . A 'QC1. '1 11. f"I'4f'!l,,' ,, .,,1 I511111 I1 B11111'11I111I to the 1111111rs lI!dl 11I111IIx 1111I11 1111'x 1111 I51 r III 11 K5 I CW l LTOL 1 Ill 111 IX1111111 1 IIT US 1211 11111111 R11 1111 111 111 I' 111 S HS IN KN OHLC I XL 1x1 1I1 NI11 11 ' 11 1 I I 17111 L IIIISCQ 111 11 1 IXIIL IOIL Il 1 IILII 1 XI'III'i L 111 'sr 1 S 11s1 CTEL s 13 C 11r I-I111 11I1s C111111 1 s I1 If 1111 1 11111 f111111111 Co 11r1L1 C1111 s 1, 1 1,11 1 1I 111 S111 11111 XX LIWSILI Cox 11111I1 H11111111, 11s1111111ss N 1 1 0 lla 111 R1111 XV1 1 IN H111111s 1111 1 ss I1111 II 01111195 HL H11I111111 S LIS UL LI I XIIIX I511Ss11 I I SHUI Ilklxl ll L CILIITLIIL 1 II UI 1 3 StI1'I'lI'I 1 11801 UU1 URM I 1111 s 1 111s I'r11 1 1 1 1 11111s 111IkI1111I1 1 111 L15 IIN S4 I II 817 1 I7 111 II U11 1 7 IKII jfs gkrvwbrc I II? - I .c.,. J ',-' ISI. ' .' All I111I111v1111' 111 CQ.11I1111' 1 JIQC . . IXI1 .I4II A1'111z11' SIAS 1'I111'I4 C111111 I1'x1 I1 I1 II' ' '111 If11'Iy11 ISJILII IIIZLS I11v11 II111' HI. '. ' XY' If 1 1 IJLIIIII I51111II's s1'I111I.. C KIIWIIIIY 111 Ifl -1 11 1I11'. If'11' 1I I311. IA5 I11'. ' 1I11'11Iu 111 N111-1'14 I. ' 'mt IfI11.1I11-iI1 I'11'.1:11111 ', 11111:.111'1-1' .1I11I111' 111 R 1.11- 111 I 1 P114 141111. IJI11111 I11-1'I41-1-K I11 - 111' I11111Iu 111 Ill .I11- 1 . 1111-1' If '1,.11' I51'I1's XY'I1111p1'1 1 5.111111-I I31-I1 51.1-1' I51-11s1 ll-5 .1111I Ifx'11I1'11 I 1-111I11's s11'.1I 1.11-111 '11 Il11I1111'1.1 ' .' JII. A511 I:1 I51-111155 111101111 I1 I1 I11-1' I1.11r 111 I:1"' 1' IXI.11.' I51'11.11II'1111.'s LIQI 1111 .1I11I11x' I1 : . ID' I.llL'1l All. I 111Ii.A ixlif 1 II. Ics 1 'cS. FI411111- I5111'I1111.111'5 111111-145 111 .-X115 Ii11s111', GI. ' 1I'. I1l1 A 11.5 j 11 f' f 1111, Gu A - I' :I11": j1f 111' '4j:I" Il C..dw1 11',I IJ . I z I1 In I 111 Y'.1I.1Q N 1" a d ' 1 ISI , G1 I' 1 'I1 ', n111I Ed 'z '1I I'.11'I1111S .1r1I111c 111 I I -A ' OI '1 In 1 I1 J 'Iv 11. . 11. ff.11I1111 111- II11II11111Q ' 'IIIIS 111 11111 . 1I - " I111I11s 111 fNI.11".' Y. ' ll I'1I11-I S1'I1.11I1-111 1'1 51' rI11'1-In 111 cI1'.lI1l I'.1. - 4 I'1I1.11'1I ,I11I1 , 115 I11151111m5 1.1111 111 I II1-1' G I II1 1 .1. vI11I111f.111As :11I1I1'111' ZIIVIIIIV 111 .-XI J V 11I.1 .111I ,IOI111 C1111 I311'1s K11-II1-1K 31111111c 1.1I -111 111 I'I1-.11111r I51'. ' .-X11 . ' ll j 11I11'1--3 s11'1111111'.111I11c .1I11I111' 11 R'I 11'- 111 R III1. H, --1-1' 1.111-,1113 11'1II1111 1-5, 111 1 1'I4 11 H11-I1-1-1 fi11II . 111 H. 'rx' H 1 'IIB 17.111 111111111I1-x11111 Il IQ111I1.1 I'11I 1 11 11r11 11 7 r1 L15 lx 1 I1 111r11S 11rI1s 1rr1 1 1 1 1 1 d1I I:ss1g, IDOI1lId ScI111I1r flllx SP1 1 1 I:m1rs11n I5111S 11111 111 1 Q1 F111 ID11111 111111. S11 1r 111 1 1 S IIISIIL 1s1 'X 111 11111 111 X'11I11111Q 11r1111 I 1 11,11 1 111111 1 11 S11 1 1 11 11111111 Y1111, 11111 1111I XI11rS 1 1 C I11rI1Q 111I11 '1111 N1 1 H1111 11 'NI1r1 SI'11111111I1 111 I7 FDI y T I1 Ir111I1 SI1u111rs 1111111110115 gljI2.,IL 111 Ycmts XX1I 1.1111 In HT YUIIS f1IIx IU I1I"lOl'11XS Lf' X11111 5I11111I111 1 1115, 1 1 1 XI11S1I' 1 ' X 1 1 1 11 11 11I 1 I II 1 111 1 11 11 11 X 1 x1 1 1 1111111111 s 1 11111 11 I 11111 1 X lfg 111 II 1111 1 1 I 1 Xl 111,111 s 11111 f 1 1 N s H 111111 JY-vgT01vb1c lf, III, - I Ifxr-I1':1 I111"'.1r1I's 51,111-I1' 1 11" 111 I11 11I11' Nh'- I':111I fNI11r:111,s 1I1'I1:1::11g .1I11I111' 111 XY'1II1.1111 IL1 - I -, 1311 -. XI1 II.. :111I G1'1v1-r Cf 111I1's 1I11cs 111 RQ111- , 1 1 'l' As I-I 1 1"IIrI fl U i ' XI1 ' 11 S-cI111Iu':. -'-1'-1 !'L'Sl'!1l . 111I11 111 ,I. 'Ics .I1 1 Q-I11. 14'-1 H1111 uf- II11' .111' 1,II1'. 111 R11I11'1'1 fr. '1I1I. I.K5lI . . IYl'I'3' IX ' IWIUNN K'IA LIl5l3K55IlIlII'l Ill 'I-Ill" 1 I'1-1'1-g1111' :111I NI: V' V' Ik .. I7 I.y 9111 r1'1"S I11- gl 111 R1-I11-1'1'. S, I1 If.. I1I1-.' 111I QI. II'-.-E I11 I4I4'- j .IIWIIIIY 111 R11,i1,'11 ' gl E . . j1. C1l'L"l1. f 1 1, Sh 1," 1. 1111.111 .1111-1-11 .111 ' Alf V' .1 ' 1 'LTAS CLl1'I1' IIHIYA K1 l I1 I I IiI1'l', Xlnrv S1I1I11"s I111'111I1-as 1111115111 111 I.,1R1111 j11I111s1111 WWII: 1 S 1n 11"111g LIIWII V' 111 ' :J If- - rr-fl, A 1 1 , ' 111k ' 111 I'-gp' H1115 11111I fix--I1'11 1'1,1.fl..1111 S11111I1'1 1r11.1,111111111111 111 X'11'11I111.'1 V, Ics ffI1.1rI1's S1.1II111,J I1r1II1.1111'y 111 I11s1 ry 111 XX'II...lII1 R.1 71. K.11I11-r1111- 51.111 '11'I1I'5 1111111.11'11I.111- 1Ir1-ss 111 QLIIII K1- ' I1II'.111 811111. -I1I's 1I1g11111' t1 I 11,1 R.1"1' !:Y'1TI1lkI'N SWW 1lI'I"1 IrII'I1KIIlI1 'SS IU XIJVY r5lllxI1I'I'. R11 -I1. TI11 , I. .111I IfI1-.111111' I51A1111I1I's 111111111 -. 111 I511r 1I11' 51 ' I1ll1 ' '111'11 C II11-I1I's 111t 111 :XII11-' I11- 'I1'r H"Il" QUYTLIVS- UIII !:I'1Il1fCS C:I1lfIiAS Y ' 'SS 111 I111I11 111 NIJI11-I I1.11-r. If1I ' RIV5 11111. 111 If:111l1:I1 cI.1sS 111 nrry P111- I 'Ill' 511-'jf 'wff' 11 C111111 s 5,1 111111 111 1 I3 1' 11,11 R1 1 1 111 Crous1 S sucuss '12 11111111111 1 111 1111gsv111r11 1rx 1-0111 1 s 111 110 1 1 1 1111 11111r 111111 l3l'1 It H 1rs l cf '1I1L Cfrlf IX 4lK1 11111111 NI1111115 1r1111 OS17l3fI1l 5 11111 11r1 111115 Ruth Osborn E.l7'ibCI1"l Oxungxh 1111111111 111111 to 15111111 D XLSL Q1111do11 OMXIILS 111111 C 1r1C111 to XC1111111 f11111 1nd Cirl B1111111ger 1111 obcrlson S yes 111 A1111 11111111 1111 XX1 1111 R111111 s S 1111 1rs11111 111 1111111 lk ll 1 1111111111 Tr11111rs 11 11 11 O51 ll IN 1111 9111111111 Y1r1111 H1 111 XV1r111rs s11m111ss111 X 111 It S 11 11 11111 XV'11so11 s 11111111 1 151111 Nl v 11 X11111r 11 W1ru11 'md 113111111 Arm1cost Fr1c1 W 1150115 quxetncss 111 111sQ 111 1x111111111 1X11rr 1nd xncl Os1111d Nlummcn Vhrx VR 001111111 5 11c1111ess to lc-111 X '1u1,1111 RU111 XX1dd111s 1tten111e111s5 1 E11 11511 1115s 1 Ruby N111 1VI'1rs11 XX1 11111 we 11 O111 T11111s111 N1111 11u11 rc1 rn 1 I1 1 51111111 111111 111 1 r 1 N111 LY U lr s1 111.11 1 11r1 WN 1111 ur 1 s 11 Y L 1 K TL 11 k Ljlwlf 1111111s'111d 111111 111111dr1c1 11111 1111rt1 11111 XV11111ss1s 1:1 If 51151 TH BI AXSNI-YN CH XRI YQ QT311 1 VNGQ If QT 1051! I x Y . I Fl' '1 . ' Y 'I v 111 111 ll1W1i' K lk 'I l V1C1C. H-l- 5 : 1 . ., '4 -. 11 lill- Hoi- 1 , ' 1 . 51: ' ' -11 4 '15 ,11111v 111 H1111 111 ,1 1115. 111 1 1: 11 11351: 11. Il .1111111y 1 1-1111 8111, 11 ,. 1fv:1 F1111-1-I . 1 D 11 I' XV 115' 1A1'11'11111y 111 J-. 1 1 1 4 1 1 D1 1 . T. 1. 111.1614 11:1i1' t11 :I K x K -, nv X. 1- I C. K i ' b, YJ. - hi K xl V I ,4. v 111112 K' 11 1, .1-C1-1. "1 . 1 ,c 1. . 51 1 '1'1l-'. il . 1 '. 1 'l'1lI 1 '. ' C111 ' 1 1 T1 N V 1 lx' .A -.Q I '. X' L' ' .Q C n . JI ' '1 if 1 71 V nl H1 ldd H 5 7 x II X A K "Yr 1' 1 R ' -'-111 lg 1 -'Kg 11 1 1 df -1 11 1 'I411I '-0111. 11111 Q1 I1 1 ' C1. 1 11- 1111' , 1' -1 11 111411 11111 A11 1'1- I5 1 Last XY111 111111 Tu' 1 1111 XY- 1 1 -1 ' 11 11511115 111111 :r:11s 111 11115 111 '.'. 1111 11115 Ik"1fI1 1313 111 11 - your of 1-111' 1. ri 1 .V D 1.-ff' Zfffsg 3' T' f 4 ,ik vs. H---....,, 32 '-'Wh T f 1, ggrlxfikxrfr Schedule for F H Tram Leaxcs 1zL1 1 IXINIIE 411 L 1 u vw womn rn xprm s 11K 1 1 c umor XtLO1'l1IT1OQ'lf1Ol1 umxstrx L I 4 5 mor 1llN1ILL H cum L 9 ffm QY1 Arrives At 111rn1Vkor SkPflIH1tF 8 193 umlxtrx S1 ptem1 r 'S uxsncs be ptf.m1ur 'G 1951 une 9:1 J V, qv' N , ,., 'Q k ll- 4 .1-V , h 'Q -fl! : "We :wi j as 1 V 'j',3'1A,, ,hy . V3 . 5 V ,v., , A 0 I 3, lf, gui? I iff y! .A ,M 1 1 fs ., , M Ww.,4xff'ff ml 57 ny, W, M 2 ,.-.,,mhw ' 1' , -:- Q 5 .,:- 1 A - '1 fo Vo So 1'-!'CS11IH!1I1 ' "g1 t 1'1.j 1' vs 11-l 1111 1 V' 14 JL1n'l9.12'1 ' V . 1 Sql w -1f' 'rm .. II C1 ' '. 1TI'Cl1C11 .1un'19.1231 .3 1 wc 1.1931 J .1 " 1. C1 - . j 1,1 J -ILlI'l'11.1JS1 1' X '1. 'c .' '1 F. . S. F - "r ? ? 'f Q' F JLm'1.1931 -I ,1' Pagc' Sixfy-four Page Sixfy-Sir Page Sixty-sewn ...I Class of 1932 111111101 I11s Fulozs Bluv .1n1lG1.1s 01' FIC ERS P11-11110111 H1111 III N11-1111119 l 111 P11s11l111f 1111111111 OXNIN1 N N11 1 1 f111 If 1111111111 1 D111s1111 1 11111111111 l111xu111x111 11.111111 1111 ISUIS l-1l1tl113 A1111 111111 lllllfllll 1i1l11 I 1 111t B1-115111 111 111r11t1 Iglll N1111u1l Balt X l11rt 15111111111 11l11 rt 1311111 4 Ill li0lllllgt!' rx 14111 ll11r11tl11 liur11l11111 ll 1 rlnrt flllllw 4 11 X 1l1st1r I x I-1111131111 Inns 111 Yllll D1 N wx 8111141 NI1 1111 I 1111 s 11 lls l1l lt X IIIU IN Nlu X11 1 1111 N 11 ll 11111tl1 l 1l1 Il 1111 11111 1 nltl ll1ls1 Mn l'11s0r li 1111l lll lws g llltrlll 5 r11 ll 1111 111t IN X1 1 hy 1 X11 1 X111 lrsl 1g1r1t 1 1 1 1111 lhllll s N1rr1sll1111x 1 1r1 1 1 I l1'I 1 lll 1r lllft 1 w 1 H1 11l111s1 R11 l 1 Xl r ll lflh 1111 lx ll1r 1 1 H111 P11111 Surly ezghf l1111x11 xox X 1ll1!t1 N1l111 1111 l 51111111 R11l111t Nt111sh1l1l lltlllX Noll1 1 1l1 1ll S It 111 111111 1 l11 1 1 lll 1 N 1 1tts H11 1 X l11 1 NX 1 111111 ll 1 1 lr ll 1 1111111 X 111 ell,-ll llllgllllg, X 1111111 1 k 1 1 , L- . 4 . 1 .. 1 T 1 N K " ., . , .' , 1 - ,. 1 - 1. 1' 1-" Q .............................. ' 1 "1 .' ' ,. 1- ,, , U , 1 , , . 1 , . .- ...................... -I.',' 1. " . .' I 1' . ' 1' S lhl -': "."11ll llill' l 1: li: V' - - 1 l V: 1 ' - : ' -1' 1 I 3 Xlzll -I ,'.'I1-r llc-l -' -2 1115 S1 ',' 1 : : 1:51 Elin: 1- l1 .l: U1-1' -' -' : Q '- . - I 1 '. " :lr F1- --ll Rull' . zl' . :rsl - 1' -rs -': 1 ' l'll1-: 111r Fr: 'is .l11:11111- - .lz l1i:1s V111 V- fl -1-1l 1 I - ' ' " .l11l1 Hill K1- - B:1"l:11l Al 's 'l'- l:1 ll -' - ' 'll llul G -l1 II11' l I' .l'l1-s .X1'1 1st1-:11l T11111111111 ': ' ' - Nl1l'lt' '1 11- Hx' -lyn .l s1-1' lP11'1tl1-1' 'l" kl -1' R1-thu BQI11111 Un-111' limp' llSN'2Illl 5llllIlllll'l'l l.1-11:1 villlgllll Xl:1 I' -l11-1' Bly- .' 51-1-1-11 W: lI:11-1- .' 'ris Yirgi11i:1 V111-11 I' : Xl:1' : - ll:111111t Rull 1 sl1111-11 xlfl .' "l.'1111 A111 1 l,11uis1- 'l11-w 4'l1:11'l1-s ll1-ws R11l -' " gs H11 'y Vil ':111s H1- - ' '.'lIlI .'1 : ' 'l'l1-l1l1:1 l'- -g1 5' Rua: 'a Ish l'li11t1111 ' 11k Mil l '1-1l ll: 'uw lf11s:111111l11l1- l'1-:11'1-1- Nil ' Will':111s Y- .1 - 'ox liilln' lllllll i1-s ll:1r1'y ' l11111 Yi-11 ri111- Y: lllil I - ' : l'Ill1-11 ll11lli11,,g.'x1'111'tl1 Will':1111 :nft M11 Y:1'11t:1 All : lk- l.ll1'il l.:1R111- .I .'1 ll l.11uis1- : '1-r S11 - ': 'llil li1- 1 'xv1'Sl' Curl l' -i Fl I'1'll1'l' tl11- l 1 -' " ' I l'l1:1rl1-s lJis111-y Sli 11- '1- - R1-I1-1-1-1 lin '11' Zlll Jvmzor Ruth Ke1r Ru! 15 1 new member 11s r1ght But 1 re1dx shes 1 rue l'ra11lcl1n111 Mary Yaruta Nlary IS always as neat HS can be An she s yery ll l1lsed by all ou see Florence Rothe nlthough Bunker 15 our sm11les scout She s our gre1test or1tor xuthout 1 doubt Ellen Holl1ngsmorth By h1s work the vyor1xm111 IS lt11o1y11 Lllcn her 1b1l1ty h1s cle1rly show 1 Mary Wllllams One of our 111d11s1r1ous cl1ssm1t1s 1s Nl1ry A11 Llrthlllqly sht ls lwllll Cllldlrhlly Ruby Mae M1rs'1 ller sxltncm c1uses us to mondtr Does shn utr m1l1c 1 blunder eann tte Mathias As happy go lucl1y 1s she C111 be e111ne te IS 1lvy1ys lull ol' glee M1nn1e Kellar Narsuy pracuc would surely meet IES doom Whrhout Mmnxe to help e1ch 1tternoon We would all be l1lce Dorothy 11 we could For the way to be happy lS to be good Elizabeth Manger l:l1z1beth s g1ft of 1rt IS qu1te 1 1re1surc In dr1w1ng pretty g1rls she t1lces gre1t plL1sure W1llette Schad When theres 1ny l1ughter 1n the h1ll ust thmlc of Sch1d she s the c1use of ll 1 LOUISE Rayer lou1se h1s set for us qu1te 1 r1te For she s neyer 1bse11t 1nd she s neyer l1te Eleanor Francis Sm1ll 1nd l1vely IS th1s m1ss XVh1t would we do w1thout our T157 Rosamoncle Pearce Pearc1e IS our l1V9llCSI one She s 1lw1ys re1dy lor some tun Retha Bolton Reth1 IS 1 jolly l11r Southern l1ss Wfho IS 1lys1ys seen blushmg 111 Gtomctry C 1ss Anna LOUISE Chev In d111c11'1g XvLCdlL dots htr p1rt To gut IK up would brmlt her ht1rt Vlrglnla Wales VC hcre s B1lly9 ust 1slc V V Shes sure to know oh yes mdeedy Roberta Drlscoll Peggy IS just an all around gxrl And to any class shed be 1 pearl Edgar Rohde ln hshmg Edg1r neyer t11ls Espec11lly when he s c1tch111g VS 'iles Wrzte Ups Carl Bollmger OHL Ol' OUT 2l'C'1fC'Sl l'TlUSlCl'll1S IS ll? Csnlfl belongs EO the OTClIeSll"'i 'YOU See Webster Cox Though W1-bsrer jo111ed us just tnts ye1r 'lh1t he ll ta1l he need not tear C lclw ell Speed XX nv the l1ughter Tract the source C1 dwell s br1ght rem1rl:s of Course S meon Yaruta Qlsr 1r11sc for S1mto11 w1ll 1lw1ys 1st wr s 1 n1t11r1 st 1 ho C1111 u surp1ss1d Wallace Norris XV1 l1ct CII1 dr1w tht XI0lll1 bon l 1 TL 'lt kl YSL I I1 TN H rbert Culllson r s sn but ntxtrtlu ll C111 bc hc1rd wt must conltss Wllllam Humphrles Alymys happy IS our Pres1dent To le of 11d he s neyer hes1t1nt Henry Sollers Hes squ1rely bu1lt 1nd yery tall ust the lcmcl we need for b1slcetb1ll Somettmes he can 1ct the clown But 111 s1ng1ng he h1s won renox 1 Norrls Harvey A yery good sport IS lN1clc Hes 1lw1ys re1dy for 111y trlcls Thomas Ferrell W1th my good old Chex rolct I w1ll dYlVQ your blues 1w1y Harry Purdum Our most 1rdent gum chcwer IS th1s l d He cons1ders gum chem111g qulte the l1d Oscar Gray Osc1r represents the sm1ller goods But to be sure he knows h1s Wfoods Wllllam Ranft To h1m studymg h1story IS no t1slt For he 1lw1ys lcnows 111yth111g you C111 1sls Alo1s Trunda I' u11d1s m11n h1b1t 1s 1 Vs ol ls shootmg 1 b1sl4et 1nd n11lc1r1g on Harold Landls He s usu1lly 111 m111y 1 plwy Bkfnlllbl hes 111 1ctor 111 tytry wu Samuel Belt S1muel surely c1n Belt 1 soccer 1 Although he ISD t unusu1lly 1111 Mary Bucher One of our br1ghtest 1nd most SIL1dlOLlS Boolcy And neyer neyer does she pl1y hoolcy Dorothy Burnham let s be merry hang sorrow let your c1res dr1l't unt1l tomorrow Pug: N 1 5 1 'I 0 1 1 1 X 3 1 1 1l 1 ' ' 1 t ' 1. 1 - , . S 1. , . V V V . ,, , , . VV Cl ' ' ' we ' ' 1 1 y' . N 1 ' 1 , I 1 , . V V , ,f V , , 1 V ' ' ' 1 K V ' - - ' '1- ll he' 1 1 111 . 4' 1 A l ' 1 ' d " 1 ' - , 1 W" il g '1 s 11,115 1-:llk cv, 1 1 1 e ' ' - ' - - 1 ' - . l'4l'Yl,L : lf mll, 1 '- -less, - 1 '- 1 'I 1 - ? A: 1 1 11 , '- '- . JV L A '. VK S- . K ' ' . . V . ' 1 - ' O . 1 ' ' ' , . 1 1 1 , ' 4 ' 1 1 A . J ' ' 1 Dorothy Miles Albert Benedict 1 ' ' . ' ' ' , 1 ' - v1. ,I 4 1 , ' 1 ' 1 II. ' ' , 1, , . 1 1 A 1 1 , I - 1 1 ' ' 3 3 V V I . V . . . V VV K 'K K 5 I 11 L t 11 I Y L A C, ' 1 - '..-C ' 1 . kr 1' 1' 1',1 1 e, - '- U ' ' 'l--- VK1 1",1 1"flg1l. fy A- ' . VI 1 H . V 1 V 1 H U 1 ba ll, - V - ' 1 A is . V V .X . . rn vy 1. 1 V Z .4 , 'S V .QIQI '1-f1,'11f' Jwmor Wrlte Ups-ffontlnuecl Edythe Armacost H nu luxe lust for to 'tx So LITIOQ yourself nhxle you ITYIW Catherine Baker -X qutet llttle mass ts she Though lust 1s busy 1s she C111 Anna De Luce -Ks merry 1 the d1y IS o g 'No hme, utr stems to go wrong Bertha DeVese Ot course new m1ny 1n 'tthlete But thxs one C'lI1!1OI meet defe1t Avis Ensor Aus IS QUILI 1nd sed1te Ont who nexer comes n llte Marne Gore Her XOICL still echoes through our mmd Although lts not operetta time Margaret Hallmpt Amld our cl1ss 1nd comp1ny A quiet country l1ss IS she Rebecca Slmonds lust 1 h1ppy go lucky unxor Alw1ys vutty 1nd full ot humor Rebecca Rubm Becky IS well known for her wlt And is 1lvw1ys VIlll1l1g to do her but Thelma Peregoy Thelm1 ts 1 blonde mxth such plL'1SlI1g ways Sh CLI'I'lII1lY helps to brighten our d1ys Ruth Osborn She re1ds 111 the storxes she c1n Find l spec11lly noxels th1t s her lillld Mabel Luster She s just the lcxnd of trrend we need She uorlts qulte xulllngly Indeed Larue ohnson But l1rue IS noted for her l,7Ll'll"I'l1I1Sl'1lp Mildred Harrow Nllldrtcl llib 1 l1L'lfIy llllb., Th u cxusts upro1r rn our rlxss Dorothy Tmkler Rlthou, h to I'!"1l1lxllI'l she comes to moo Htr mind ns ln lwnltshurt, Iena Vaughn Iflk U11 IS LI11 lllglxll or ptop t 1 xv Us me vt ron, Vlctorlne Yaruta JKIXLYIIL 5X ITHTK1 111k L, l1t5S ILIUYHTL 11 I1 DIL ITL 5 Rosa Walsh Htr LHLL I1 'IDX lllnti OLS H 1 IFFILS 1 I' Silt X Illl"UUb,l TL TX Naomn Wftlltams 'N lornl VK lllI'iXTlS x xthout 1 wok 1 1 ehlld x lthout 1 IIJIJ Grant Baseman Gr1nt nexer bothers mth 1n excuse For 1tter 1ll vsh1t IS the use Roger Ymglmg Rogers blush comes ln 1 rush Xvhxch quxte 1muses 111 ot us Dudley Gooch ust 1 carefree h1ppy boy In te1smg the gxrls he takes great joy Herbert Bowen Why should we come to school 1t mm Wfhcn coming nn l1te just sults me fine Cllnton Cook From the sxze of the frog me c1nnot determxne Hou f1r xt can jump how much nt ns le1rnmg Emerson Davxs Sm1ll children should be seen 1nd not heard W1th Emerson this would be absurd Charles Disney Hom quxcltly his days are spent, They re full of pleasure and content Randall Esslg There s none as happy as thus young lad Nothing ever makes hlm s1d Robert Owings Bob never comes nght on the date For why be early when you can be l1te9 Charles Hewes Two thtngs that help make lxfe worthwhile Are a frtendly word 1nd 1 cheery smile Robert Stansfield Although one may travel 1t a moder1te p1ce It s slow but steady that wms the race Yeatts Wllson Tall h1ndsome, wxth dark brown eyes ln 1thlet1cs he takes the prxze Oswald Mummert Speech ns snlver silence 15 gold Do not 1lways your thoughts untold Kenneth Markland Polxteness goes 1 long long w1y To vsxn 1 ch1r1cter for us tod1y ohn Gxll ohn bec1me 1 st1r soccer pl1y er Although from pr1ct1ce he m1s 1 s r ytr Myers Green Seldom he1rd seldom seen Th ll s the fellow Nlyers Green Vernon Zlnk The stxllest vt1ter IS ofumes deep But unto 1.,rt1t ch1nnels ll mll crttp Armstead Thompson Ot snture he vs1s p1ss1ng t1ll Sp1relv buxlt 1nd le1n wxth 111 Loretta Batz Peggy lxltes to study htstorx -Xnd to her Klng -Xlbert 15 no mysterx Evelyn Moser ixlxnys l1ugh1ng 1nd jokmg ns she She spends her ume quxte happily 71 Q 0 ' Y x , , V . , , It '- V A dt j, 1 ' 'l 1 f ' V ' ' l ' ' 1 1 T . 1 1 , ' . ' ' 3 A .5 . . . V . , V I V ' V ' . V' . . be. ' ' . . , . f I' . s H . ' l n , J 1 . e ' , X ' I v 1-1 11 A V Ay K ' , 1 '. ' h ' ' t ' . t ' '. 1 I ' 1 A 11 1' K V ' ' K ' A ' ' . t . 1 V ' 1 ' 1 1 -1 1 I 5 ,V Y t ' ' V I I , . V . V V . , K . V V V V VV . V . V l K K Q Y ' U I . , . . - , 1 - - - J ' 1 ' ' 3 A Y L - L 1 3 V . V . F V V , . . V . V VV V V. . . V V V V V . V V. t . V . . . 1 e 1 .I ' 1 . I K t . Q v il K 1 -'A K K L I 1 9 f 1 . " 7 . ' - ' Y ' ,T 'R x I A . -1 Y D ' , K . V' ,4 i , , V V . V. . V V . U V . , . L 1 Some are remembered for sxlence or wrt, K ' V ' ' - '1 L . . ' . ' 1 '. ' 1 jlm 'I 1 . . ' 1 . ' ul . . L ' . ' V L 'V . . , , Sd 1. 1 . ' - 2 '. 4 "'t .1 - A M ' j as il rule. 1 K. V 1 V 4 5 V... x - A Ak ITA ' hz . I. T Q xt v ' 15 ' l- .l sg.-ll II ' Y. . . 1 vt 1. V . . I Y is A x Y ' 11 I C' V -d ly l : l glad -1 Y ' - l. s tu .l -si A 1 '. 1 ' . , . . - X T 1 . ' . . - sul f c ' 1. I' -. d - paw. V . A1 d cr x lu . -lj vl rl - d. A . .. .. " 1 1 1 V . '. H . v . l , '. ' . ' . ' ' ' -g Is l kt- . ' v 4 toy. 1 ' ' ' . 1 f S' ff If, Page Seunfy one -. ' V, :1 111111 1111111 11111111111 Class of 1933 11111 S11s1111 F11 111s 131.1111 111111 C 1 1111 1 I1 LHS 1110 111181111111 51111111111 11111111101 A11 1N1111x 1118 X z 1111 -X111111 H1118 Allg6I1k'1 11111111111 Xr11111 t 11111 Igllll 111 Igll 1111 IgllIx 11111211511 11 15 1 Il 118811 I Llll 1X H111 1111 1111 15111111 1 111 I 11111 C r 111 1 I11111n1 Lolll on N119 blER1IN1 11111611 C 0l!lg'lll XX11s1111 f11110u111 R11111 101151 11111111 1111111111 111x111 X111gue1111 l1111s X 11111 Il 1111111151 11 111111 111111111111 111 I' 111 lll I-1111 Y 1 1-1111 1 1-1 1 I l I 111 U rg,11111 1 I111'51 FIX 1111111111111111w1 1111111t111x 1 Ilhmmx NN1111A'11w I10111.RT I1NIlxl LR JANL XNIIIIANIC ROBLR1 1 11111111 AN N111 NN11L1111.1z Huw II 111111011 I 1115011 1 111116 L111g 111151111 Lung 111 111 1111111111 1311 X 11111111 xIIlIxIl1l11 111111111 N11t11er 11 1 'X Il 1 N s N 1 x11 X11g,1r11N11s X X 11 1 1 I1 1 1 1 11 IPlllN1 11 1 ll 1 1 N 11 x Nllll 1 1 111111111 9111 11 P11111 511111111 tlLU 1I'I'1:.N114.I LR 8111111 51111111 511 Ill XllI1llIxIl l'l11111111 5111111113 1 11113 S1111 1'11111r11k 51141111111 1111 111 In 11111 Illl tl 1 1 ll 1 1 X 1 xx I s 1' XM 11 I11 1 1 X 111111 NN lt 11111 XXUS1 11 ux 1 f1 11111 nk FI ............ 1 11111 T 4W 1 1 K1 J . , . 1 1 v ' A A 5. ' '. - .,.' , 1 t. vw , . I' , 1 u 1 1 v w Y 1' ., . . . 4. . 1 1 v 1-'1111 1 111115 '11 ' ' 1 I ' 1: : C ' 131121111 . ' :-ost " S ' " ': 1 .': ': .' " ' 1 l'1 - Q: 1 V ' ' fi ': 1" 1 - :'0s ' ' f 1 XV:11 1' nvis l'1: ' -1 1' 1 'art ll: '11 :' .:' "1 l': 1" 1 1-'1-11 '--'1'- : UI' ' -1' 1-1111' V' '21 1 'S " - 2 "1 3121 1 "1 .'1111' W1 -1 '1'2 " -.1 1111-- 111-- 1"' K --k -' 11111 1 ': 1'ly 31111 '111 11: 'k1'1 N1111:1'11 'I'1':111: ll1I 1,:1111':1 1- 'Ii1'1' .I111 " 11111111 .Il1I1'1121 .111.'11111' 1.111's V1 11:11111 vII'SSI' 131-1'1'.1'111:111 1111-11t11y " s-11-11 :XIZll'.11ll'Il' 11-1' -1 A111 :1111'l V: 111111' 1'l:1111l1- 13111111 I'I1'lll1'1l1S "1 IIIC . 1: 'va - .1'l 1il:1111'111- ': 1:11 S:1111111-l 14111111111 K:111111'1'11 F1111'1111- 1':11'1'111 B1111'11i11gs1:11' N1:1111'i1'1' W1-:1x1'1' ' NI: 'lx' 13 111 1'l!1z:1111-111 1111111111111 111111-11 .1111'1'is X1: 1'L1l1'1'1 Viss W: I11'l' I411sI1-5' 111111 1i1"1111's 1.1111-11:1 ,'1-11111-1',,111' 51:11'g:11'1-I W1-sl Vir 1' 1:1 111111 xY11I1illll Ii -1111' 151-1'I11:1 X1-111:111s1-1' l'1:11'1'111'1- W1 --1111' N1:11 ' 1111 Wzl -1' 11111111111 51:1 'lx' 1' 111 1' 111-1'111:111 Wi11i:111s 111111115 1111111111 Yi1'g111i:1 11111 1i1':11'1- Iii1'1:11'11+1111 .1:1111- Will':1111x N11' :111 Iirmuks li1:11i.1's li 111l1- .XI'11lI 1' 1'1 ' :111 I'Il1l1'11'S Wi1s1111 51: "- 11s 111111111 1l:11'1- 1111-1111:1 11 1- 1':1111 N' 1-11 .Xu 1 151111 I':S11l1'T 111111' 51111 1111- -'11 11l1'f' 1.1-11:1 "1-y Willi:1111 l'1: 111-11 Yi f' 'A 111111:1111 1,11111s1- S1'11:11111'1-r 1'l11 " ' .'-1 - A11 '.: '1:1 k 11111111111 1 Dy 11111111-1' -'11il1l1-5' l'l:11'1-111'1- Y J 1'11:1r11-H ' Ivill 11:1 "- H1':11'1- .' '11 1'111-is1:1111- '. 'll1Z H as ' '5 'I".:1A 'Dy-s G ' 1' i1 . : Zi rain!! In Pugf Munfy Ilzrfe Class of 1934 Hwlfnf I 110 P11111 znt Nfliffllilf fl!flSIlII'l Ilflhvls I Rx x Lxh mime adauis stmlla :damn I1clL11l :111 1I1 nlms 1lI1r1 1'l1t Ilurotln 1 lll 11111 1111111 1 ir ll lu In Illrs r 111 In I XXUI'IIIIl1g't0lI Iult flu I11 zmr tin I1I11 1 ir1I1 Ivoermr Ixos lll Iumu I1 111111I1 11 in I Imiu rx Ilfllls Irltlll m 11 I1 Iurm In 11g11:tI1u1lx111g1 XII Iiur 1111l1lr1rI Iwurkm Irmux l"III'lLIIlll num vlplc 1 1r 111 ugirmt Kllllflb 1I1'c1111Ie1 uxku iliu monkey mln rt Ioopmr I111111s 10rr1g111 :gnu cross 1II11n xr xx lllll llllIl's I slim 1 dm IIIUI 1I1r7um1t 111111 lIlXlll'l glulu fIUTIllIIl 1' s 1 lllx tl11r f if 111111 YI4 1 71 lt'-Ihr UNI tri 1101 1 gmmvrgm llllll f Ill lrglrit grl lll I11 ir 11 1 1 re 4111 im ll 11141r1-1s hfirmon mg! OFFILERb Ill Ill Ill I1111x uncnts Illll I I111 lIIllI'1lIl 1 fi uit Im Il hoo 'il I u 1 III IUI 1 I tl IIII Ixllllgtl mtl Illglt knight piul lwmig I4 xx IN Ixrouil I1111 lrfl ll 7 1, if 11 1 li ll lyllljl N lfll 41 IMILN Annu Lrvxls hm IIVN A1111 131111 h1A1z01 11 lam 1 NIA1111. N11 XI mm k lv 111111111 11 lv X111 I 01 BI RN eln nfl Il idrm 111 norms I11m111I omngs g1org1 Imlrlxtis clorutlxx p1rk1r IIIINIIIN lPll'klll9 in I IIIII roI1111I Illitlllglll' r'11111 r1114 1 ggi Ill I un 1 1uws1Il utu Iisln FIQHS IUIIII rnlnrts Ill mln I 1 UIQ' N xl I K I xl 1 nr 111 s xlll 1 Ill sn N HI N 1 ir fl Ill mtl -Inu N IIIIIN tm er mlm tlmrlc 1 klohr fllllll 111 I1 1tI1er1111 sullix Ill ,gnnlllm Itllllllltllll llkllll tr ll Ill 11g1r1t 110111 ml lllltl IUTIIIIIUHII 1r111lItur1 1 IUHIIII 1 xo I1111I I4 f r11I1ar1I ix lllxll l'lIIl1I'lll1 ix IINII 1utI1 ui X l I I N II 1 I - 1 1 in 1 xx 1111111111 10111 ilu 1r 111111 r llll ll x11 s I1 r Nllltll Iul X piul 71 ntl Q X1 Y l"1." 1 . .................................. . , 1 .' "- I' .......................... 1 '. ' I 1 4 v I' 1 A , ................................. 1 . . n . ' u 1.u- X v 1 Q v 1 , r . .,...1....-.....-..-. .... . 1 A A A D 2 -- .... .I PE ', M . ' 5 ,M .II . . ' , ' .' ,'. 1. 1' : ' : 1 1 ' ' 11' 1 Il 11 ': ' ash 1 ' kll 1' 1 : . : 1.: 1 "" H' 1-I1 1 1' 1 1lm11' s 1: " 1 1 zlh' 1 - 1 ' williz Ill 'Ivy ': ' " .1 ' 1 : 1:'1.': 'g,, '1 1 1 11: 1'1In' 1 1 1.": 41. ": .' :II1 "1 '1.' 1 ' : 1'oI1' ltz .1 4 - ft- - - - - 4111 1' : : ' : -ost : - wiIli:11 pvr .' 1 ' 1 fm ' : 'vy II11111:1s : 111:1 1 mt I' ': 1 os: I:1s' '11111-11 1 II: 'II sl: iv 'Ilips : ' 1 1 ' -' 1' 11I1:1r :kvr wiII': 1 'sun I1111'111:111 l' ws 1 ' ' 1 : '1 z Ill2Il'.V f. : :tow 1':1I 1I1 : 11-r 111l:1I1 lil'I'llL'l' vi gf ': : I: II 11: ' 111r 11111 I' 1:1111 11IIi11 1 Iuru II'III:'l'4 koir lu- l' ': 1f 111111: v: l1iI1l:1 Ivlt : ' . 1-:1tI1111'i11m1 kclI:11' ml: r11'gI111' :111111I':1 ' I : - ' 1 1 : 'I' ' ' 1 I '11' 1 '1 1' j11:111 w: Ilvll ' 't 1 f: : "'v'1 ' ' .1 '- 'z '1' 1IOI'll I' ".z:11'I s:11':1I1 lIIllll.' 1-Iv: : ' 1 ' f 1 .' 1' 1 ': .' sz : 1 Iwzitri-0 1 :1111 1 ' 1: wil : ' 1rts 5 'zlsI1 1I111:1I4l Imml ulwi' 11lsc1rf1:1rl 1I11'I111:1 IZilIl'HSI'1'I' l'II!'IISIt' rogors 1-I1:1rI41s w:1lt111' 1'oI:1111I :Ivy :ir I : Ilvy Ill1lI'.V : Iis I1:1 'ull ' 1111' 1'Il!Il'It'S v:11l111r jul '111 ': 1s 1: 5,11 v:11'viIli1 In1:1 I' I1I:11141I141 .' -nit rutl w:1 111111' '11 1 . I J '111 1. 1 f !41kI:1 lm-I1111:111 I4-vis .'vI1w: rtz 11I:1in11 w:1r1I illll :1 'rs ziliw ' :nk 1-Iizzilwtln Invk: Iwilly svzllmlfl Illll.1lll w:11'l1n1l' 111:1 -' 2 .'Ii11l1I 1'1lIIl1'rilll1 LIill'lIIll'I' Imrtu I ng, I,v1Ii:1 .' 1: IT- llllllll ': I 1r.' l'Vl'Ij'll '1 lor 'I ' f1 41fIw:11'1I I IIN 1-tI111I s itll 1' ltl '1IsI1 '. l 1 11' vm" 1 gill 1-:li'1'wII I 1111 I'1':1111141.' .' itl1 i'11YI 'ittv 111: ' : '1 Izim : : 1 'II' :11:1rg:lr41I Illllllhll p:11Ii111- S itll Slll -"1I:I wliite-I-1 4-:1I "1 llllillll I'-1r4Iil1:i11fI :Im Il1'I'Iil'l'I 111:1tI1iz1s ji1.'1l1I1 UI 'illlilt' 41IV I v111I1 ' 1 1 I'lIIll'!'I I1: Iillgll In-I4111 111:11'sI1:1I 111:11'1-4-II:1 ,'t11x'1111.' tI1 as wirlv Illilll ' : '15 1. . Y 1 ,fu I I: It'Il c1I1:1rI01t11 1111-'I1:iIQk11 :1111 :1 sti1l111:111 I1:i :I '.I.'4lll I1 1. 1 tI111I111:1 I1: '111111 wI11:1 Ill. 1111-51-r1l1-'-k 11: I at -Iml:1l1- vstl 1 " 1 airgor l11v'lI0 11: I1-r I . In-11l:1l1 If't'l'4 1-I: 'I '1 'ig isa 1 jox : .1 '. 1 .VU I Q f ur Hi.. Iagc Smfnfy file Pugf Sfwnty-sir 1' f N 1 0 ? fi ,- f f Lf K Z'- M if Q "'l4.4: ,ff M140 L25 fd W cf, H .X 3 ,ff QZLH 3 g if j Z H2 4 5 4 5 I g C! ui NZ 2 C Z I YN' Nw.. N X 'F GZIH 1 4 N ,ffl- Elf ge' if Y 'Ziff Z ,g s U. ff' ,QS zito jc ZA f XN Q f6 2 if Z ff by X 52 Z 3 I 4 Q. W 1 X1 :FM X if Q iirftntitr JM!! 151111 Rf 11 fffff xr 1611 7 I ,E .9 ,f X ., I 1 A g ,Z Y, 'HQHZ 2 , 525755 f ' 104i I f , 452 f fm NYT' .lg zwzmf ,, X f 52 f 'f ZZ Z! Q' f X fff 4 fur 15:1 ,- Riyys ig Ei- f 715711 f f f fi' 7 1"-ffm: ff'-'X ff IEA 6, NQAEQ T235 Q51 if 1, X , rl "' '-35415 218 QXL5, .S i X 1 Z' 2 5 5 Eff: AQ 4 Q 'X ff 5 f 9 f Q 'Q X X 4 r Y f I Q 6 2 ? Q W I f f. V Z Z- ff, 3 ua 6 5 :fi ff 1. , , , , f ' if7, ' Q , Z 4 i 7' fbf it A X 1 1 f , ,, X ., 2 C 2 f if 0 ff ff 'X ,iff f 7 K, ' ,XX . ix , f X lIl' f ' ? ! Ziff" I fl 'Ax' V Y fl Mig Q Igk, L ' , IIA . W ' I fl ' 1 , O V ' I V KX ' f - 1 4 "" W ff 47-if ff 4 ".,:s.'F-J':.:3 V 4, X ' '7'l' l'H A 4 ? V1 5, f' I 0 o - 7 l dy UQ l Student Connell HE Student Council, havlng been lh effect for only three years, IS the most progresslve organlzatlon 1n the school This organlzatlon IS composed of the presldents of the four years, one representatlve from each home room two puplls selected from the entire student body by the PI'll1Clp3l and at least three teachers as advlsors The Councll, ln an attempt to carry xts alm to have happier and better school CIIIZCHS, has accomplished a number of thmgs whlch are quite worth while The meetmgs of the home rooms are held the first Tuesday of each month an the councll meetlngs on the second Tuesday The ofhcers for thls year are President Paul Martln Secretary Gladys Gooch Student Councll Dance AZZ' Jazz' All creatures love dance music sometlme or other The manner ln which the usually stald students conducted themselves that afternoon showed how greatly everyone enjoyed hlmself There were very few wallflowers and consequently numerous shoes were badly ln need of shmmg after the dance A jazz orchestra, composed of slx students and especially organlzed for the occasion made its debut and was heartlly received In splte of the amateurlsh ness of the muslc the Shag was enough m evldence to make us reallze that some students might be termed professional dancers Then when everyone had just about reached the pomt of exhaustion the Refreshment Committee came to the rescue with punch and cake More dancing and finally the strams of Home Sweet Home echoed through the auditorium brmgmg the thlrd successful Student Council dance to an end 1411 11111111 , Q R' 'A -V H '::::" -f . 0 , d ' ' . Vice-president .,..........,.....,..,.,... Billy Humphries Q . ,, ,, . . . ' , If ' 7, , . . . , fl ' Y, ' ' ' YQ 57 . 9 , . ' gr Sv LV . - 1114! P T A Play E ORD crowds thronged the Ftanlclm aud1toru.m on the nxghts of December Ftfth and sxxth for nr was then that the delnghtful play Honor Brnght was presented to the publnc The plot became complicated and the sxtuatxon qunte humorous when Honor Brnght a hook agent agreed to take the part of Tot Marvel a chorus gnrl Around thus agreement the actxon was centered Rxchard Barrmgton who was to marry Tot dtd nothing less than fall tn love wxth her sulnstltute and you may rest assured that more complxcatxons arose The play was made most effectne by the admnrable acting of the folloumg cast Mrs Lucy Bar xngton Mlss Ellen Gray Richard Barrington lher on! Mr Horace Wheeler Rt Rex Wm Carton Mr Russel Pfeffer Peggy Carton lhxs wnfe! Mx s Grace Sterling Honor Bright la book agent! Mrs Raymond Hyson Rex afnes Schooley Mr Morris Baker Bull Drum la press agent! Mr George Vogtman Tot Marvel la chorus gurl! Mrs Guy Harden Annxe fthe mald! Mrs Ira Wlales Watts lthe butler! Rev M Rogers Maggie lthe cook! Mrs R Helly Foster lthe gardner! Mr Ca roll Saumerug Michael lthe chauffeur! Mr John XVh1tmo1e Snmpson fthe deputy sherxff! Mr Thomas Moore ones lthe same! Mr Arthur Colburn Oulja lthe dog! Fluffy Popplexn lllll V HV l l o c o ,.. . . .V . M. s 1 1 . . . ,, . .. , i 7 K 1 1 K 4 t 1 4 ' , 4 . , 1 . . . ,. . . . . . . . , . t , . . ,. . . . . . , . '. ' . . 1 K ' . : r, . . S W . . . v. . 1 A . . f ' - s . . - . K . z J.. W . . 1 - . . . - . . V . - '. J. . . - . . 1 . - . rr . . . - . - . . . A .. 11 .Nr 'flllif nr 1 c Orchestra NE two three four all right boys lets try that again No this isn t a class in military tactics but Mr Thompson faithfully directing girls have appeared publicly although there are quite a few being instructed is the cause of many favorable comments Franklin s orchestra is cer tainly amounting to something and we feel sure that it will keep up the high standards of Franklin The class of 31 wishes the orchestra all possible success P111 I- Ill, 111 I l 4 7 ' ,Y ' 66 ' '- "'- 1 9 y ' 9 , . his orchestra. This ever increasing group of boys, for as yet no 5 . . . , . 1 ' ' . . . , . . . . , . , , :f T. 1. .,--gm Glee Club The Glee Club for thls past year was composed of 1 group of seniors who were selected after tryouts Thrs muslcal actxvnty of the senlor class was organized at the be gmnmg of the year under the dxrectlon of Mxss Harrell who later res1gned on account of her health In March we resumed Glee Club under the leadershlp of Miss Parsons Each Monday and Wednesday this enthusnasuc group might have been heard slnglng away yet very conscious of crescendos and eighth notes The great care given these small yet lmportant 1tems IS expected to carry the commencement music over laudably Page Emghfy one A' 'LL g if -'rn -My Mk 'F 2, .,' i , ' . 6 5 . s 2 . 2 ' 'W s , . ' Q! H ' 5 7 7 7 Tim Franklm Tracey Penrod ENROD' Penrod Schoheld' Come here this mmut What IS that rascal into now? Booth Tsirkmgtons Penrod 'lffOfd9d two hours of YIOIOUS omedy and made the pranks of Penrod and his chum Sam most real to us Openmg a detecituf agency Penrod wrecked his szster Margarets romance by traxltng Nlr Dade as a horse thlef drove his mother to despcratxon and brought about a general dns turbance The agency had nts good pomts though for Penrod was later rewarded for having brought 10 light an honest to goodness crook nn the form of sisters beau But slster had xnothtr beau 'md the situation w'1sn t so crxtlcal after all The c'1st of ch'1r1cters m order of their appearance was as follows Della Mrs Schofield Penrods mother arge Robert Wnllxams Mrs Bassett Mr Srhoheld Penrods fwther M1fg1fCI Schohcld Penrods sister Herbert H'1mllton D1de Penrod Schofield Mrs Wllllams Sam Wllllams Marjorie ones Georgie B1ssett Rev Lester Kmelsmg He-rm1n Verm1n Mr Coombs Chief ot' Pollct Coich Stigc lVl'n11p,tr Sctmc Dccomtors 11111 1171 Dorothy Pearce Mary Shoemaker Fred Wllson Herman Williams Lllllan Stansheld Walter Lewls 1ne W1lll1ms Billy Humphries Bxlly Angvller Louise Mvers Thomas Wflderman Ruth Const-mune Neal Brown Bxlly Ranft Charles Stewart Charles Colwnll Norris H1rxcy Mxss Guy C1rroll Mormngsmr H1rold L11dxs Bully Doenges Alonzo Clark Wxlson Corrum 66 . . ' ' e. ' ' ." . , .. .. . . . c , , - . ,, , ,. . . . , . I Y ' 7 I ' Y - . - , , 4 - n . .I . . ,. . 4 ' r , . 4 . A r ' I A . . ' . . ' ' . . : . , 1 Q , . . . , . . Mr. Jones, Marjorxe's father . . . Walter Bosley . K v . , 4 4 I , . x . . . . , J. . l . l . V . K I 'L b g . 1 . . y I L ' . . ' , . . ' . . " I. ' 1 -' ' C 4 . .A ' ' K1 liijl if-fzru Semor Play DAM -rnd Eva was a d lrghtful three 'rct comedy of the family life of King who has made 1 large fortune through his gift for business OI'gaX'1lZ3IlOn but rt has never occurred to him that thrs capacity might be 'rpplred to the home He has enjoyed spoiling hrs tvro daughters because nothing could give more pleasant power to hrs wrath The family has had just a little too much father 1nd persuades rhe doctor to prescribe a l o rr g trrp Father hears of the conspiracy but goes anyway having Adam Smith installed as father rn hrs home Ad1m s vrsron of 1 family with outstretched arms rs turned into an actual pic ture of a family with outstretched h1nds Then comes a great blow' Adam announces the f1rlure of the King Rubber Comp1ny 1nd 1t the s1me time the girls jewelry rs stolen As a Mr King returns every member of hrs dependent f1mrly rs well pl1ced rn some positron even Uncle Horace Wh1r 1 shock' It w1s all 1 plot of Ad1m s to bring the crowd of idle wasters to self respect Of course no story would be complete without a dash of romance 1nd to make 1 long story short Eva marries her father The cast w1s 1s follows ames King a rrch m'rn Corinthia hrs pal or marcr Clinton De Witt his son rn law ulra De Witt hrs eldest daughter Eva King hrs younger daughter Aunt Abbey Rocker his srster rn law Dr Jack Delamater hrs neighbor Horace Pilgrim hrs uncle Adam Smith hrs business manager Lord Andrew Gordon hrs would be son rn law Page Ezglrty time Paul Martin Eleanor Bruehl Grover Cook Katherine Stansfreld Mary Wooden Louise Myers Charles Morrill Edward Johnson Charles Stallings Elwood Beam f ,, . , . . U ' 9 . 'i . . r r . , , r . r fr I - . .r e . . . . ,, .. . r . , . r Y . . K N 1 4 ' 4 . me ., , L I 1 ' L L C C A I ' I ' 1 last resource the family turns to a "disgusting farm in New Jersey" to raise chickens. When . C I 1 vt 1 C I - . , , r , .. ., . , . . . : J . y . K . , , -i A . . , . , . J . . y . H , , . , -. i H . - , , , , i Y ' - I' - rt, ltr Bra .st .Tumor Semor Party CRY of dc1ght a joyful shout lor at last yes at last ll'lVlI1fl0l'lb were out The date to be sure 76th or November And a date I am Lertam y e too shall remember Are you coming ulth Tom or Harry or hd' Yes my drtss IS grun an you say yours IS r Im sure I shall loxe rt from what I can aear For xn anything green you look slmply dear Both gxrls and boys dxsplayed patlence untold And then came the mght crxsp clear and cold There was to be danclng as always before Ior small red and gold programs au axttd us at tht door In the huge audltorlum we were greeted hlse lungs And all heartily enjoyed Cousm ulxas Izar Rings For tvtas this llttle play filled wlth humor and fun Whxcla dlsplay ed unxor talents one by one BCIWCCII thi' 'ICYS d'1nC1!1g SCYVECT 'IS 3 U'C'll' As the I'lpS SOL1I1d6d OUI T'-FOIH The yOL1I1g d'll1C8Tb TLFI' Then what greeted our eyes were the famous Jazz four Known to all as the Cr1oles of old Baltimore To the strains of the snappy xV1Sl1lHgIOl1 Stung A grand march xt as the PI'CdOlI1lI1'lIt thmg Before us faxryland was open for a night As gowns of all colors appeared sma t and bright Then me danced and danced to our heart s contt nt Untll ten uhen gally to the gym me ment What greeted our eyes xx as a sight to bthold Tables and tables and red and gold Balloons and x hlstles and refreshments too Indeed me thought me should neyer be through X :ta songs talk and yolses most an hour was spent Thtn batlt to ancmg ut mtrrx y nent But as all good thnngs nutr last ong XXL rtluttantlx dtplrt d x 1th augl r an so Tx as LlLXLI1IlllI'IN so tu faculty sal An tune for good chll ren to be nn It T urty one s last party a ranltlxn xx lSIl1I0llL, 1 T manlts one and all to our tlnrty two 1 1 . 0 CEEK y 'D 4 lf " I 1 i . V ' lf . . A " . 1 J . tt' , t 1 V - 1 U ' " . t , ' - - F I . . . ' t' , V , . . ff . Y, . ... . - . " Q. 1 L s- .. dy V .-av" . . . ,, T If K . . ly . . 1 . . , . . v - K I I v 1 q 3 T I C K 1 x 'tt' x 1 x l .4 . . U . -I . ,x . , Q.. 1 V - - K - ' 4 . 1 A 1 t , t L T. X . Q H -I ' - Mt .. t t . . . ,, . v. .. . 1 . , ,, .. V ' . x . . . . . . - T -KA 1. VK I A ' q ' ' 1 Y L I . ' . ' , V V K xl 1 N' 't ' K K' D y A in 1 A X 4 1 L . . J x' H t A ' ' , . ' ' T' " . - a. ' a- -'14 W- . . 1 ' Y - '- . l 1. ' a. A' ' 1 e x" l. 'ite . d Q ng. d ' ' Y 'd - ' v-d. 1' V. . ,fra -' -4. ' 31. ', fy, If,f1l,!-,1vy',,,,,' Page Eighty-Jive Athletlc Pageant HIS year our Physncal Educatxon Department presented one of nts most successful an instructive pageants Play Past and Present The Program The Old Man Wlllxam Humphries Part One Colonial Perxod Mtnuet 6th grade boys an gn' s Period of Expansion Smgmg games 4th grade boys an gxru Square dance unxor boys an gxr s Clvxl War Period and Reconstrucuon March drill 5th grade boys and gxr s Sololsts Albert Benedxct Charles Baker Negro dance Hngh school gurls Pernod of the gay 90 s Games unlor boys and gxrls Clown dance Freshman boys Intermxssxon Musnc Hlgh school orchestra Formal Period Free Arm Drlll 6th grade boys and girls Wand drxll lsmglel Freshman boys Wand drill ldoublel Sophomore boys Dumb hell drill Sophomore boys Special dance Mary Broadfoot Madelme Schulthels Present D1y Period Singing games 3rd grade boys and glr Tap dancmg Hxgh school gxr s The Old lVl1n School Days Sportsmanshnp Hlgh school boys Scarf dance Hxgh school gtr s Tumblmg team 'md Fmals Hxgh school boys and gxr s Pnamsts Mary Wooden Elwood Beam Mr Vogrman ASSISIHILIS I Mass jones Mxss Grxm s Mxss Shipley Mxss Gray Mnss Lauder Mlss Tnpton Mr W ee er Pugt lzlyldy .su Q . . . d In . . ' .....,.,.. ..,. ...,.,,..,.,,....,. . d 'l 2. ' ' " .,., ..,,,., . ..,,., . .. . .. .. d " ...rr ,,,. ' 4 '1 3, .. . . 4. A H .. .. S, -. 4. . . r...,,. . 1 6. . ' ' .. .ls A ' 'l , ' 'l Elm hr Sith Lcltm Club HF Latxn Club organ Led three years ago IS composed of members of the second year Latm class The Club was organized to glve the puplls an opportunlty to learn more about the Latin language the early people ol' Italy and thelr 1nHuence on many phases of our lxfe In the preparatlon and presentation of the programs whlch conslst of re ports readmgs PISHO solos Latmn songs plays and games etc the puplls not only learn of thlngs of mterest but have an opportunlty to speak ln public and to conduct meetlngs m a bL1Sll'lCSSTllC6 form The lT16Ct1l'1gS are UWICB 3 ITXOIIITI Bfld LISLIBTTY CUlII1lI1E1fC ln 21 ROIHGII wedding and banquet In Line T e ofhcers for the year were FIFSI Consul Herman WITTIBIHS Second Consul Samuel Bottom uaestor Margaret Mlles WN The ll-lltstory Club HAT' A HISIOFY Club? Yes Its just new th1s year and composed of unlors and Semors wlth Mrs Reese as advisor Ir has reached suc cess too Its purpose IS to study current events and the problems of the world today whxch of course are of great interest to all The meetmgs are always IHSIFUCIIVC and never do they grow monotonous From each one we obtaxn a clearer conceptlon of some country the present day aH:a1rs of our government or other current events I order that we may study everythmg thoroughly there are voluntary committees for Readmg Scxence Lxterature De bates Posters Bulletln Board and for studying ln detail the Current Event Leaf lets wlth a chairman at the head of each The ofhcers of the club thls year are Presldent Wllllarn Humphrxes Vice presldent Helen Crouse Secretary I:d1th Beall 111 l'lzf1l Y Q X . 4 I, nl I T CEN-- . f ' l . J, . . 3 - v - 1 v uf A - - K 7 , . . . , . . Q 7 5 7 7 ' -7 '7 h ' : Scriba , ...... Marjorie McKee 1 , 3 l . . , . . ' ' 7 7 7 3 ' I Y Y 9 7 ' , Y , i . . , i . , . n ' v 7 9 1 ' 7 7 9 ' , ' . : '1 1 1' .Ukl 1,'.vf IL Puyv Eighfy-eight Oi ..--' 1 I I Ama K Sith The Quest for the Holy Grml ND now I dle my work IS done Twas not ln vain for I Indeed My earthly goal drcl reach and I Dld see the Holy Grail' There now Remains to me thrs one desxre To see my Maker face to face For I did rxde ln Holy uest Afar I sought the Holy Grail Three days three nights forth drd I rlde Nor paused I once for food or rest And on that day when Hrst I rode A man all tattered and abused Dnd cry to me for help Thleves thieves Cned he fourscore and thrrty th1eves Have captured here my master kmd And now do torture htm to death But I was bent on Holy uest I looked aside I passed hlm by The second day I do recall As forth I rode agam to search A man rf he could be the l1ke A leper full of many sores Drcl cry and beg aloud for food I looked into my small canteen Three tmy drops rt seemed to hold One drop Id take Id save the rest Untll I d found a new supply But as I drank there came a moan A cry a wall and at my feet Drd l1e a wretch wlth tortured eyes I paused I stooped to him I gave The whole of those most precious drops From whxch my llps drd hotly burn And lo the s retch drd straxght arlse And lo he stood before me there The rags of all hrs tattered clothes were changed to robes of Shlnllig mhxte And ln h1s hand Oh praxse mv soul He held arrayed nn glorxous lrghr Thar Holv Grall for which I 1 X I 1 . Z: Q- . uk I I- . 'CEPK 1 I 0 n , ' + 7 7 , , ,- Q , 9 I Y I I 5 Q . ,, . . ' 5 5 . ,, . . 7 ' 7, I had not time to pause and help. 7 I 7 7 Y 7 , I I 7 5 7 7 ' 7 7 7 7 3 , , , , . . V I 1 I A . . 'rllf r A 'fm I Nh ltr Bm Sith These many tears of hitter strlfe I long had sought but had not found And lo to me He gave that cup Whxch bubbled o er nnth sparklmg x me And unto me He gave command To drink untll my thirst xx as gone But I was hent on Holy Quest I had not time to pause and help I looked aslde I passed hlm by Agaln I rode on day the thlrd Again I rushed most madly on In haste I passed a little chlld Half naked cold and almost started Who weakly sought some ald from me But I was bent on Holy uest I had not tune to pause and help I looked aside I passed hun by But ts hen the sun that exe had set And I had laid me Clown to rest There came m sleep a marvelous dream A hgure mth light radiant Str Knlght though brave and true thou The Holy Quest IS all IH valn My name IS Falth Three days ago Thou dldst forsake me sore For thls Ye shall not see the Holy Grall And then Oh mercy on my soul' I recognlzed nn hum the man Whotn I had on the road passed lx I beat my hreast I cried to God But even then another came Who scornfully dud cry aloud The Holy Grall he shall not see For me hath he forsaken too My name ts Hope An lo I sau The leper whom I had passed hx And then I was heslde myself Wlth grlef remorse and cruel pam But ere I turned my face from God There stxll another figure came A chtlcl It was arrayed ln whlte Who wlth saddened volce dtd say Me too dldst thou forsake for I Am Chants and ulthout me Thou canst not see the Holy Grail I f X r Elf! O I 4 - ' 'CEN K I I , ' 9 7 I - , Q F- I Q Who with great clearness thus did speak. rr , C x , . 1 1 .5 I. 1 I 1 Y ff ' . d , ' , , . K . 7 u . I - v , , 'mf , HH 1, HW ny: Ximiyvtwo Adi ltr-I a Nth Un went my hte unendmg tlme And I x ere swaxmg old and grax Great sadness sorrow hlled mx heart From If I could ne er be free But I Lept falth mld uorlfc and toll Wlth parched lxps and throat so dry Wxtla hard and thlcls and swollen tongn 1 journeyed on through davs and nlghts Cn hot and dry and lDLlI'X1lI1g sand I searched In valn for mater clear But as I dranlx the cup was filled For even when I gave xt hack The cup was hlled as before And seemg wonder m my eye The Holy Angel answered thus There stlll remams and always mll A goodly pornon of the draught Thar M11 control and quench the thnrst Of all that love and honor God So lceep In faxth to Him ln all And follow ln I-hs footsteps Knight And non I due my uorlx IS done My earthly goal IS reached and I With peace and comfort nom do go To see my Maker face to face fb 4 IUII1 Nw ff lffr Vlrglnla Caulfield Bl Q I 1- I ' ' -I f CEM" KI I I 1 I- I I I So drink I didg revived I was. ,, , . '. - I , v y I ' 1 A q K ... ? p l -ag... M, ltr 4 ra at The Death of Tmmpas TSTEN my chlldren and T shall relate How the had Trampas came to his fate Twas on the Vlrgmlan s weddlng eve That Trampas bullet pierced hls sleeve The Vlrglnlan was slowly walking along Fearmg that somethlng was gomg to go wrong When all of a sudden there came a shot And hls sleeve was plerced by somethlng hot He pulled out hls gun and wheeled around Eager to smxte hls foe to the ground Foe It must be who would shoot lllce that For only cowards shoot men 1n the hack The Vlrglnlan aimed and the flre Hashed Down m the dust the v1ct1m crashed To plunder to steal to cheat and to knll Grace Smlth 33 After readlng The Vlrglnlan hy Owen Wlster the second year Engllsh classes were CUFIOUS to know whether there was such a character 1n real cowboy llfe Consequently several of the class wrote letters to Mr Wlster concerning this Below 15 the f3CSlXT'lllC of his reply to Ellzaheth Armacost s lnqulry t7fwv-2 Nvinf' Cf-'Nj fm'-fWf""-' ffm' :Mfg JM WM 711 Vfqauf-an 710. 01-If' Mipmjnwf Ammon 0ZPvmAf.?lir 4 1931 11 N iff O ,fd , .. .- k'C'.'f'K--' 7 - 7 7 7 , . . . , . 7 , . . v - , 7 7 7 , , 7 7 7 Never agaln to work h1s wlll, , 7 7 ' - . , . . ., A . . .. .. . Y 7 ' Y Y 4 v . , ' . l s v , . A U , A O . f I o 0 ' . I Q , , 'flf f A 'MH .1 'fwfr tt, wht' BIHI mm Shadow HE sun looked lnto the bare ugly room and made If a llttle brlghter From the wlndow the room looked bright enough but one standlng 1n the center of the floor would be able to dlscern a recess a klnd of alcove that was dark and gloomy even on thus brxght mornxng The sound of chlldrens volces came through the window mto the room Prom the dark recess there came strams of muslc from a pxano Strams that sobbed and pulsed with sorrow and strains whlch grew from softest sounds tc thunderlng tones whlch died away mto reverberatmg echoes A man was seated at the plano One would say that he was an old man for hls halr seemed very whxte in the gloom that enveloped htm The muslc testlfled that he was a genlus for he swayed wlth rhythmic lT10I10I'l to the time and sometxmes he would murmur to h1s chxldren thxs was the name that he called the keys of the plano Now he ceased playing and he stared long and hard at the keys He could hardly make them out An anguxshed cry rang out mto the room Soon my children he cried ln broken tones you too wlll be left alone ln the world Soon you too wxll be deserted Soon Oh' God' my sight' The whlte head bowed ln despair ln the gloom and the chlldren crled out In heartbroken tones as II crashed among them Grief filled minutes passed untll there again came a tortured cry Alone alone and blind Oh' There was silence and gloom ln the alcove but most of all there was despalr Despair that land xts 1cy fingers upon thc strlcken man and mocked at the shrunken sob racked flgure that was so lonely It wh1spered to hlm told hum to remember the day when he had been ln the llme llght It bade him to remember the tlme when he had played to a woman knlttmg by the 6156 and to a small boy who sat as nf enchanted upon h1s knee a he touched the keys And xt laughed as the man started up from h1s chair and slowly made hls way through the room Here It was bright He hated the sunlxght now that rt had become merely 1 yellow glow to hum It reminded hlm of happler days davs whlch would never come agam He had chosen the dark alcove as the home for hrs chxldren because the sunlight was not there and because there he dld not try to see the keys trying to make himself believe that h1s eyesight was not desertmg hxm But of late despalr had been IH the alcove and he couldn t stand lf He wandered to the wlndow and stared down mto the courtyard that lay below lf A whnte blur that he knew was a girl because she had been there before was lookmg at hlm Please she sand play some more for me When you play I forget You see I I used to play like that before I l lost the use of my h hands could not see her face as he stood there but his ear caught the hmt of tears 1n her voxce Back to hxs children he walked and as his fingers felt thelr way over them he was conscxous that despair had departed and the shadow over his heart had lifted He crled ln a volce fraught with feeling Thank God for my hands Charlotte Smith 3l 111 N ffl ce'.e,1r--- , . 7 ' v 2 , . . , , . . 7 7 V ' ' 7 a ' ' Q! 4 77 f ' Y V . , . If ' 77 ' ' C? ' ' 7 7 7 7 7 - ' as . , , , . ' . . . . , . . U . ,, . 7 tx - na ' - i ., ' y Q er v - aa ' - . . y s l a S 1 V . . . ,, . ,, v . . , . , . . , Y . t Y , . . ' 7 , . If 77 ' fl 1 9 ' ' ' 77 - - - - . He v . ,, . ., ' . - . , . 7 . , . . '. . ,, .. . , , . - y , . , - - . 1 f 1 1 1,11 1 nf 11? Bid mils Name l1ly in lin cletr lxliry Benson Ag1th1 Berge lli'l!1Ol Hruehl N1rg1n11 C1ulfleld Princes Clark Helen Crouse lNl1ry l-owhle C1IhLfll1C Holllngsworth Dorxs lkleffer l:xelyn Lexght lndn Robnrtson XX1lm1 Rohde lNl1rx 5l1oem'1lcer Mwry Slbley Clnrlotte Smlth Kitherlne Stansfleld I llll'lH Smnsfield Roselx 1 Thompson Helen XxI'lI'I10l' Dorothy Wfoods Mwry XX ooden lYl1rsh1ll Armicost Cxrnxu Cook Hunttr Frecnx Donald Hwmpt fmt H'1nlcn HX l 1 irxu limson l1ul Nhrnn fmrlms 'Xlorrx nu qt 111 1 If S hu Stumstlcs Nnkname Faxornte Saying Beck Benny Agg1e F Y Gmny l'r1n Helen Tomboy K1tty Kle Ebby Anne Bxlly Nlurrav I Bobby Kxtty 1 Tommy Slunny Dotty Dublme Nlush Qoolcle lzreeny Don lhrd 1 Bin 111 l 1rrx Dulce 'Xl1rt1n f h 1rl1e Don 1 IIXI1 Oh heclc Get uhxz For Heivens Silxc l thought Id IC Oh r1ts Ahsolutely Voyous Hey thmg Gee Oh sugar Oh my goodness yeah Honestly Oh sugar X ou re not 1ght S1y there e Q Hurry up Oh help GYTCIOUS shoot My goodness My soul Oh helny Sfrifn l dunno Hrclc O lx or Pete s lee Gosh Gu vh11 s tnr 'N !l1ll1gSlllxL tn: E i CQEK O f i me .ll ' d' 1 ' ' ' 1 . ' " ' f 1 1 'K , Oh . Y . ' " s 1, l ' ' f' tl - xv 11. . 1 C LI ' 1 Oh, lilwood Beam lienmmle Good nighll ' V' , 1 Y 1 U! ' H: 'rj H 11.1111 " 1 , 'l. '- H, - 1, 5 If ' ' Sa' In A 1 A n .l, -, . ll O 1 U A Du .ld K 'l. -1-r l. l . sol' Nl. mn fc lu gl- Cli I-V ' ' ll sift ltr -I ta N11 Hobby Studx 1111, NltdlCII1k f1cL1n1, rhr IVUYILS Study1ng, 1lJout Htnry t tnge CIYL o T1 Found XX rump, SEOFICS Uropplnh th1ng.,s CILIIIIIQ, A s unc lor WDXIIIH SQ111111, ljtll1j., md Htlpxng, others Hung, well dressed l mty d1nc1ng Hume 1 good txme BQIIIL, or15,1n1l Pcppmg lf up Bang merry I'1I1Ly dincmg RL'ldlI1g XV1 1r1n1, C:r1y XV11l1l11'1h Drt tmmg lltltnng, 111 musxc 1 l lUQ,l'lll1Q,, BLIIIL 1 snr athlete Bung seen but not heird Dflblllh 1 Ford Helpmy, the orchestr1 C1rry1ng a cert11n l:1r1efc1se Bemg 1 le1der XIISSIHQ school T1lt1ng stud1es Bt-mg., 1 pol1t1c11n Stattsttcs Greatest Need A doctors thermomtttr 'Vlore t1me to pl1y Soma, KICH-Cf pe1rs Some mches IH hucht An aeroplane Somt-ones shoulder to cr Some compet1t1on A rtdlng horse Members for tht Cnrls XVelf1re Club A d1nc1ng telcher SPICQS from lndm Electrtc Le1ghts A loud spe1ker Someone to p1y her Btlls Publ1c1t1on of her stones A new mlrror A p1t1enr People who need help l1ne Grey s books A th1peron An 1cf1omp1n1st A COl1g!'tg'iIlOl1 An orchestr1 Anothtr p11r ol sp1ts A new Tr11nor A t1n horn A new Ford Some butter Scotch A store of h1s own Some good helpers Some Sh1lcespe1re1n works A conwentent schedule An encyclopedm Pt If Il Fawortte Song A lJ1ll1r 1 Doll1r Ten O cloclc Schol1r Thert s MUSIC 1n tht A1r Slng Somethtng Sxmple You re the Nlelody lm tht XX ords Sweet tnny Lee Dont be Ltlce Th1t Thtnlxtng of You Should 1' There s Somethtng lhout 1n Old F1sh1oned G1rl bt1rs 1nd Strtpes I 'Nhss 1 l.1ttle M155 Be C trtlul wtth Those Eyes Pillillllf, the Clouds xuth Sun shmt On the Sunny S1dt of te Street Sm1les K1tty from K1ns1s C1ty A Cheerful L1ttle 111rtul Cheer up 1nd Sm1le Sometlnng., s Gonn 1 Come from Th11 Sweethmrt ol' my Studtnt D1ys lm Sll1j.,I!1g my Song., to tht qI'lfS Cnrls of my Dre1ms Slllglllg my Love bones CJIYL ML Somethmg to Rtmem luer You By e 1 Llttle SIFIIIQ, Around Your Fmger Three l1ttle Wfords Henry lNl1de 1 lo1dy out t Lxzzy Im D'iI1Clng v11th Te1rs tn N15 Eyes I Love Me You re F1mous H1ppy D1ys At l1st Im H1ppy To Wfhom lf Nhy Concern 0 -K I V C1225-' O f L' 1 v I, 1 1 ' . 1 K V I A Y 3 - ' ,I , , '1 '. A 1 .' ' ' - 1' ' 1 ' - ' 3 h ' ' 1 A ' ' Tall: r 1 1 of l. St 1 d I I 'l' A ' ' - U ' . 1, v -1 ' y ' v 1 on B' Av Um.. . K VI. g , . .. .1 1 ' 1 5 v 1 ' ' 1 1' ' Q , , C K - - 1 lc 1 1 1 I i. . ' ' Y 5 L I x . . . .. . 1. 1 - . - . 1 11 , 1 11 1 1 ,g 1 :1 ' ' 1 I 1 1' Y ' " - l.L'I1CllHg fl helptng hand To take part in more plays Here Comes the Sun 1 Av 'v' K A , I I I 1 A ' ' A g 1 I r L I . I il A .L v ' 1 ' ' 'l 1 , ui V ,I K -. Q g li' 'K A gi i A ,Y 4 - v 1 ' 1 V' U 'V C ' ' . 1 rg 1 ' 1 I 1 A l 1 - 1 ' s rl1 ss 1 ' 1 'A ' ' q ' I , , A 1 K' ' L ' -1 1 1 ' , 1 . '- 1 K ' 1 1 1 0' v K 1 1 . 1 1 1' I 1 1 I ' I 1 I . K A ' 1 1 1 ' 1 1 1 -' ' ' r .1 l L , Y K . . .L - - K X lv, Xt' My 511111 Ah 1111 Btu N1 Name C l111l15 511111111 I rld I Sl5I1 B 1111l11 A 111111 lx l111 lS1111 1 l11l1 l11 ll111l111l1 B 15111111 Nlny Broidloor Ll1111e B11Clx111'111 I: 1 Fuller Clidys Gooch Olnc Hoffm111 -'X11111 Kll112NlLl10lll! 11 ly11 101 11 11111151 Nlyers Dorollu OSl1o1111 ll111l1e1l'1 0111155 D11r11rl11 Pe1rC1 Hel1n R1111lcles Llllll Scl'1ael1r -X111111 Slon1111r fr111C1s Stu11rt Ll141l111l1 Tr111111r 11111 XX 1151111 Ldpgr Belt Xll111 Brooks l Llvklll Cole CILOFQRL Grollu I-l"lOITl1S ol'111so11 l1l1s1rCl ol111so11 1 I 111111 SIIH 1 ll 11l l1111l1 5 1 1, X'X1l11111 SIHHIIIQ 11s 1 l 11111s Sclu 1 1 11111, cl 1 111, Stcmstzcs N1ck11an1e Cl111l1b ln 111 lk 1 H1 1s1 C l11cl1111 B111l1m 111 GOtlCl1l1 Oll11 -'X1111 111l11r X1 111 I1111151 at I3 P11r111 Hcl111 B l:1l11I A1111 I5 r111111r Y B1l1s Broolxa S11l111 1 I-C1111 l:1.ld1 S lfl 1 F IU 1 L51 1111: I Fax or It Saymg lxly Moral l 1111111111 SIIIITIIL Stop ll s 1ll fl umpmg up Oh for 5001111155 51 1 XVl1o care: O 1 shoot Oh hzzle 1 sl1ucLs 1,olly 5 G1 or1,1 y com or l111d s s1l11 or 11 1 lou f 1 1 O 1 my ol111 Oh H91YCl1S Oh Gee 1.1110 ol' mud 'Vly Cow Oh H1011 Huh XX l111 Ll1 Ol'1 Oh tl1u11d11 O1 yt 1l1 Hora f11tl11r5 N1u1l1 X 1 111 Yul1 511 1 1 sl 1 1 1111 111 1 1 C1 11 1 1 A. r, 111111 111 115 L1 1 6 A ' can O 1 f 4 ' 1' 1 l 1' j 1 ' -' ' ' " - "l 5 '1.l1l111 l. ' ' l 1 lilg 1'l 1- ,x . - '1' V' . lllll l511l1l111' .1 lf1 51.11 lfd 1 Tha ' 1 ,gllI f .. - 1-. 4 14 . I' J . ' 1 . l f ' ' - . 4 1 - Q '. lc 1 J 1 ' 1 1 ' 1 ' 1 V uv- l.111l11 E111 I , ' 1 - Ol . ' . 4 ' ' 1 . Il Bly 1 f'1- . 1l4. '11 1. "4 J B' H 1 1-A' . "1 f 1 1 . N1 ' X . ' ' D1 If 1 ' 1 ' 1 f 1' ' Ll If '11 '1 L3- "P-1' K , .K --1 1 v , J 5 1 -1 A . 5 4 - - '. S ' 1 ' , ' l J VK X K . T 4 . 3 x r R111l1 XVndd1'll Ru1l1 lb lllilt su? ll ' "'- ' J. X '. 3 J '- ' ' V 1 ? f ' 1 lrfd f -- '. ,, 1 5' ,. 1 ,H 1 ' . J ' , yi . . '- J 1 '1' 1 ' lf1l11': rd Ja ' lf1l1l11' V. J . ' 1. "f lil11'11111l fl . -1' ' -1-r Rc. ull- 'll'H Sli 1 VY 'lm' -lu. l1l41 l1.11. l l 7 'U ' 'l Ll '.11's li11rl1 li fl nl - i 1 . H111 CR11111' 1111. 11 ' l'lr'1l1'r nk Cf11lw1ll If 1'1l A' '11 .l- .Q 1111, ,l1 . ll 1'l11, ' lf-Wll' I- I lf.rl1' l5.1lli. Sl. I ' Sl11-l 111 O11 15 1 K1 514 11-,h 'wwf ,N 11'-11 1 ph' V! ltr Bra mt, Hobby llayxnp., nn the orchtstrl ItllsI!15,l1lb umm XX rttxnp tomposxtxons M lkxnp eyes Bunge actommodatlnye 5lULlYlI15.K Charles l A trlp tm Cuckeys ox urday Dancmgs Blufhny, Teaslng Athletlcs It s not talkxnq Bexng amlable Trymg to be serlous Glggllng Debatmg Nlakxnye, speeches Nlakmg lrlends DflYll1P, tht Cheyy Takmg pym Basketball EXCC'lllI'AQ., tn cyerythrnp Talking to Anne Combxng hls hair Argumg Being lazy Talkmg Athletxc spxrxt Kllllhg txmc Fixing Typewrlters Nlaklng slcle remarks Playing the ylolln Swxmmtng Teasmy, gurls Berne a tease Playing soccer lxflaklny., up lost time COUUIIHQ, cafeterta money 'II Statlstzcs Greatest Need A better attendance record An accelerator A rattlt to maltt some 110156. mx 1' Kncx j,,Ll1ll!1L Sults An X tn bookkceptny, A dan Ing contract A dxctxonary Typewrxter 8 mght week A 5 30 bus Shorthand dtctxonary A paxr of xce skates A Hxstory of ohnson A Herald A boy lrlend A Ponnac lVlore t1mL alone A lrttlc courage It s not hught A Hutater A bus compamon A box of haxrplns More energy A trxp to Atlantxc Cnty Some pep A lacquered ll.ockardb box A need Unbreakable glasses Readxng abxlxty xn musxc Somethnng to talk about Two Bxts Some toys A stenographer A chauffeur Hlgll healed slippers A llttlt help ln history A screen for his bashfulness 14141 Fayorlte Song 'Nl arch Nlllxtalrt Glddy up l'NapolLon nt Yourscll litck Slttpy Valley N14 und Nly Shadow Charley Nly Boy The Doll Dance hly Ideal Hurt Cheer Cp l Get the Blues Wfhen Old Fashioned Gxrl Down the Rlyer of Golden Dreams Ah Sweet Mystery of Life ll Rams My Txme IS Your Tame You re Drutng 'VIL Crazy Louise Smnpxng m a Hammock l aughmg at Lift I Stlll Remember Good for Nothln but Loye lm Going South T111 We lxfleet Apun Blg Clty Blues Blue Agam Lnttle by Lnttle Somebody Stole My Gal Its a Lonesome Old Town My Baby just Cares for Me OH How I Hate to Get up the Mornlng A Gay Caballero That Minor Nlelody Three Lxttle XVords Crazy Words Crazy Tunes W htstlmg nn the Dark lm Happy Wfhen You re Ha x Away IH a Nlanger Pack up Your Troubles Your Old Kit Bag O l . . 1 P -. .1 CZEIZK'-' 0 1 J K , 4 , K . . K , K . a 1 5 - ' K - V 5 ' ' s - . "' ' . Q ' . Y. ' 'f' V - ' K K x . -- ' - ' - G -- - A il Pat on the I A Y ' " A l 0- H s N ". ' .X " ' . ' . v 4 - K ' v S . 1' - 1 1 4 ' Q Y I . Hr N ' H A Y : 1 ' t Q " 1 St - . C' t ' - ' L . y . . L K 7 V . . K K . K. . K . K . . K K . . . K . K. . ,K K . . . . HJ .- I K ' K K K . . . Nlaking the varsity Passing mark in typing when You're Smillng K ' l ' Q I' A ' t I K ' v K tr 1 'K I 'Y' v . V . K 4, I t - ' K Y . K. K K K K sr so ' ' v ,. . . . . v ,V Y L r I L I I A V 'fl . . . K . . K. LC. I L rl I . . . K A K , I I A 5 x 1 S Y L 44 i . . . K . K . . V . , I V K in , ' 1 L 1 1 K ' 1 ' . - ' . 4 ' ' I K A 1 A 1 Y l I I K r K ' , 'V . - ' ' t K' ' t 1,- PY VK K V K K K . . KK . K ,.K K .. ' s K ' , - ' ' . . in ' K x Kxvrfnlyrflr-11, gf Uur' 111111111 .B 9 may gm N! VV Atlylvttrz f , , , - 1, , f 1 V , 4 ical 31 U M X' X s ' 'J , 1 1 N 1 i 1 A I N f s V 'I I .R p',a, 1u,,f, mf flf1ffff'f1fYMff The Athletic Council HE Athlenc Councll was formed the latter part of 1930 and has been functlonlng this school year to promote good xdeals ln sportsmanship All athletlc actlvltles ln Frank lm are. responsible to the council The councxl approves schedules makes arrangements for games handles finances makes athletic awards decxdes upon elxglbtllly and slts as a court ln case of disputes or any decplon asked for regarding athletics The constant axm of the councll lS to make partlclpatlon m athletlcs a vital part of our hlgh school life The council consists of Mr Wheeler President Gladys Gooch Secretary Thomas ohnson Vlce president Robert Ovungs Treasurer Mr Hyson Mlss Saffell Mnss Huttenhauer Mr Muehleck Miss anney Wxlma Rohde Bertha Devese Elizabeth Beasman Hunter Freeny Henry Sollers HE Athletlc Assoclatxon of Franklin 15 of great tmportance tn carrying on the athletic actxvxtxes The purpose of thus organnrxtnon us to creite a better school splrxt and t promote good sportsmanship This org1n1z1tlon ns dlvlded unto two groups one for the boys and one for the gurls The ofhcers for this ye1r are as follows BOYS ATHIETIC ASSOCIATION GIRLS ATHLETIC ASSOCIATION Wilma Rohde V h D Vxce president Henry Sellers SIC? presldem Ben a evese ecreury Presldent Hunter Freeny Premdem Dorothy Burnham SQCWYGYY Elwood Bmm Treasurer Ellz1beth Beasman Treasurer Robert Owxngs Manager Elxzabeth Owings 11141 nz 114411141 HJ 1 J , 7 h , - . b ' '. yy Q J The Athletic Association ' L 1 U 111 ' T J' W ff 'QW oys Aztltlemcs Soccer he soccer season opened this year wlth much entlxusxasm Over forty boys appeared for practlce Consxdermg the rough Held and the new maternal we had on hand we turned out a falr team and ranlcecl tlmrd 1n County Competmon TEAM C Morrlll R H A Trunda O R W Clagget I R H Purdum-C F Schwartz I L H Freeny R Owmgs Gll R Y Wllson E Belt C T Johnson O L Substitutes Shugars Harden Beam Sollers and GAMES FRANKLIN FRANKLIN FRANKLIN FRANKLIN FRANKLIN TOWSON RANDALLSTOWN SPARKS SPARROWS POINT CATONSVILLE 2 Plyf Une Hzlncllrd Tluee G L LH H Ferrell t , , A ,, , ', i"ff'vSn5149 , ' , . K A A 9 0 . -. . f ' -.'F. . -.. J. i-.F. . -Y J. -.. . -. . ' T 1 1 1 1 , .,,,.a,..., ......... 2 .. . .. ..,. .... 1 ...,...., A . 1, .L . Basketball HE basketball season opened wlth a bang m our new gymnaslum this year Great enthus1asm was shown by the entlre student body After being defeated only one game we flnally met Catonsville xn a final match and were defeated only by a few pomts which gave us a good second ln the county TEAM ohnson Trunda Freeny Sollers and Stallmgs Substltutes Clagget OWlDgS Hewes and Purclum CATONSVILLE RAN DALLSTOWN TOWSON SPARKS SPARROWS POINT GAMES FRANKLIN FRANKLIN FRANKLIN FRANKLIN IIJ 04 111111111441 J ,,,, ...40 ,,,,,1s ..,., ,a..,, , ..17 FRANKLIN .,..l9 Track HE track season opened this year by Franklin takmg a thnrcl place and ranking Hrst among the county schools 1n the annual mdoor meet helcl at the Fnfnh Reglment Armory Wxth the great possxbxlxtxes of takmg the sprmg track meet over one hundred boys turned out to practice SPRING MEETS Trl Angular Meet State Track and Fnelcl Meet McDonogh Meet County Track and Flelcl Meet Playmg The Game Play up my boy play up Play for the school that you love Play for the honor of wmnmg, Play whether you,re a star or a sub Play up, my boy, play up, Play for success that's m store Play falr for your Alma Mater, Play for ones that have gone before Puqf 0111 Hun: Play up my boy play up Play hard wlth all your might Play hard for Frankl1n's honor, Play hard ln the game of llfe Play up, my boy, play up, Play falr, lf you w1n or lose, For God above does judge us, By the things that we clo and choose Hunter Freeny, '31 hui I zte ' Q .,...e4l . ..-..... --.I ...,...,.-..... ' """' ri:-" Nair-'?'f-TT-'- y f Ly, . P l , v , . 0 1 7 1 a 9 s .. .. 1-.- we ' 3' " ' " ff ' wen: 'i.?" D11 . ' ' A ' QFFWM The Boy Scout Troop HE Scout troop at Franklln ts progressmg very rwpldly Many new boys jotned thts vear makmg the total of those enrolled about thxrty five There are sux p1trols Bears Alltgators Beavers Ltons Stlver Foxes and Flying Eagles The scoutmaster IS Mr Hyson and he IS asststed at troop meetings by Mr Roberts the ofhclal lnspector 'HT ld Man of the Mount n After last year s successful Boy Scout operetta everyone looked forward wlth anttclpatlon to ll 'agam thus year We were not dxsappomted for agam came another xery good on called The Old lVl1n of the lVlount1m Perhaps 1 brief synopsns of this mustcal comedy wnll help show nts sxmple yet mterestmg plot The scene ts l1td m a forest groxe of the White Nlountatns of New Hampshire A party of Boy Scouts has encamped prior to 1 vnsnt to the Old Man of the Mountaxn leavmg Tommy Tucker to guard the camp Tommy h1s 1 we1kness for mtnce ple and although warned that eating lf wxll bring upon htm restless sleep and uncanny dreams he falls 'asleep a vxcttm of this luscnous delight Soon he xs dreammg of a journey up the mountains where he meets the object of hxs mlsslon the Old lVl1n of the Mountain Most amusmg characters make ther appearance ln sequence 'and Tommy s v1rxed experiences gmdually unfold 'ts the 'tctton takes p ace The characters 111 selected from the Boy Scout Troop dtd excecdlngly well although thus was the first operetta tn which 1 gre1ter part of them h1d exer 1ppe1red Everyone was xery much pleased with the production of these young amateurs Iffl fl Ill If n . A I I 4, P I -. , 5 T- ' t F Y C Y 7 f ' ' , . , . ff ff v . K . , l . . y . Y 2 H . .. . . . . ' , 1 . . . . K. . V . . Y K I K Y . t t t - , r 1 t 4 , r 1 , A l . K U - 'Q' L 1- . 1 Y 1 r lf 4 t 1 , 4 1 V I 4 r 1 r - 1 t , 1 . I ' I ' , K 1 l I K I 1. I V K x - 'I' 1 U1 111 rl' rf SU' GQ nz W"'1 50 AL? ffxff -H K5 K M, x W MX-'f"3??7fdQ1fXi? sifN 1 ffiyhxx Qu Wm 'N ,. XQJVQ I! N. NX ' fx 6511125 Xyfiiz. A HIE? M V-"--..,, e -f xv ""-,,- Q 1 ' V ' '--WM Y I . "u-n-- 1 ,ff LX, -.-R Y - 'f f ' . l ,ff 'Q 5 I 'HA' A kg' "" f ' 1 4- : ,fri FI- ' Qi! - 1' ' " X ' ff Xi' 1 Q ,N , Af'-ff f 5 L x . ' - 1. ,3 N z - 'fx J - , ff -f -f , X, I A X I: y , xv 'K gyjd if I ' -I 1 .X ? In fl L ,A -'Af-' My L A ' , lv .. 1 ..U"l lf' 1 , '54 1 V- ' .W 75 ' ' lu? , V Q ,V ' ' ,lid I h i- I. Q f :ff f Q' f f I ' fd"-f: ' " 1 . ,-4 '. 1 ,i-KX . . . "t"".,7: 1 X- . . ,ig--X,-:Q , nr 5 5 K f ki Q 2 YK' , 1 KES? V ' an 1 . Yf 1 N A ,Q V ' ' NZ. A I, Lf",,,6? I - ' XX, I N .1 1, 'r f M A X 4 .- fm , J' I H 'M 'u ' 9: l' J" -" M 3 2. f . f 1 f 1,-f ..f,u v,. -. 'TJ 1 Q s I V, 'L 'wh' b' N' ' L 5 Q- k " ' 1'.fg-Fx?" 5 ' . , 2 1 Q, V '32, Q ix , . iv X -:. i. , 'ix-L . X 2 q f f 4 , 4 ' : V O V if, QAAU. "",...... n H 1' 1 -"" v -, 'l X! Mm-M" f ,Q A I ' , ' Jn Glrls F leldball ACATION was over so back we came to start the heldball season agam The glrls lndeed deserve a shout for to practice qulte a number came out After pracuclng hard many an afternoon the v1rs1ty was chosen, and not too soon For the fight wlth Towson quite early came and our girls took thexr places to play the game Tramor played Center and so dxd Weedle while the Left Insnde was none other than V V Nlmme took the part of Right Inside, and Beatrlc as Left Wing dld not hide Our Rxght Wxng Naoml was rxght on the spot and our Center Half to be sure, was Dot The left Half Back was Plnkle Devese whlle the Rnghr Half Back was Lnb if you please As Left Pull Back our Becky duo play and Rnght Full Back Olive m pl1ce dld stay Through the go1l posts the ball dnd not roll for Pauline Smith was guard of the goal Our excellent wing Avis had wrenched her knee so she couldn t play 'at 111 you sec Then Goochle, and Welch and Peggy too were alreidy to fight for our Red and Blue We lost the games tls sad to state but then we had to meet our fue The rest of the games on wmgs dnd Hy when they were ove we heaved 1 lgh We had lost bu there was no use to cry the basketlrnll season was almost mgh In the coming se1son we determined KO try to vun some fame for dear Franklin Hugh 14111, Um 11111 o , o , . . 7 5 Y ' , . . .. ,, V - - A . , . 4 - .f 4 7, - v , , YQ 77 , . . . .. ,-. Y Y 7 ! ' .1 - - M . . .. . -v - 1 1 s ' f u -v -1 ' - ' ' 7 3 5 C ' . , . ! S " U Y K K S ' 1 I v a ' ' , . , . , . . . . . l Y , ., . . . ' , : ' , . . . ' , llnnflr 1 1 .JM lrls Basketball OME dear frxends and tell us pray wxll there be a game today? At 3 30 m the gym? Fine well be there wnth penty of vlm Who IS the center on the floor? Why thats Weedle to be sure And IS that small one by her slcle Bunker ln whom we talce much prnde She s the slde center they all say but walt are there not more to play? Here come Naoml and Retha too our forwards decked m red and blue There are two more besldes these four they enter through the lower door T15 Pmkle and Tramor we see thelr faces when they as guards do take thexr places Peggy Glenna and Olive they say are patlently awaltmg their tlme to play The game has begun the glrls do fight t1ll xt IS over with all their might They have played well but what a shame they had to lose that thfllllng game The girls this year have done their best but we wish ln the future for greater success U: llun f w ' , , 7 , , ' ' . . , . . . . , . - 1 rr - an . , , . - ' u av - - 7 , . , . . 7 a 7 ' , - . , . v ' tr - - as u - sa. - 7 s 9 1 u va - - - - - - 9 9 9 a - 9 1 - , . 1 If 1Irv1l,Yl1I1 Gvrls Sprung Meet IS tlme agam for the gxrls spring meet, and ln thls we shall not meet defeat There are many events whlch do mvlte all the gxrls to come and for Franklm to flght In Volley Ball Hut Ball and Touch Down Pass, there wlll be out to prac tice, many a lass And to the Run and Catch and Obstacle Relays, we are already extending our pralse There IS another event, Hit and Run to Bases, ln whlch he shall see more famnllar faces So glrls come out, and do your best For dear Alma Mater we MUST wln MH Faculty F wvontes SUCCCSS Miss Huttenhauer Now Class we re ready to begun the lesson Mrs Reese- A word to the wise- Mr Wheeler Q E D Mlss TIPIOH Do what you should because If 15 the right thxng to do not because you have to do xt Mnss Sterlmg Mamtenant Mr Thompson Now people Ill not present marks on sllver plates Miss anney Please bring m your varsity umforms Mr McDonald Lets go Mr Hyson Oh pshaw' Mxss Parsons Who would lxke to earn an A by talung my lunch tr1y over to the cafe term" Mnss Saffell Oh my joy Miss Gray Settle down' Mlss Lauder Oh glory Mxss Hlss All rxght Mass Cox Tlmes up pass papers up Mr Colburn Time to clean up Mr Muehlech Pa' Inq 1 ll ll 4 , 4 9 . . . , . . . 3 y ' 7 ' 7 . O . U , . H , . N - ,U Y' 37 . . ,, . , , . , - N - ' it ' 17 U - - 7 . - , , . . J f. - - - - ,, .1 , ,H ti Y! . -- , . . .. - H -- - - C . . H . -. . ,U , . 4 H U - u 'xv -- , . . - .. - H . .. . . ,., - y . .. . ,., .. I., I . Af Um llfnfl 11 TY Page Um' Ifllllllfl 11 Iilcrm ll Ulu Hflrnfrffl T Thurston Ensor Homc A Rx mm AD VVheTe0lb0uts of the Class 0f193O m 1931 Bercrim RUM Hpumy 'X uri NIcCLl1oL1,,h Nld 5 Wu 'XLJYITITI LvcLL1 ,NIS ou 1 utw Cmrun vm ur C 1 Hmm Hmm 'ly Allu, 1 L15 1 Klllf 1 Nix S lil VNKIYAITII in umm Hmmm I llr 11113 fl I vc 1 u rn 1 rrx m 7 Klxxl I1 K, IL usull fin Illlgtf or 1 I s XLNILI' Ffgl K1 'lr KPS lx C Lil! L,L ILllrSlYI'l I ID IX lci Igrlf ldtll ,I CJLUILL IQfLl5fll'l ll Robnrn Broulxg Homg Ioulsf. Bud-1nJ1 lm Hunu Tfmlrni Bull Homn Flenori Cmln I-loma Vlrloru C irlmlf. Hamm Elwibcrh Cmruum Md Stun l'Nmm1 VIOICI C ull son Homf Albert Holtz B 64 O Rulroid ohm Kemp Home Iw1I1lLlKIIX,Q Phllco G15 XV1lfn1 'Nhnn XVhllU1lJTL PL1DllShlI1p., Co Vx Aldon XILCOYUWS Homa N11rrl11 Nhrknl Hn mn Crlidolu 'Nlura Hornm V111 N Strxynr S IBLINIFILSS f ll L51 I 1,11 1 Nuho S Nhlluruugm msg Un lar: x VI IUYICL Owings Homm 'Nwdma nt 11 Hump f wr xn R'lI1fl Cnouchnr fallen FIILHILVLIIH Rohdv. In U"ilfllI1L, 1: UHIXQTSIIX Hospltwl Cithcrlne Runklns Ciltrlders I-Iirdmue Exelyn Russell Goucher Colhgn Temple Smlth Home Margiret Stewirt Home Mane Smdman Md Smte Norm1l pllzibeth Scumpf Nici Smte Normal Lirmour Templeton Home Somerset Wfiters Hopkms Edgar Xvheeler Home Elmo Vombll, XXXLSILFII M1 Helen wyxllmms Dr Houstonb Office N xrg,u1rxu Iruuh Hama Ottlhr, Wfmrers Home Lost amd Found nu L w hip uma Nlr Thompson pL1sL I1UIlCt as. X tl lmi r ph xsn ruurn to Groxu' Cook cs: urls mu ruurn no Axgitui uund 1 Xs ll s srmy only mnmiurs o thi fuu ry I1 ad C1 I nduxtlfy ouxn TL KILSI mo y 1 mum Ykxll Llssood Be lm 1,11 151 alll f omni I1 UIN151. XX III Xhry Slblu plcwse C1 for II cm Tu Cy LL of ilu Glu Club Ilbcril rux 1rd offumd for xts uturu ouni X Cmwlk book XX 1ll Elwmc Buckmin plcisn C1 for II Pound X gnpnlmorn FXS ll rc-umbles 1 Fruhu. wxll the Frnshmin C1155 1310150 Vile l1L7flLl Pound I1 m Lrmrm complgx As the more 'ln 5, with m td X111 r ev plL15L ll lb soon 1s possl e I-ound rm IIZLIL V111 Hunter Freeny pleise C111 for ll, Ion Qomt dugnuy Plmse return to the Sophomores Lost A Boukkcnpxng su Please return to Edvard Pulau Found The I lfL of ohnson Loulse 'Vlyers pleise C111 f r it 'ls 0 thmk II IS T om ohnson s Pound X unxqup C1155 fNIrs Ree Q C11 for II Found X Qhocnmlcr Vs 111 Frank Shugus pleise c1lI' Pound X swstcmitxc diss in boolckcepmg XVIH Bliss Sdfcll plcise C111 for lt' Found X mwp Indn Piul Vhrcxn plnisc C111 us: A pxuurl t Exclxn Brom XX 1ll hndcr plexse rnrurn ll to Luorgc Cxrorxe' oom 1 H osx nn Sur 111 Que xx un 3I goes Others such is those' will ln bird to find r Xlulhll Ls uund u nw: pmm x HL in Hunt xc son X 1 H1fXtX Iuwmm plvmsg C111 r w 1rn lux I-lI1dLf plume rgturn to Dororhx Osworn ouni X um on XX om s Oscir Gris plvxie C111 I 1 0 CZK'--' X ' 1 f f ' ' . , J ' , 5 . X ' , X , . . v' . . Q1 A' fn . it. - A v L J 1 Ri "1 I4 ',-- LJ S. I". " C' -. - 7 ' . R 1 ' - -Ch 'I -' fn Ill-,qw ' . . . . 7 ' - N ' v f . Rc ' 1 Agh- ' V - L ' , - f Y ' 31. ' -' -Xlull muff ffl :ml . . . . 1 '- 1 - Jac -In 1- :XI '-' NH. fr. ' .' 41 ' . . . '--- 1 H1141 -nc :Xrfx 'I ' IW glwlu' - .1 . ' ', S I ll-H WUI ' A' .1 mg Prlmmg tm' tr: rhvr il .I .' A 1, --- A gl U4-.1-1' Hlkllll' XXX-s -' NIJ. In . - C -' -FL ld. Cl zlrlmw lit " an A dl P. 'ful ffm. A 4 ' ' " 4' f ' Isnlx-Hr: I5 '- H n - 17. - Qui J ff' ' R ,',' ' I j- Ch' 'g- "L'IL'Y'.L7I1 Co ff. lg . l H- Q ' l "' Syl ' n - nllmgvr Gs-1 jf P1-:ora n Cu. f ". - X-- K j . ff. l IS ,lk 1' J- -, Cs '- j . . 4 ' z 1 u ' ' " - 9' " C . .. ' X 7 . ' ' . 1 CI . X if K X-- - .4 ' L 7 , . K .K , ' -. . 1 z - ' ' 1 I L 7 4 .3 ' 'f v ', ' L. I V ' A -- . i' A L Y . A . : ., . . . -, ' A Alxcf GllI'kiIll'Y' Gus 66 Eh-crrxc Ernest Xvooden--University of Nld. X , J J N 1. If X11 :X X xltcfm that wlll ' ' ' ' '. . . . I-1 ' '. 2. LI .' -1 Cklff J K C If ' E V ' . . 5, I,m, -D Plum ' . . I.. 4. F .1 lulrl. f J 1 . L , ' ' .' f ' A. ' I ' cf . ll 0 I f N it. 6. F i T1 - 1. I lc lv' "T'll 4 5 ' '4 w -4 f 'r 'or mt? 7. If 1 K -.-X '4 ' H Y' . . .t . . ll I ' . 8. I. 'r--- I ' U 'l ' ' ' W H , . . . ' 1 ' 1 1 ' X . 9. If K --: uf 1 V l. ' K L ' . ll '? IU' ' , A. tv ., gt . K .V '.' .' , k K I S - ll. ' --.-X , fx , V' - . . Junl . . - 'rn ' ' nef of it. v' h I -1 ' call for 1 g 1 bl ? 12. ' 7.-X 'I H Q L ' '1 13. . ' 4. ' If ' . H ' - . 14, f. ' ' ' H ' . K '. . . 15. mf' . -1 -J A L 1 ' K 0 ', . w 4 A ' h - as -I 16. ' - -f ' - . . f . 5 K1 V . 17. 7: , . ' . "7 L . . 4 f 18. Q -df . ' . t ' , M " . -. . ' 4 1 19. ' -If . of H . . . L 4 -K A . ll. I. --. V f on H 4' V' U . W Q 'Q - ' V ' I f R 5. F. . S, 22. I, J --Sn - .. . Il- 1 'I ' ', 7 . ' . " ' . , NT. 13. F -:ff f lx -. H bf' " -lx N lc . Vll . .. " '. 1 K fo xr? 24, I.lfAL' mf "Hx ld I.. yd U 'A ' M - ' I . 25, F L : lg lc H H Qdf' . . . 'fig f Ur-f lfffrflfffff Tf1"l'f'ffL f Zlwpnff' fn'TX"'77'X 'f5'2'f"' ,X W Y E7 I+ tx 5,4153 X 2 ! llllijsbx IQ X 1 My 96' 1, If ...P THL AX OIN FLASH Oxford Hugh Scho Oxford Md The NTOVICS 'Ind L1br1ry of O H S 1t quttt clexcr We 1re borroumg 1 fem bootcs from you for our l1br1ry l1'1 F H S Here 1re some of thnm Tr1tl of the Lonesome Ptne Path to F H Big Timber Bonds OrCh1rd boundmgs T1lk of Gr1du1tton The Twenty fourth of une It m1y be t It nmete nth Tha. CTISIS Gr1du1tton lLrson1llWemor1ts Of F H S The Nloxtes 15 wc shoot them tn F H S Ind vtctnlty Cnty Ltphts RLISICYSIOVKH Guang Wftld Hunter 1nd Guy tnetr lord Itft of the P1rty Groxtr Cook ltt Us B G1y lFreshJ men The E1sttst W1y Study It Petys to Advertise The D11' Good News une The Inst P1r1de Gr1du1t1on THF W EEK McDonogh School NIcDon ogh Md VUL' C'll'lI refr'un from l3I'lI1l'lI1iI, the follow mt, Play tt Square urt s 1mt to 1 P p1 SQLVIFQ 1 muteh tht rt of tmts stormy t t1ther mt 1 'ur tmtttvwtn ntowtn roolttd Chl'lIlI1g t t tc 1 tm s 1 1 Sqll'l!'L mt rl t11t trusts ou trten trt1t mr squ1re X un tt sttms tn world s 15'llI19I you shelt lc th rt You xstll hnl lur lou. undying, dnnt rtp1y har t11tl1 lu lying Ttll tht truth 'llid mlte the ch1t1ce lrnnd trt1t har SQLITTL ftttnds xou II hut 'ipltlily tt xourt SLQLVITL ' X x JL Q N9 f N 4 fx Lntnnts no 1ny ti youre squ1re leue bthmd no te1rs of s'1dnes lc1xe lI'1SIO'ld 1 tr11l of gl1dness The world remembers those P11 that Pl1y xt squ1re Thus ts such 1 worthwhtle ptece of phuos ophy XVESTWARD HO Westert1 Htgh School B1lt1more Md XVe enjoyed 1nd ltlced your wrtte up of 'IHIIC D1xts found tn Among. Us Gtrls Al 0115. Urn? 9111112 hK7l1OrCd Frqnklln Wllll her presence for one whole yc-1r B R C REFLECTOR New WlI1dSOr Md XVI. rt1d mth gre1t interest your Redector of December 'ind wtsh to express to you our fh'iI1kS for your 'idV1CC 111 TWO of your best 1rttcles lVl1lce Re1dy for the Oppor tumty and Dt-tfttng or Cltmbmg We 1m exceedtnqly sorry that lack of sp1ct prewen s us from prtntmg these arttcles THE PIED PIPER Thurmont Md How tt Feels to be a Freshe T ere ts a time tn our ltves when vw 111 wonder how xt feels to be 1 Freshxe Then the ttmt comes 1nd we txpertence the sh1ll we ll tt 1 thrill? Perh1ps we h1xe never tried to txpl11n lust hom tt feels to be 1 Freshte so you c1n be 1ssured me th1nk you deeply for your tnteresttng 1rt1cle on zhts subject NVQ vstsh to express our Il'1'iI1lC5 to tht fol lovttne exch1nges 1nd m1g1z1nes THE SPECTRUM Rtdgely Md THE HELIOS Sp1rks Nld THE DIAMOTNDBACK Untxtrstty of Nl1ryl1nd College P1rlt hid PL Rljlf MXTND GOI ID 'Nut YK xndsor 'Vld l'fl11 HH ll, fflf 1 Itfflf, ft 'fu' iff 1. v CI' II: 'xIr,i'l,".IQ.'g:nj,fff ' I -I-If '7 ', N ' I f' f I71 . I 1 . . X . , ...1 11- - f 'X , .1 fl I 1 I g s.: '- "c--aaa., Lf X ' 'AXKI ' f I Atl, l A ' II I III I X ,put I -A I. I I . ,g r I, . A I ,I .XI I ,I Kip- I .. I l l r xff ij 'I .' I fx 4, jpeg , xt, e .1 ,l I I I ,I . I I I, I ' I. II. ' I . X , 1 I 1 "P f ,. If ,-. I I ,I . V 'P X 'Q lust up ,T , - e , . ,- .. .I ', II I X Q. gl f"5-' 'f7"' " 'V ' 'A -' -. N ' . , ,. H r , W t N ' :ve f nf eff 1 1 1 X nmol lflsf - -- 1 4 - - - ' -- - N w a-- 5 I' l --- ' ol, 5 - V : . , A ' . . II .I .I . II . ..I'c 4' I ' ' ' HI I'I , s. K A . - Y Y. 'J T K I T 4 I .TT Y III I H II I I JCI II I, . .. I I . IDI ' 1 ' T . . . ' ' J ' - ' i ' f - in ' ' . . , - ' , . . ,f . 3 I - - V V . . . I M v ' T , - YI ' h . . . . I Ie I lt' yo ' ' in thi g. f wit , al, lty it A - , . ' ' T 1 - t 5 - '- ca ' t ' . . ' . ' ' :he Y-.I , K D I Y K lf.1r lwttt-r tx .lv lv le: t' g thqt V by ' ' A ' ' , Tzllc- th- l lung tl 'typ P. l. but plgy it -' Iv t I I I ' Z Tr-g. 1. ,yg-,dE,t H' '- 4 Vi-'V--,I-' -' -K .t. ,. Q .I T 'Ir - n. ' " f' Iwi s ' - , ' I 1 i - II - I was-ul 1 611213081 sf RT... rg.- 11111 ll X lf' M X A i , .,....,.,.........- X " Skill: A-M - L H V11N4t1 ?+ f. ,N , N A 'MTN' 1 ' 1 " 1 M ' ' wi ,- , W ' 4 A f' i X , 1 N 1 , 1 1 F W if w N , s V 1 'pf l 4 ' l 1 9 - , l l 1 4 iff i Y 'fr fi 1 L ,g E' ' Q , I .9 I. - , x Xxx.,,x V, ,. v..- X X xmuu vw: v-uk, pl 14,22 LLB. , Q 3i57Li1 ? Q4 -ffQ 35f 5 'flff nf nwrfff 'QVIH 3 COMPLIMENTS OF The H E Koontz Creamery WESTMINSTER MD DAIRY PRODUCTS fn We deliver ln Relsterstown Telephone Pikesville 367 F P1kesv1lle Motor Pham maczst Mixn St and Belvedere Ave I: GOODI' Manager fAfIlhgIOhD BALTIMORE MD 8 We return as dignified Seniors to act as Freshmen in the new school Charlotte IHIIZIHIES the new building by filling clown the steps Sept 10 Frank complains of the seat bemg hard so Miss Harrell asks him to bring 1. pillow Glyndon Permanent Bu1ld1ng Ass n cl 1881 LET US FINANCE YOUR HOME MONEY TO LOAN ON FIRST MORTGAGES Easiest way to finance a home Weekly payment basis ,Q o L1 I1 m ASSETS I IABII ITI O 4 -5152 SOL OW t IO t S 9 1056? OFFICERS O FOCKI-Y P d T MAINGER Sc OII INGLRXc I TROXKI-IRICI I M et ry M day ight in Red M n Hall Glyndon l GJ Hour 00 I 8 30 Phone Re srersto n 55 W W9 'E6"DT'DG"DCS"'D S QQQQQQQSQQQMQQQQQQQQQQQQQQQSQSQW Iffll If J Q , . . ol Q1 , . Q, Q RP 9 U , . . ,N IE qi P "3 4 L C9 C9 r - I . U pg GB 5 P Ji ' ' f Q Qi 5 U L-u A Q 2 Ei T. O. 1, . . ' - any ' ce l 3 Sept. : ' ' A , ' tai . I - I V I I 1 I Q, 3 ' EQ l . : . ' ' , ' 4 . . 'O J -W S S Q 5 'G Q Organize " fy ' N tj P . Em i - V to Z3 E2 9 ' gl For ov forty ycnrs we have paid 3'f interest semi-annually n Savings Accoun' nl Save systcnmncnlly winh us and your savings will earn more than 6' f por am . Yo can withdraw all or pa I of your mo ey on de and. ca 1 . . ES J l Loans 319 . jo- gl :Amount dun: Dcposirors ,' .0911 I ci Cnsh in Bank l.75l.f'l iurplus l l4'5l"5O i 5 wig iii . ores pays wlc 24. 7. t gi Tr, ii M, To ii LITE? tag L , R I as Q N Ii.. ISI -SI 4' if Itsli ttiiljrvsidcnt i . A 7 Q .J Q frl5.liir'l't-:lst 0 H v s cues '7: Ono 'Zn' D ' ie 's W , - 'I Q1 I S is lv f'7 -. 0 F 63 43 , s- - - 4. - , no 'iii 1 Inf ifiiifiw 1 51,1 if H fe DQCQCEQGEEGQCQEESECEQEC EZENEXTEXLSW -I 'NlWh1xm IohnF W nk C Vt Whtm Wl11tmore Publ1sh1ng Company Inc PRINTING Statnonerw OfHceEqu1pment Tvpevrlters Rubber Stamps Furnnture Sales Books 35 South Mam Street Telephone Rels 260 REISTERSTOWN MD You mll do better here than else x here for good ITlCI'Cl'l1I'ldlS6 and qulclx servlce Iwervthxng for the A A Dyer IIOITIL and I'1fIIl 'lf popular PFICCS fo QUARRYMAN Glyndon Stores SAND AND GRAVEL Incorporated We deln er GI YNDON REISTERSTOWN 170 Sept 17 I-Ielen mfornns Mr Thompson than the heatlng system of a house lb cute Sept Nllss Huttenlmiuer The ghost of l"I1mlets father appeared he tween 17 incl l ocloclc I"Iunter Was II Stindard or Dszyllght Swings tune The Arundel Oorporauon 9, BALTIMORE MD CONTRACTORS AND ITNGINFERS AIND DISTRIBUTORS OF SAND AND GRAVEL N 'QJQQQQSZQQQMQQQQZQQQSEQQJQQQCEQU-yQSZQ9Q-9 I 1 ll I l f , 5' J . J e ,X -. I , ., .I f. ,X e JI if ,I -. J er-1 J .V J . Qi ., GJ ., Q1-ZTQXI, D , . . A ., If TT TD Q AQ Prcsxdent I XIICQ Presmdent Secretary-Treasurer Q 1- . - f - - J , vp wg . . y q . ' 3, 5 , gy 'Q C2 69 J Q la A E? en cg Q 5? 69 Qdw fe? G3 9 fe? Q ' CQ' fi C2 59 CUM XJ ' ' G9 69 C5 05 1 1 C9 Q9 V for 'QD GP Z9 C5 en Q 69 ES' Q wifi f E? Q ' Gow Q G2 Q ST TTTTT A I TTSTTT '.H1SDfDSD 5 T. If ISIS DPRTT TTT' fu 1 J N Comphments of THE CLASS OF was WISHES Mlller S Cafe THE SENIORS ALL SUCCESS Across the Street AND HAPPINESS FOR THE ICE CREAM SANDWICHES FUTURE TOBACCO SAMOSET CANDI Sept 17 In intlclpatlon ot a test everyone fell over each other m hls hurry to get to Physlcs class Sept 19 Franklm plays 1tS flrst soccer game and defeats Alumni Sept '77 Mr Thompson What lb 37 from 849 Hirry 3 from 84 Helene E Reuwer Da111e1 Slnple X sh A Fr d I k Vita Ton ma nt 1 b a Sha p alp T atment Halr C lor Man ct ring H nr Clttmg 1 Geo P Cvowthev Wlmolesile 'md Remll LAMB AND VEAL BUTCHER I hone lXT'lClISOI1 3981 1 L C xlertx l HOMES FOR SALE Telephones UHIYCFSIIY 2465 Relsterstom n 15 5 1104 W 36th Street BALTIMORE MD Complxments ot Chcwles A Lcwkms GENERAL MERCHANDISE Park Heights Au BALTIMORE MD mont Rus I' Stalls 181 86 183 Lafayette Market ff 'JJ TWGVEGVE S' Q 1QWQMQQXQMQQZQ-wQ5Q9Q9Q-wQ5Q-wQS2KQG7fQQf I ll ll "Oi 'EX 'NI' N "T ' 'T ' ' " , ' " " ' ' ' ' E ' ' ' ' ' jQl9Q1Q9QIQQiQQIG3GOEKfJGEGQ2K8Q2GGEQQQCEQQQTQQQIQQIQQXQKQQQQQQQIQQ QA Q x E 5 2 3 . . . I .Q QE? 5 1 ,S . 2 if 53 .. H .. 1 1 Z: 5 5' 2 ' 2: .a 2 gn 'U ' , ,.' o it. " ' A , xx ' 4 . j, 'W 3 . -- V 1 -A 33 5' LF S 'J ' . . - 1 J mg " , ' 1 Y . 1 4 1' it -A , . 5 H5 , , n . i ,fx A . , I 1 K .D QQ ' .. l I ' c Q . A ' I ' ' l I -4 , 4 1 Q J Al I ' 1 V 1 ' . : l 1 , ' 1 ' K4 I L K , 1 m A 1 U3 QQSGQQQQEQ E E QQQQTWQQQQTWQQTWQQTWQQFW?'MFVQQEQC7 GQQNGXQWWEEEWYEXCXGNGXWXGEEGEEQE Prepare fo cm Emergency N Everyone should haxe a fund of money for emergencxes Wo one lxnox 5 x hat tomorrow mav brlng elther rn opportunmes or unexpected calls for cash Start to btnld such 1 fund nos X Re1sterstoW11 Savulgs Bank O, REISTERSTOWN MD Ca 4W pald on savings accounts Safe deposit boxes for rent Sept 74 Dlal st ff and class ofhcers are elected Edgar becomes so bored m Engllsh class that he IS asked to leave Sept 76 Mr Thompson mforms us hat we know very llttle about x ork 1n Physlcs and less about other work Miss I-Iuttenhauer I guess they were thrown rn the lnsktt Mr Wheeler searching basket l can t hnd them Mlss I-Iuttenhauer I guess they were thrown out with the rest of the trash C0 'G 'O 'Q THE FRFSHMAN CLASS FXTFNDS BEST WISHES FO THE GRADUATING CI ASS OF 1931 'O 'QQQSQUQSQQQQQQQQQQQQQQQQQQQQQQKQ I ll ll I l X ! We QQVGVGJL, 'evoiueluiubsfemel Q Cm 'Q E EEE Q Q Q ga fy I? Q 1 A A V Q Aki , , b A , In h L , -V G? 59 ' ' ff - 4 ' ' QR lg . . gg Z9 rs, ga cw Z9 . - I A a . 1 ' Em E9 . - I . ' . 't ' ' V Ql K9 Oct. l: Mr. Wheeler: Did you hnd my Geometry papers? Gil 'Q ' . 1 -Y, f' rf- Q Eg 1. A K- , . r 3 .p Q, Q . l I 4 K , I . t.., . . Gy Q " W 'en o Ei EJ tw .pal Q ggi C v E . I 4 4 4 . ,. E2 Q ' Q te eg E9 C51 Q Q Q W fe as S e Q fi? fo Q EQ at uuuu E E E at ts, Q., -A j'v ! fj . . , gQfQ6Q6Q6E6E5E6QGEGQQQSEEEEEQEER fn W D Gvoff C 6. P PHONE GRAIN FLOUR FEED COAL LIME CEMENT FERTILIZER SEEDS 5' QJQBQADQAQQAQ OWINGS MILLS MARYLAND Z cw U C: S Sl- I2 cm QI O C: I-I 5 cw GVBGVBQVE CEQAQLJLJL QCECECT I I I I I I W1 I . , I . . . I I I I I .. A I I , I 1 . I Q. l H 2 . I I Q I I I " - ,R It 1- . I T 3 - I I F 5 I .. . I I I . I 3 I .. - v I v E 5 - I :D I I I ' I , ' O I I ' N I , I I I 2 , I . I 5 I . f I I v I . I 3 I I QI I I I ' ,I 1 I I. Q I I. 3 I . sq I I : 8 I I I S I D I , I E I ' I , I I I SI I I I .vo I I ' P I J I I H2 I , I I I I I I I 'Q if I I , A ' I I C- I , Q, I I , . I , I I I I ' JZQGYUQ I'2C?I'5gI55IQC5 I 9Qf"w3QgP'wvwfwfag3QQ Wholesale CONFECTIONERY AND FOUNTAIN SUPPLIES 221 223 W Pratt Street BALTIMORE MARYLAND Phones Plaza 4986 4987 4988 0.1 Branch Exchange Oct 3 Mrs Reese tells us we are going to move over the week end Oct 6 We move upstalrs Katherme suddenly has an inferiority com Oct 8 I-larry Say lsn t that a funny loolung Fresh1eI? Dorothy Woods I just heard somebody say that he looked lllce you The Peoples Bank of Re1sterstoWn S GVEGVDG' 3 CAPITAL S25 000 00 SURPLUS .525 000 00 WE PAY 4175 INTEREST ON SAVINGS ACCOUNTS A Community Bank Rendering Real Fmanclal Service T FARL STEFFFY Presldent JOHN F WINFRF Cashier QQQQQQQQQQQSQSQQQQQQQQQQQQQQQQQQ 1 ull!!! S53Z9QEf5E5'QEf5'736Q'Ef3'E6QEWQ56fE6f?2CIQEQEZDQAQGNZS? QI H A CLARK PLUMBING AND HEATING AND SYSTEMS DURO WATER PUMPS Rensterstomn Md Phone 181 BREWBAKER COMMERCIAL COLLEGE In STENOGRAPI-IIC SECRETARIAL GENERAL BUSINESS AND ACCOUNTING COURSES DAY AIND NIGHT SFSSIOINS ernon 77 506 PARK AVI NUI Oct After 1 h1rcl lmttle Towson cleteata us ln soccer Oct The Gl e Club holds IIS first mcetmg Oct Duhby IS so 'IDXIOLIS to get to French cl1sS she fqlls Clown staxri ln her excitement Oct We are clefeitecl bv Sparros s Pomt Compllments of Frankhn H1gh School Cafetena Maccay Trucks In SALES AND SERVICE 304 6 OAK STREET Complnmcnts of the BAI TIMORE MD Room W111te Star Lunch 64 MARKET PLACE I5 I 'Q-9 QQQQQQQJQQQQQQQQQQQSJQQQ13Qf3Q9!Q53Q-1, I Y II I f 1 tw ? 5' it Q . U 'ffm F 'Ov ' 3 , , J G9 Z9 . ts. xiii V O--7 I ' . f f 6 Q I KU? E3 . 10: . . . . ' '. P ' - . gg K . : c , ' ' . ' 63 . 4. lx v . Q . . ., . . 5 V . i17:i . I' W Y vi u . C? 'fa A H E5 E9 ts Uh 95 ' Q Z1 I I ti 'QD , .. Q' 69 ' . ' 4 - I 1 Ein 'ii A I A Q Z3 ts, 9 GZ 69 I v 'ii G9 QD C P PPP A A P PP SOOO Gi' .lofi hf'T , ff , . 4. 11 ,, v ,fx , ,fqj SQQEQQGQFQGQWECQGQEEFEWQEEGEFQEE va Blue R1dge College New Windsor Maryland CO EDUCATIONAL fo 0: fo fra 0.1 O Nezll 5 Charles Street Baltimore WHERE YOUTH IS SERVED and youthful fashion preference gn en all the attentlon they deserve College and Academy Courses Speclal Courses ln Muslc Busmess Art and Domestic Science AIMS OF COLLEGE ARE 'IHOROUGH SCHOLARSHIP LIBERAL CULTURE CHRISTIAN CHARACTER Moderate Rates S335 00 to S360 00 a year not mcludmg books and Laboratory fees For Catalogue and other Informa tlon address Edvard C Bnxler Ph D Presxdent ct 77 Mlss Huttenhauer durmg testl Walter what are you doing? Walter loolung over Paul s shoulder I m seeing how to spell borrow 76 Dorothy Woods aslcs what date the 77nd was? Oct 30 Mlss Cow enjoys IV cs company so much that she lnvltes us m for an hour after school but she doesnt serve refreshments Phones Fred S Eckhzudt Umvefs1w1822 LIFE INSURANCE Relsterstoun 37 M L Robertson GLYNDON MD BUILDER 1774 Baltlmore Trust Bldg 5408 Chestnut Avenue BALTIMORE MD Remember you mn t be happs lf sour feet torture you Be sure BALTIMORE MD brim' your shoes to the Franklin Shoe Repalrmg WORK DONE WHILE YOU WAIT SHOE SHINES-THE BEST IN TOWN Franklm Shoe Repaurmg 55 S MAIN STREET Relsterstovn Md QQQSQMQMQQQQQQQQQQQMQQQMQQXQQQQ7 l ll I 1 f f L we Lf L19 D e L9 te D J ev QW 3 W ,WMYYYW . C 77 MYYYYYY , ,W Y W Y Y- ,M , -, ,,,, , ,,,. , ,WYMW WY., ,W fx tn ' Q Q ' 7 , ' fem -en ' ' ' 4 C , B y - 155 me 1 y r 1 I Q5 Q ' ' ' W Q S - Q 5 ' E3 W 1 P ? . u 6 . v . . .'.' ' B Q o.aQ' 77 Q77 7:T7TTK7 shi? K9 1 I l " ' lzl ' ' ca H fu C9 Oct. - : H- , Q9 my z L, Q - ' f ' lg Q ' J Q J ' -r Q Q ' Q 7CfT77TTTT7 , Q Q W K f 1 ,..'f... ' to J Q is Ca Q W Q ' ' - Q Q H G - Q Q ' w - Q Egfr r fs 4- 5:7 n 5-7 1- -I f Q F. 1 t- 1 '57 as :DCT r -1 7-24 r '4 C6 eGCEWQGEQQGQEEEEEEGEQQWQGEWXCNK, Struer, Brx mt A Sfflffflll C olleve ESTABLISHED 1864 Hws 'uded thousands of woung men and x omen to prepare tor and to obta1n cles1rable pos1t1ons 1n Busmess It can alcl xou COURSES-STENOGRAPHIC SECRETARIAL General Busmess H1gher Accountmg Bus ness Admlmstratxon Commerc1al Teacher Trammg etc CAI L XVRITP OR PHONE FOR CATALOGUE CHARI IHS Q FAX ETTE STRPF TS BAI TIMORI Phone P1lxesx1lle 8 O,,m,,AAA F Elme E99 ons Lawjrence H Grimm FUNERAL DIRECTORS Rewterstown Rd 86 Seven M1le Lane I hone Relsfefstol 'I 19 PIKESVILLE MARYLAND REISTERSTOWN MD Nov Nov Nov 'Nov I-Iard to bel1eve but we have a hohday G1rls hate hrst basketball pracuce Good luclc to the g1rls We recene 1nv1tat1ons to the un1or Sen1or Party The hrst assembly of the year IS held We are lOOlxII'lQ for ward to humg manv other pleas1nt assembhes The Wlmeeler Supply Company DEALERS IN COAL WOOD SEWER PIPE FEED BRICK CEMENT BUILDERS HARDWARE FIELD SEED ETC O'dcst Mus1cal Instrument House ln the U S RSTABLISHED 1811 Mccalllsteys H R Elsenbrandt Sons, lnc 216 W Franklm Street QUALITY SPORTING GOODS BALTIMORE MD BAND AND ORCHESTRA 124 W Baltlmore Street INSTRUMENTS DRUM CORPS EQUIPMENT OJ CO CO H Q QQQSQQQQQyQ9Q9QyQ3QvQyQ9Q9Q9QyQQ I 1 Il ll I ll lf!! ., ti ., Q, V, t,LjL:Q,fgl Z9 Q z ' 'Q " f 2 I ,N 55- 9 ' ', Q 'Q 1'.1j , 4 ,' ef 3 'es I' ' I "J I- - ' S Q 61 . 55- 153 0 Q f , GO' gay ' . n J v 2 Ea? 41 A aaaa -A A L ta Q .4: ' . ' ' . E? QA .7: ' f .' " Q' .4. J - at ED' 17.182 ' " I- Eg' Cl ti 9 I2 CS? 23' 'cg ' . . GQ' Q Q - Q . Q f . , fa, 191 , . D . gg F ' WLULL, , , , Y- N, lf? I Sl KVSS 3 Aw I S7 l iw fi .- . 47 QNQQQEGNWEQXWQFQWESEQNQNQNWNWNCT In In Co Us ff.: C: 9: 03 Home of uallty and Seruce PI KESVILLE TAILOR CLEANING DYEING ALTERING and REPAIRING We are as near as your phone THANK YOU CALI AGAIN 1222 REISTERSTOWN ROAD Pikes 120 Smart Attlre for Smart Youth To be found m the spacious salons of the Great Hutzler Store HUTZLER BROTHERS CO 70 Franlclln acts as hostess to the Columbia UHIVCFSIIY students 1 The new Franlclm High School IS clecllcatecl 76 Ar last the mght of the unlor Senlor Party 77 Dec 1 Tl11l1lC5glVlHg holiday Don t have 1 hair cut lllxe the other fellow For that Personal Hair Cut go to DEALER IN ALL KINDS OF LIVE STOCK Wllhams Barber Slop Cattle sold on Commlsston Fresh Cows Bought and Sold Relsterstown Md Wllllam Devese Phmkm 89 Elms W Fowble GENERAL MERCHANDISE AND GREEN GROCERIES Woodensburg Md 52 Hanover Road RFISTERSTOWN MD MOVING AND ALL KINDS OF HAULING DONE BY TRUCK Tcl Relstcrsmhn 44 W Gas 86 Onl Trucks for Hauling Ice Cream and Soft Drmlts '4 '0 ?'E6"EG"D 5' C0 QQQQQJQSQQQMQQQSQQQMQUQJQUQSQGQJ I ll I jfocotsoaorseapofposaoziofiooetaooooofiofporsofsoaoceaofgwozgcq ,' 5 U 2 2 2 2 1 ' 5 ' J 0 o o o o , l F F F F F l K 5 X :Q I I IJ I , Q 5 ' A E . Q . EJ 5 .. 4 - G W 3 U . 9. ' I , ' ' Z . ' M s'i ' , 51 P x 1 O . A C. ? a . A 3 . l . OEF V U i 'a . Y ' fo C- E l 4 A ' in 3 1 Q -' l 'G A l J l - ' l E U . ,"' ,' 5 9 . 5 . ' I ' ' ' A ' - - f ' ' i '- v ' ' : ., 9 I? f ' " ' W I a Q M. I k 6.3 K J U ', A Gow K ' ' ' T ' A ' Q' 2 . f A , Q A ' ' Q' t P QSQQQEQ QQTWQQQQQQQQTWQQQQQQTW3Q9QTW?W9Q9Q5 X frvh ff-oN KNSX 7 '7Xff00x ff-OX Yf'f5N ff-GX ffr-GX KPOX ffnx Y GX fvfh Www 100 JL JL JL Js. JL JL JQJLJL JLJ JL J JL Jud N N In griclx it 1151 11 th XX ulxlx YN 1 l1d1x Drud 'X 1 1Ng rmoldux The Glyndon Lcnmdv y N N PHOINI RFISIIRSIOXXIN 68 ll Is mx tn SLAIS I Vzrlotu ind IV111 f s 1 mxs 1 rom other fellow looks I1 e' DLC 1 D C'I1r1st1111s l1o1Ci1X Tnlpplmonns Buslncse QR Rcsldcnu I7 NI In M Chas E WI11t11Cy BARBI 1. TIRIS TUBES CAS OIIS .md AU I O ACCI SSORII S RLISTFRS I OW N X Rustcrstossn lVI1rx land F1 eclea zck W Hzlbev 0 YI-I D COAI GI INI RAI Mn Rl IIANIJISI CQ R ISI llf R GWYNNBROOK NID Q f'T7'NfTT'X wrx fwrx wrwdrx '1rwfwrNfwrN TVN? 1' 'T7"Xf'T7"Nf7T'X'Q1 9.blXwojM1Jj yuayzkga kaoyguqyyuayyaoyxyaa agp Q.Jfkc1.wgc:.ajQvpQ I fl I 6115 ML' 'J Mfg 1 M51 .. v fLfJ,H,C '1 5 Iii J: Q, . 'LZ ij JL, 8, Vi I 1 xslt I li 1 .,fl'-,MI 'fu 'Q U3 Q 'io' Eg! 'el . 1. 1 1 Arm I Q 'I 1 " ' '15 . ' gcry' KO' ,Q IJLIITOIIIIL' . , 'Cl I1Iw I o cl I1 utr ' ng. '34 59 . I 531 Q '31 '59 Z9 551 fb S' . QI f QS. ID ' I l-1: I'-IFS .111 'of I ' , '. ,o11. Q IDT. 151: ffl. I ' . 3. cm flnrlc v1.11 tl1' I1 yy' l vclxcr 1111. IQ Doc. I8: "S1lJ" comes to SCIIOOI u1tl1 il lwl:1ClQ cvc. XVC wo11CIc1' what tl1c Q ' 'li I G01 I 1 . 2341.11 -2 - '. .. l 4. 1 G? 'Q , , .J fi' ,Q , 3 , nz, Q4 A I M ' A -I' ' ' G2 f . ,S . . i Q31 Q 62 ,gg f- J J - - , m " ' 5 -' ' ' li 'Q' 1" ' Uplumrc I"r.111l4li11 I I1gl1 Sflmol .Su .K J y K I. G? ,Q JJ J J Q, 'si IQ f 1- . . 1' ' 'Xiu ' ' O C2 ,Q , , ,ow ' . 1 . I 1 sit G3 'Q I f I f' . 'i f 1 ' .I f 'ill fa' Q Q' "'. 'I I Gig' Ak . , . 1, 1 G? 'Ly -- X I f 7 I7 K V R X ' f .6 ff ' ffxlf, "fl if xlfy xii, .1 QVEQL, if ,f r Q F ff J, Kr 'gf 1, If . I . ' ,f ' X ' 1 fs en as was 5' LJLJLJLJQJ Ca G E656EEE Complzments of Cl Fmend 11 31 Mebs xnforms us that heaven IS 1 xerb 1V1r Wheeler holds 1 prlvate conference muh a fu numbers of the Trxg class after school 1V1r Thompson tells us that those x ho heave filling bodxes should read thelr Physics books Grover asks M155 1-luttenhauer to paralyze some entences C 86 P Phone Rensterstovn Md G B Caltwder Hardware Feed Eertllnzer Seeds Paints Oils House Furnnshmgs Floor Coverings Glassware and China C H Michael 81 Son DRUGGISTS Al1f1HL3T1lCd Agents Victor Machines and Records Eastman Kodaks Schaeffer Pens ' ntman Candy United Cigars REISTERSTOWN MD C 6.19 Telephone H E Rutter GENERAL CONTRACTING AND HAULING Automoblle Service GLYNDON MD Brooks Department Store A lull lme 1 DRY GOODS NOTIONS WAYNE FEEDS SFI DS FERTII IZER HARDXX ARI FARM IMPLEMENTS PAINIP HOUSE FURNISHINGS REISTERSTOVVN MD Pmone Rexs 15R cv fi E2 Q3Q9Q3Q9QyQ3Q9QyQ9Q3Q6wbQ3Q3Q5Qf I E C31 'O W J E5 - - ci W Q Q Q 1 W i, 4 Gy . G51 E31 Q 5 3 j.x.7: " 2 " "' . ' . Q E9 1 . 14: . . ' V ' - v - , Ca' Wa 1 A . . E2 E9 Jan, 16: . ' v . 1 ' ' 5 5 ,QW 5 s 1 ' - 3 C9 Jan. 21: ' ' " . . ' U .. Qu E3 'WR RW R RR 1 EL? lxq ' . . Gy Z9 . . ,531 Q3 V ,. Q 293 - , 1- , 1 - ,l Teams and Trucks for Hire gg C9 I 9 ' .Qi' Q ' , . Q G .FED DEW,DDsEmEs , CDE C CRE, 'fa . eg E9 . . cs, Aga . . 0. Q an , as V , , . ra, nga . I . 5 A 4 - iv: T Q Q - '- . ' 3 Y Q wh' 1- ' ' 4 ' ev Q . . Q 'Q H ' - 1 : '. ' fy QAWW eeaa ea aa- Q .Q .ffl Q, 4. A fm j .1 4, GT ,jj fa. nfl Exif .3 rg. fl f6IQE5Qf5F36IGE5Q56?E5C56f2HCg'E5QY6Qf5663666665 BALTIMORE TO HANOVER BUS SERVICE Buses for Speclal Occasnons LJ S TIRES AND TUBI S Phone Hampstead 132 Maryland Coach Company ebs gets YICIOLIS and Llclts ofI her shoe The result lb th1t Slb has 1 lnlaclx eye an 76 Exams start 1n e1rnest an 78 Mr Thompson glV1I'lg as a lesson m soundl I-lox cloes a nolsy room Paul In that case II x on t make any difference GADQI Kc? Q 69 ii EJ tl 69 Kel E9 ken E9 il EJ gl J SJ J Q3 EJ ki E9 Q 63 X E7 Q3 69 Q EJ M E9 'O f Na y lov 5 Home Made I C E C R E A M Retail and Wholesale PHOINI RI IS 11W x I If ll ll ff lsifsf' 'S UT If Ufbd Eff' L' If DJ if I' S J J CQ' 'ci E2 Z9 55- 333 K2 69 G3 'nl ca Q GZ sw iii, I 2 I 112 Q22 mosician lcnifnw when his instrument is in tune if he is in a very gl 29 5 - I V Q ' l - Q1 E3 A so A oooo so A so 57? ey EJ I , Q3 'Q ' G2 E9 G? 'QD , C2 Z1 To C, C5 'QS 1: 1 . - Q 29 fs, 'D G2 Q9 '33 Q E2 59 TTT T4 CT I If .Eff ll . LT. T Q fl If T C 5' QAEJQADQILS GJLDQ1 To Ga CQ E6G6'Q5GC5Q6Q5Q6EQ5QQ:Q5QfQf5E6N6Q5fT Phzlzp B Welslm if Sons F! syfwmj SAY IT WITH OURS REISTERSTOWN MARYLAND Phone Relsterstown 8 Greenhouses Glen MOFFIS Md Feb 7 Charlotte and WllI111 return to lxlnclergarten Clays by spending llbrary perxocl ln the corner Feb 4 Charlotte and Dorothy Woods VISII the furnice room Feb 5 Mlss Cox mxsses the chamr and makes a good lmpressxon on the floor Fish and Oysters ln Season Cigars and Confectlonery AUTO SERVICE and FILLING STATION Firestone Tlres 86 Tubes Hyson Brothers Fancy Staple 86 Green Groceries The Klncl You I llxe to Buy 1one 5 FOWBLESBURG MD HAMPSTEAD MD Ghe Westmtwwster Nzcrsery NURSERY STOCK OF DISTINCTION COMPLETE LANDSCAPE DEPARTMENT O ACRES ESTABLISHI D 1893 WESTMINSTFR MARYLAND C 86 P Telephone 227 N 'O 'G 'G C0 C0 QQQ-TZQ9Q3QMK229Q3Q57fQSfK22wQ5ZQMQ-wQ9Q-Uk-f I ll I f I ff V U U W Q Q Q Q I, Q Q GJ b L 5. Q1 I I T T T 'T TTTT' I 'T' GZ E9 6, Q - ' G2 69 - E5 L Ki E2 'ci fo Z9 , K, fl L . G2 V - : , , . E3 mi ci 5? by - -Z . A f Q ' ' Q3 Qt ' y I GQ gg 1 n : . J ..V. . Q J - K3 Phone, Re1sterstown ..9-F-ll Buyers of Produce and Vegetables G32 fall -I ,GS XB . . w G2 Gt - Ed 'gl , A G2 tg! ' ' pl , 3 C v sw . . GZ K9 i-Wflwm WN W M ,W Y V V i , Cm og . E? Z1 Q5 'il G2 49 zo . ' i Q' 'en W cg Z1 to ' ' ' ni lf- Dj Tel 'Q 'S T 'T T27 17539 Co For uallty and Service Call for Visit the Mzller S Ice cmd Sllbllfball Pharmacy Ice Cream Co The Drug Store that lS Different Rexsterstown Rd and Slade Ave Phone Relst 104lVl REIST ERSTOWN MD We delxver Phone Pllcesvllle 472 Costumes to Crder Costumes Sh1pped Everywhere A T Jones E99 Sons Slnce 1868 C O S T U M E S M1sk Balls Tableaux Theatrlcals Operas 823 N Howard Street BALTIMORE MD NIEDEL S Style Quality Service West Baltimore s Best Shoe Store 1131 WEST BALTIMORE ST I-eh 6 Miss I-Iuttenhauer I want you to WFIIC this theme m conversa tlon Grover The glrls w 111 he able to do that fine because they talk all of the tlme MISS lmluttenlmuer Well rn that case you shouldn t have any trouble The Dulany Vernay Co ITILE JEFFS ARIETY ITTLE FIQEICES 557 559 341 N CHARLES ST Park Heights and Belvedere Aves Plmllco BALTIMORE MD Sells Everything Phone Llberty 4540 We Delxver BALTIMORE SCHOOL FURNITURE and Supplies PLAYGROL ND and ATHLETIC EQUIPMENT Telcphom Rm 185 R Relslerstown Plumbing Spoutmg X: Heating Co Orrick Naylor 86 Son A Good Place to Dlne When A ay from I-Iome ANDREWS Dmmg Room Ice Cream Candy Clg3fS Cigar ettes Beverages Soda Fountam 324 S Mann St REISTERSTQWN MD REISTERSTOWN MD Phone Rexsterstown 113 lwufflff J G ti J Q fi ti ti C ei G3 Q E3 E33 W W AD 6"DG"DG"ECE"DQj'BGvD GVEG"DG"DGVE tv 5 I I I , fg, Q 5 A I I . 50 Q , .. ' ' I ' K QC til L ' . I 4 -- A, , I - 0 ey QI 5 ' 5 I I - Q cal - I A M 5 , 4- V . N G . Q A V . N . v G A v , 1: I ' t, . .. ' V' 1 I- GQ . G . ' " . I ' I ' . E y 5. 4 A' I l.. 'S i QQ ' I 1 I. l U V .. 3.5. V 4 E0 , F . U' . H Q y , 0 g E w--4 .A A : U , 4 A l l f E ,I ' 3 ' f ' '11 - I .I 4 P E' 69 .. u 0 V l . l , vi ta 5 5 - 1 - I , I ' le Q , . , I . I- . I Q - 1 I H ' ' J' y - 4 . I . . in I I 3 'Q Q A A 5555 A ff, Q9Q?W9Q QQQW QQQQQQQQQQQQQQQQQ QQQQQQQQ Q W Q Q Q Q N J A H Q W 5 Q Q Q E? Q J Q Q B J Q Q W J Q H Q QQQQQQQQ Complzmefnts 0 a Fwend Members Florist Telegraph Delivery Association W11l1am J Halhday FLORIST 321 N Charles Street BALTIMORE MARYLAND QQQQQQQQQQQQ www S' z-1 C Z on m no E :- :- 3 O no W cn E 1-1 2 Z C5 U3 C -o 'wa 5 52 n O 3' z- e 16 Sb co me t school ith her head ln nclag cl Feb 18 W are e t rtamed oyally at rh St Clent C unc1lDa ce Mss H tte ha er Guy Harde l Yo ask that afte t at a ful paper last eelcf? u u t u et r f r to a Smzth 59" Rmfsmdev G"DT'DG"EG"DGvD Q Q Q Q Q Q Q Q in Q Q Q Q Q Q Q Q J Q Q Q Q Q Q Q Q Q Q ? Q 'D WESTMINSTER MD on e PROMPT DELIVERY SERVICE LOW PRICES GOOD GRADES Permlt us to Estimate for you I f ll I If QQQQQQQQQQQQQQQQQ XX QQQQ QQQQQQN ' '11 '11 1 J W ' 1 57 . FJ' l ' 9 l lg l X w J l SP .. .. X X -, X ' CI 2 X l J r ll lmfaim 1 lg 5 ' I l "' Q' : w G gl 1 V1 C ug E l l , 5 N -1 l . ' 'E . 0 ' u X 2' - ff C gn l . - W , T l I EE .. E P. l 5 I Q l , l R l , . I l O U in E' l l 1 W .. ' Y ' l 2 ' l A l - if ,, 2- Q W l 1 5 X G X G I X3 J Q E E C A , l . O C 5 Q1 X ' l Z J ' ' 5 X G 9 l l Q. R O " i N E' A ' ' I l F " 5 V C X . l lp 2 'U 1 l l l A 2 Q l l 'c gl 5 :- 3 . ' l -4 P-1 lax, ' X? QCJQR I I AQJEQQQQQQQQQQQQ 31 QLQEQFQGGQEQLZS 'GAS JQAJQX' tssnfselsxff Cf.: Bacharach Rasm Company SPORTING GOODS People S Chevl olet 14 N Howard sum HC REISTERSTOWN MD To Cp fra CQ BALTIMORE MD SCFVICSS AIJPOIHIIDCHI Mrs A I Loc ard Phone 174 R BEAUTY PARLOR Westminster Road Relsterstown Halrcuttxng Finger Wavmg Marcelllng Water Waving Manncurlng Fe e see the Pageant Sheldon durmg a spelllng bee IS gnven the word mlsspell l-le asks lVl1ss l-luttenhauer how to SPC f 7 Class meetlng lb held A few members of lVc receive a note from Nlr Hyson requestmg thelr presence for half an hour CVBFY CV6l1lI'1g l'-OI' 'I Meek H H Shank CASE TRACTORS and THRESHERS FITZ WATER WHEELS Phone 45 COCKEYSVILLE MARYLAND Keystone Market GROCERIES MEATS g, VEGETABLES Forest 6067 5214 Rexsterstoun Road BALTIMORE MD Estimates Cheerfully Furnnshed All Orders Promptly Cared For G Edgcm Haw' ARTESIAN WELL DRILLER Agent for Hrgh Grade Pumps Phone Towson 873 W COCKEYSVILLE MD N C1 QQQSZQQZQQQQQQJQQQQQQGQQQQZQLGQQQQQQQQJ ffm 11f111f, fem U , D , e , . , is iaggssfoqfwfwgqfiwfw Q, JQ5, 'QD S or S so roses w r"s 'Y Gy - fr B , A 4 ra I - , . Qi ,ev , - eeeeefe A A sr Fl Q 3 C2 Z1 rs, 'Q 6 ,V ' ' - R G9 Q 1 'Q f, j Gy Q hor Q A . , . QQ! Q . . . . Q Q . . gg, 'iii ' - Gy C53 ooror S SLS LL Ls ,LLL LLL, Q? Q b. 26: W W H 4 , ' I ' 5 ' gg Q 11 i . F Q lvlilf. -Z , . ' " . A Q A ' QN sl ' . - V Q 69 S S ' 5 or . re, Q ' F Q . . Lb, 55 . . ff? EJ lo, il ,Gy 59 W lim iii G2 59 T - ' lim '33 , lf' Q57 A jim an 1554 'D . l N. E9 - ' ' cs, Q . W , . G3 Q9 ' GQ fl , - P 69 ez A A Q ee-- Q, CXGNENQEQEQNWNS snr ovgneneneof fra fn Ca 0: fra 9.1 9a 0: C: Q DEPOSITORS FIRST Thxs lnnlx does lnuslnebs on the pflliflplt thu vour COIIXLIIISIICF 'md b'lIIbl'lCU0l1 ire tha nrbt con51der1t1on F cwmevs E93 Mew chants Natzowmal Bank FOWBI IISBURG MD Mar 4 In her hurry to get to the cafeterm Mqrv Woode11 fall down and Mr Wheeler becomes, a hero and pxcks her up Mar 5 Marv Shoemaker decwles that sprung 15 here She lb goxnb to show us an av1at1on flelcl rhar has come up Mar 1 Some ol the Senior glrls return to thexr chxlclhuocl dwys and come to school mth llnlll' I'IbbOl1S on l hone Pxlxeix llle 190 lNI DQN T IORGP T Guy CI' Howden W P Beall DELICIOUS GRFEN SPRING VAI LEY BUTTER I-ORD SAI F9 AND 'SI-RVICF FGGS AND POULTRY You Get Personal Seruce Gran Sprmg Valley Sansfactlon Guaranteed ' HH' 485 XV I OWINGSNHHS Mn QHWWNSUN MD X w 'O 'O JQKMOJKQJWKUJIKUJIK.0lKL0!k,00KQQWK.OIX vlm0v1w9vwx,o1xgowxg I 1 ll If Qe.euebJ.JLegefofeoofffegeoeisgg N 4 f Cdl I 3 ' Q E I L, I ,I , rr,A , ,, , 5 Z9 A.'f. ' rx - 1' . ' . Qi gi 52 69 f f ' G3 E ,z , . gg 'oil G9 N 4 K9 Em 'Q so rrrr or I I or or FJ E9 . . A V E3 rea . 1 X ,V A H ' . l??'- 3- - ' Y Gy 69 I Q E9 ' ' ' f 5 G? gl - Q' ' ruin . 5, ex G? G A - . .1 . 59, 5 I' 5 6 gg - - 2 Plas' 2 . A-47J E2 69 Q. gg U B 44, l ' ."5 3 . , . Q? 29 ri lx ,,nQM.,,,,,m,,,r.,,,p,,,,qM,,3 Unexcellecl locatron Modern Currrculum Complete Iqulpment f"GEfL'E5fEf5IQYC'ESQ15 V5 LS X6 YC XCQICS YSXZSNTJQ fra Western Maryland College XWESTMIINSTER IYIARYLAIND ALBERT INORMAN WARD D D LL D Presrclent FOR YOUNG MEN AND YOUNG WOMEN To CQ G Mar Mar Mar Ca Arc You Adequately Protecte Gs Hull Brothers Grocery C W Whltmores Sons INSURANCE e s 7 R615 40 I: 7 REISTERSTOWN Nloderate Rates GRADUATES FROM APPROVED HIGH SFHOOIS ADNIITTLD WITHOUT CONDITIONS Catalogue upon appllcatron jen ons Successors to MITCHELL 84 NORWIG 70 W REDWOOD STREET Wrlnua tells us that there xx ere two Friday 13th s last month Mrss I-Iuttenhauer tells that every debate has two s1cles Freeny says rt lsn t so rf you are marrred St Patrick s Div All the boys blossom forth rn green bows Charlotte comes to school we1r1ng 1 beauty spot The Lrherty Road Game and Flsh Protective Assoclahon RANDALLSTOWN MD Help us save the game and brrds Dues 1 O0 per year FOR HIGH GRADE POTATO CHIPS FRESH MEATS 86 VEGETABLES EAT Hill Brothers Garage Hanover Potato Chops Made by Wm D Utz Prop Phone l96 C6 'G 'Q9QS2QyQ9Qy'Q9QyQQQ9QSZQQZQQQQQQQQJQQ l H Il I fl! ffl! of 11? 1 if 55554 52+ S5 Eg . , , . .. . .. 3 E3 V ,. . ' . K. r . f 4 . A e e V 'Or 23 If ' 54 ol fd H D 4 1 A Ear R G2 KJ g U n W S e e for 2 . 131 ' Q Y A ' . Q92 r . 16: ' Y ' . 1 El M I Y I l V A , A - I ll lj lg-5 ,V 777777 W Y ,Q R i . -60 ' . - -- , , G? E3 de 5 u n EZ' G ' - Em ga PJ 49 Or Q . h - Q 69 Ear EQ rm T 0 fhT TS In .X C. . F . T ! Eff UTCTQTT TTT QQQEQQQQQEEQWQCQGQQQCQWGQEWEGNDT Cf.: Cs Phone 178 W I Wheelev 593 Son WHIPPET AND WILI YS KNIGHT International Trucks Wlllar Batter nes 74 HOUR BATT!-RY SIARVICI HAMPSTEAD MD Mqr 77 Mr Thompson dumb 1 PICILIYL of Andy Gump clu mg IIIYSICS class Mar 30 Mr Ilgenfrxtz comes to mln. our pictures Sl'ClI1l1y 1slk5 lnm lf the cameri IS Insured HL tells lmer 1t1 wncl 50 xs lu o every Ihlllg lb all Ylgllt G Walter Tovell nc BUILDERS 86 CONTRACTORS Eutaw and Nlonument Sts BAI TIMORE MD C J Benson Dealer IH GENERAL MERCHANDISE QUALIIY FEEDS C 6. P Phom l UPPFRCO MD 1 N I- R A L F F C I R REFRIGERATOR GUARANTHD I-OR 3 YI ARS M azwzce E191 m U AllIhOflZLd Dealer I Phone 141 HAMPSTI AD MD '6 'O Q93QQ5Q3Q52Q ff Q-UQ-MQ-wQ5735wx-f7QJQGZQ-TZQQK-9 l I ll lf F7 U I Q U f U Q, W LCC? E91 G3 loci Gy EJ ei Q - C9 K9 C5 C5 GQ' QI ' ' Ea Gil E0 J ' ' Eau fa . . C, I. any Qi G3 cm - 5 3 -5 EQ QQ! QQ: 'll , . 59 J QQ QQ E2 Wg IQ Gil A62 dl AA A lo elm L., . A -. ' , ' f' 1 lp ul . Qi QQ I IP cg! . . EQ Gil ' P . 62 dl I . ,Q 'al ' IG? Gil ' ' E3 K9 4 , ' .. . 4l'5 GS , , . G J A Q gi Cla 3 Q .1., ' IC ex CQ J, , gi ' so Q Q5 2 5? 'gl 5 , . gy I I Q, X, ' 'Y ' I C' - if f ffxwff 'f C' 4 , WL! f6E573Cf5EffEf?3f5'3CQQ"315'lE5'E5EC 55526553509 Cf 191 The Glyndon Bank GLYNDON MARY1 AWD s111x 161 Am A1 Q All Departments of 1 Modern Qc11mccc.a1 Bank Chccnmc, Accounts and sauncc Accounts Chc.ccmac scvmcs and Tcmc-1cc1 Cheques SAFI- DI POSH BOXI-9 A I Rf ASONIABII RA Il S Nqr 3l Nlwrbhall 1115 jubt Conn from l11x111g 1115 p1ctL1rc taken 'Vlr Xxfhecler M1r5l11ll I l1e1r IIILV irc bloxung up stumps out t ere I5 tl11t so r WheelLr 1111 glad t 1 I1 t 511 1 Clllltfl 11 I1 01111 up The Reusterstovvn Lumber Co I UNIBI R AND BUII DPRS SUPPLIES P Q Rustcrstown Nlarylmd C Q11 IN rr1 10111 Rc-lst 1 I r1s1L 1 0SIQQQSJQ-MQMQ-vfQwQwxQ1xSfm fx-wx.-ywwxwky I 1 ll 1 I! ff f X,-hx f-1 Q-. - f X '- X , fx Gjxf f X1 'SJ CO2 gg. 'Q ' A . ' 1 ' ' 'gy Q 5 ' . . xo! ,Q A , , . , , K G? 69 . . Y V 1, G+ 1 . i 5 ' ' 3. " f 1 . 5 of' f 91 15,-H l 69 cc 1 AQ 1611 15 ll! Q 1? A Q f ars a : So I Var. 5 E? M . 1 : ' c . 11 lux r In . I 1111111 If tl1' 1 ' 4 C91 GQ 53 lcd 1 1 . 4 'SD E2 f 'N 19 ' W 9 5? KE? ' Gow 133 . QI xi . 2 . 5 ' . L 5 Q G31 10 -. 1 , 1 511 . . -1 -. , fc Q as 6 Gmac and Y.11'Cl. il ' In S, NIJ. ig E39 111 1 -. zf, 1 16111111-1 1fc11-1. 1 151-111 Q '01 AQ Q E Z1 C7 ti GJ ts ti J ta IJ ca C? c5J E5 ti CJ 2 J ta fJ T CJ rs J ca rJ cs LJ QAQQAQQJQQJLSJQAQQJ E6 'O Washmffton College Maximum Enrollment 250 Waxtxng Lust Now Flllmg for 1931 1952 WRITE FOR CATALOGUE CTHIASTI RTOWN NIARYI AND 'O BurkeholdersServ1ceSta11on A Raymond Lhllds GOODYEAR TIRES GEAR CASE FLUSHING SERVICE P1 UMBFR STEAM 86 HOT WATER HEATING Omngs Mllls Maryland RHS 731 Telephone Pnkesulle 395 Apr 1 Apr 7 Easter I-Iolxcliy We get our pxctures x hen we return Apr 10 Charlotte Hou much 7 Dorothy 110 Apr 13 Harry and Dorls try to pass 111 the aisle but lf can t be done Apr 15 Inclla ancl Guy race each other to the cafeteria The result IS the downfall ot Inclla PAY DAY HABITS ARE WHAT DECIDE FUTURES e Welcome Small Accounts as Well as Large Ones Your Sawmgs Wfull bc Safe m the Pzkesmlle Nattoatal Bank PIKFSVILLE MARYLAND " DQQQ-UQ-EQSTQ-UQQQ-DQ-EQJJEQJJQCZQJQEQSJ I ll ll Fm- owe, U wit? Mrieawrldfcsi-'islam Ea , O ri 'Si ' H G' gi , G' Q9 ' lea C5 , 3 5 . . . Q9 Q9 V K, lq N Gy 1 I I I 1 I I E? I fo 3- -1. U ' -J S 1 . : 1 ' is ..x22? E J . : ' Y ' j T . 4' 6 Q W? ol., E oo M We to 1 J 1 G9 fa 6 gil GJ ag to gi E? al W 1 6 lei' ,- - Eg its ta, 'gi Cf? G 1 ' Civ Q Q 6-71 G41 'X ECECEQQQEEECQEGCECEQEL862555556 THE PHOTOGRAPHS THE DIAL WERE MADE BY Ilgenfo ztz 575 INORTH CHARLES STRF HAI IIMORE MD gPLC11l Discount to IT Ll S -X r 17 Schnol plix I-'enrocl X ix The class trlp Vex Countv Tmclk Meet it Patterson Ierlx og une Clqss Nlglmt EXCFCISCS une Clue Plav Adam and Exa une Biccilaurene Sermon une Commencement The Blue Bud Tea Room 6 W Read Street Nrs Ax H SLllllX1!1 Prop DELICIOUS HOME COOKING Nlelvm J Burnham Breakfast Luneh Dinner ICF COAL WOOD FUEL OII fvolnpllments of J "M Mrs Alexander Durham GENERAL MERCHANDISE Park Henghrs Axe OWINGS MILLS MD wMQ3QwQwQyQ9QyQQQ3QQQQQQQQQQQQ I U ll If fgas, fi M gg ff ei Q, ,, . 1, f. Q, .sl E? 49 . 9 1n G21 S14 4 'Qc G? 42 ,- el Q '- H Q '35, .. ' ' :ET Q' 6 co' 7 Q9 I eo' - D Q ... ig Q l f . p . 1. .1 . 55, gg? .IL Y 151 5 A A . 0 eil 'V . r , V E2 Q I 1, 30. X . . . I . Q l bl 41 I .k.' l U . Q E3 J e ll: . I . N f CQ QD .5 we . , 1 . 5 Q , " ' Q l E? K ' er f '- l Q T . 9 K , Q . ,y I3 . Eg Z9 I fi Q , J ,,Q. Q Q A v v 4 1 4 4 Q1 E Plume " 1: 59041 . Eg 'es A 52 IQ CG' eq ' V- C2 f lbffl-2:27-c5'f7 c,-p 1- 'TT r 43 n Q1 rf -1 GT o -z o 'x r 1 1- fr 1 1 fx fn n 5Q6QWQ6e'o QWQGQQQCQKQFQSXOQGXCQ CQ in G.: G Cf Evans Bakery Fycmk I Cook REISTERSTOWN MD ENGRAVED BUSINESS AND BETTER BAKERS OF SOCIAL STATIONERY BREAD ROLLS PASTRIES Ommy Desmpmm SWEET GOODS We Bake We Sollclt 221 W SARATOGA ST Wedding and Birthday Cakes Arcade des 'arts Building Special Orders for parties etc BALTIMORE MD Miss Saffell D1CfaI1rlg to IVC I guess you all know where. ersey Cxty Baublnrz Sure Mmnesota unlor Why IS your neck like 1 typewriter? Soplu Wlmy? unlor Its Under Wood Mallonee Brothers CRUSHED SL BUILDING STONE Pxkesvxlle Maryland omplzments o Cl F mend Pnl-rcsulle 19 R Plkesvllle 474 IVI Fox Motor Co LARCX S FOX Prop Full llne of LINCOLN F RD FO DSON Star Brand Shoes Keds and Rubber O R F Cars Trucks Tractors ootwear XVL can sue you monev REISTERSTOWN MD SHOE REPAIRING A P one Rexs 173 SPECIALTY Nlgil Phone Rus 77 XV Trundas Shoe Shop lOppos1tL Emnlxlm High Schoolj 'O 'fi 'O 'woQ9Q9QyQ3QSQQQQQQQSQQQSQMQQQQQQ I 1 Lg - Xe or B595 sf Lcicyo U Q16 5Q+'f:l 9 f C? Q , . W E9 CS, as I G2 69 , , E31 Agn v v v Gy sl A A ' ' E3 Q: , . , u Sl Q El Gal ?D Coy J . O cccc ewOOMeOOe aeaa Q Q3 ' i 4 A ' 3 " Y -J A ' E0 G iw' Q Q1 A , I G2 Q J I Z., . , C V, 1, Q 5 JN 1' Q J 1 I o QI H C f 'Q ' ' ' ' ' GQ K1 t , f V G01 fi , C3 Q . Q fo I A - R- A cs, Xi, , E2 IQ' ' ' ' KO: E wl.,, , - Q lu : '. - - Xl ,. I J , H - , G3 'Qc ff lg' K-'T' ' - , f','j T 1 j'W ffl. l1Wlf,,lf 1m,f,,m,,1lf SEKGCECEQGQEKEGECMWEQEWECECECGF4 ICJ TI-IE T11112s PRINTIXG QQMPAN1 I t' XX I NTXIINSTER XI -XRX LXXID N 1 1 s 1 s 1111 X 5 I IIL LII L C. l 111L LIS 1 Is111111 S r I-Ivson I nw 51111et mg 1111port111t rl 111111 t11t PLTIIIIILL to Instory A 111 S QI I f 11111111 I 111615011 5 VXI 1x5 uy I1 1111 C ISS e 111 IX lkt 1 1 1 1110111 FIIICL 1111 111 Ent 111 thc 1 IHF CLASS OF 1951 SIINCI-RI-I Y HOPES YOU VUIII PATRONIZL ITS ADVERTISERS VN SQSQQQQQJQQQQQQQQQSQQQJQSQwkgwf lrff ll I N 35' E YY in 1111 1' Pf11fI1 111 7 Q9 l., . I . 1 . I 1 1 E21 'Q lllQLQf.1ZZ1ll2QQ 11 I Q:'gf,Lfg,1g T 1 - 71"-W T1 .IH-P1 r-Ye, , :XI I I '71 Sf: 1 Q f :fr 'lk llwm 'ff Chu! l'2.f,.','x Q Q ljf'f1ffl1'L Il 'ifw-M ISO' E3 C,I.s A11 111.1I., XXIQIQI1 .1111I BI IIIIZ, Pc1'1111I11.1Is1 f,111111z111'11.1I X'111'I41 Q Q7 ,1111I IIXCFXIIIIIIKQ IILLIIN Cj11111I 111 IJYIHIII1g. 19' Q ' ' J ' ' 1 , - 1 ' , . ' . ,.. . 4, W 'Q IIII. DIAL 15 1111111 11111 Ircs. .IIa. 15 .1 5.11111 I1 111 I ,111 .I IL1Il Q koi 111' 1x111'Ii P111 I11c'1I 111 1111 111.1111 E9 XX' ' ' ' 1411 TI I .tc . 6' 1 , Q W Q M . : " ' '1 I1' ' . 111 11- 31 - I 4 ' Q -I Q 1 - 1' 1 Q H 5 - ,1. ,V.. Q Q 11. . 11 Id , .1 1 . II. ga IXIE- -ILIIII ' : I 1 gf' Ia. I "XIV af' I14 " to I141v1' 1111- I11'I4c 1.111 tru Q I' 4 'si I'I ' ' we 1 ' '11 f G Q f , . , v 1 15, 1 gg 1QV.X ' ' ' ' Q Q G , Q 1 5 L J E9 15, IQ C2 IQ 101 Q Q G Q '11 G2 lg . .-, Q. 3 .H q 41 0 A. .A Q A Q .- Q .1 4. 9 A-. .N 41 .A ,J , 1375: . 551312 15 6 7 'lf ' l - Y l, I I f I." ,.,,,- ,-v..,,,-. ., , . . Y, ,. , , ,..,......,.,.., ..-. .... ,,.....,, .,, ,.. ,-..,,. ,...,,.. .., ,., Y. . , -1.r.n.n-. .en 1.4. v-.-1-r 1 N 1-:',.J: 4..2..::L.r.n uv f: Tliif " " 3.2 ff: . .E 123 1721 ii is , E ' 5 15 EE A 3 s F -u ml 4 Q Q Ee V , Ili 1 52 ff-:W ,za S2 ,- f' , as W 1 59? LIU 15. . 4 . E - E , . Ig ' 15 '1 Sal ,I . 'Fi 9 E f ' -A . 771552125-:?iF F-5f'45"""F"f'22'iS-".T' EE-A'--F-222'-3Z.'i?' -is ...-lf .M 'ML' ' -:W .-- ,:7:::i-1sf::!Qun:'- 5' -9.4, "- - EL- 3:1-M an I ' - - - ---fi -if-.. 1- ' .. ,


Suggestions in the Franklin High School - Dial Yearbook (Reisterstown, MD) collection:

Franklin High School - Dial Yearbook (Reisterstown, MD) online yearbook collection, 1930 Edition, Page 1

1930

Franklin High School - Dial Yearbook (Reisterstown, MD) online yearbook collection, 1933 Edition, Page 1

1933

Franklin High School - Dial Yearbook (Reisterstown, MD) online yearbook collection, 1934 Edition, Page 1

1934

Franklin High School - Dial Yearbook (Reisterstown, MD) online yearbook collection, 1936 Edition, Page 1

1936

Franklin High School - Dial Yearbook (Reisterstown, MD) online yearbook collection, 1937 Edition, Page 1

1937

Franklin High School - Dial Yearbook (Reisterstown, MD) online yearbook collection, 1939 Edition, Page 1

1939

1985 Edition, online yearbooks, online annuals 1970 Edition, online yearbooks, online annuals 1972 Edition, online yearbooks, online annuals 1965 Edition, online yearbooks, online annuals 1983 Edition, online yearbooks, online annuals 1983 Edition, online yearbooks, online annuals
FIND FRIENDS AND CLASMATES GENEALOGY ARCHIVE REUNION PLANNING
Are you trying to find old school friends, old classmates, fellow servicemen or shipmates? Do you want to see past girlfriends or boyfriends? Relive homecoming, prom, graduation, and other moments on campus captured in yearbook pictures. Revisit your fraternity or sorority and see familiar places. See members of old school clubs and relive old times. Start your search today! Looking for old family members and relatives? Do you want to find pictures of parents or grandparents when they were in school? Want to find out what hairstyle was popular in the 1920s? E-Yearbook.com has a wealth of genealogy information spanning over a century for many schools with full text search. Use our online Genealogy Resource to uncover history quickly! Are you planning a reunion and need assistance? E-Yearbook.com can help you with scanning and providing access to yearbook images for promotional materials and activities. We can provide you with an electronic version of your yearbook that can assist you with reunion planning. E-Yearbook.com will also publish the yearbook images online for people to share and enjoy.