Framingham State University - Dial Yearbook (Framingham, MA)

 - Class of 1918

Page 1 of 162

 

Framingham State University - Dial Yearbook (Framingham, MA) online yearbook collection, 1918 Edition, Cover
Cover



Page 6, 1918 Edition, Framingham State University - Dial Yearbook (Framingham, MA) online yearbook collectionPage 7, 1918 Edition, Framingham State University - Dial Yearbook (Framingham, MA) online yearbook collection
Pages 6 - 7

Page 10, 1918 Edition, Framingham State University - Dial Yearbook (Framingham, MA) online yearbook collectionPage 11, 1918 Edition, Framingham State University - Dial Yearbook (Framingham, MA) online yearbook collection
Pages 10 - 11

Page 14, 1918 Edition, Framingham State University - Dial Yearbook (Framingham, MA) online yearbook collectionPage 15, 1918 Edition, Framingham State University - Dial Yearbook (Framingham, MA) online yearbook collection
Pages 14 - 15

Page 8, 1918 Edition, Framingham State University - Dial Yearbook (Framingham, MA) online yearbook collectionPage 9, 1918 Edition, Framingham State University - Dial Yearbook (Framingham, MA) online yearbook collection
Pages 8 - 9
Page 12, 1918 Edition, Framingham State University - Dial Yearbook (Framingham, MA) online yearbook collectionPage 13, 1918 Edition, Framingham State University - Dial Yearbook (Framingham, MA) online yearbook collection
Pages 12 - 13
Page 16, 1918 Edition, Framingham State University - Dial Yearbook (Framingham, MA) online yearbook collectionPage 17, 1918 Edition, Framingham State University - Dial Yearbook (Framingham, MA) online yearbook collection
Pages 16 - 17

Text from Pages 1 - 162 of the 1918 volume:

5 V m , f -u I I ' 51 A A X I 0 v-."4 'n ,. 'V 5 '-J Q , . V 3.4175 .V mi., W-'g,. 1. , rf,- -RJ . I v . .4 .1 lf' . . vii' . ,. o ' '--f,'..N . 4, -Ityly. 11 'v' S+ " ' w ti ' .1 5:F.,J. 1255- "fw.. , - -M V' if 'J A. - .-23 xl' 5 , V . , ' ,JC-V' ' .JU f' Uv' X . .. .4 1 A , N 1. . 1 ' V ,fi-' ,Wx wi M, , A r ' 'fm . QJJ r-. ,, . 7.4 4 . fy Ffwpl KN V4 1 :Q 15, , W H V . 3: 4 '1592 ' .0 ' A 'L 'f?'2:' , ,gs 5,-1 " v- -wk, rv., - . 'U f'v S, Z' - v My . ML 1 l,,1i:.' . 'w W-,I H, fl , J' j f".f"5 .YP xi 1 N'-'ff ' TY'-g 1 .,:, ,Ly , of , 4, - UL -uwmx ,Y"71nQ' , ,1 ,TIF Q vi, it 1 5:6 . 'lil 4. -" I ' X ,. . fi. 1 1. ,HA , 5. 1 Q. "ii ' if gp,-,,f 'Q - 'H .,,,. sf' '- -R M A' ' '., :J 'x "dv '11-1, V 1, - -' x? .' ,-fix " , 1,5 . ' 'Af' '- f ."'?jf ef Q L ' -'fifkfisi ' 2 ,-f w Qfihff '21 ' ,'-. -1-9 Q A . -Q I . ,154 Kwai. -X fs-ta, ,. .M . W. . . ' 'ft 1' ' ,. ' :-if 4: U5,'Cl'- .L V ' 'I V: -' ., 9, Q -:' . .,-, V N, 7, H,-. :F "?.' , 1 - . , ,. .. 'J , . , A . I". . F 1, F - H. . ' " Y i . I, 4" ' "Wu 4 9.1. QSJ ' ' .bij ' ui' F555 " . , V iiiiif '-' ' " 1-' ,: ' WPS 'ff ' Qu -1321 f"'. -QV. Agfa. I i , , .X A, , E . 1- :,.'s,' f 1 '15 i-?. .vw 1115 ,' I '- ,ak . .,. 5- 'ey Hz- " -pf' I-4 -. 521-'J " 4. .'.vf, 1' -.5 1 , -.' .xii 'A . . 35:4 W ., . , X . 1 -- . . - ,f ,fv- , Q V, YN ,I ,' ' , i Qv' , , ,p 1, .A ,W , .. . ,M . Al,-,H '. . L, ,- 75-4 IZ QQ , x . ,, .QM .W ' Er X. 4 ffsqg, '12 " uf- 'A , QU! X ff,-xaxa, A, ., 14.51. ,U ,qp-V , ',-.Q wr' u: 1 v ,,,.Y. , 9 av. 1, 1. -f -4. Af.. . , .. 5, V , 1 1. 'ffjq ., 5.3-,A 4,14 U, rf'-I, ,U , tus 5. f, . r k ' fm - f.-- . ,n , A .,..,. ,vyjg . 51... f .Q fit' ' N 'SQ J" w- . .K g,f . ,Q - M V , . 'f . .. 7 NE 71' '- ,, A' 25" 1, ' "1 Q , V - 1 . .4f..,,,.. . '11 f,, '-1.0 ,,.. .,,. . - -. , V ...H P J A J V - in' ' 1. X v X nv W ,ig ,x '- -xi L , K 'K w , , ,, b X: 'ff " I V .43 1 ' -1-e", 'J' ' . -j - 51 : ya 1 ni- nam unwxr1uw11u:nnr1ou-xr .nun-urnunv-aunmxn1nxm:wnun.1:u.nn -1411 , Q 1 , ' r - , s ' v , x W 1 1 . r w V ' I 1 1 0 lm. x' 'L' .gtx .,, . , . X H1 4, 1 ifu 1' ,' K ' b' ' gy 1- N ,5 V J -7155, ,V .., V 1 A f. 41,.gfvj:'3, -' if - .. X ' ni .5-1 , ,N 11 45.2. . JS' v x",I -312. , qv THE DIN. "Q 525 1j1 !vs ig, H 5 ki 5, 'I 1 4 i E N 4 I Qs a mark ni nur esteem fur his kinh assistance anh helpful serhiee we Iuhinglp behieate this hunk tn Er. Eames Q. Qllbalmers WI-HTTIZE-:IOFZf1 LIBRARY Fra:-5' ' ilnllfsge Fran .- ' 'e f,:fzca'tts i V fi H W , n 2 1 .II P: I li :lf I FOREWQRD HEN lonesome, tired and wholly weary, Read of this book and youlll feel cheery For all the fun of the past school days ls depicted here in various Ways. These little ditties and crazy rhymes Are not masterpieces of the times But have the pep and are full of fun And that helps a lot when all's said and done. Please do not take offense if you Should get a dig, a slam or two All jokes are Written with good intent So kindly take them as they're meant. -2123 NM .dll 'Y - 62.111 J, ' ,as i1eJwl.Q3S64+5QY1 -'1 if V -' 'i ' P? Ty '42 .f Y - - ,.. .V :al .Aff -. -M: 2 A' fiiffz? .L 2" .Laci TV " H, .. -1-, ' 1:fg..'j',: .1-2231 K ,Wy 153' , H 1. r ' -A .- ML, L-.gn-y--..5 jig lpff:f12'4f1-2-' . ,, 72? C.:x'g":f' v - f 1. .,.1.i Ar- H , 411-1-.,',,"'f-1-JL,fd,-fl-1, I .,.- -, .21 ' 5? , . . f-fmzs'7?1L1'-'f51ws.,- -f,,.f 1 ff," Jw.. ' .f - :-.1515 ..g.:f.5,,,g,5,.:- ' Q ' - D 9fm-1"f,4bQ-Jfw.: w-JE'.f- 'fu -1--Maf,ggf:'1:4v,,, 41-'Ffa-if 4.20, , ,,,1-ie ' 4x'4?fff'f"f'-f"gf"--:i3""'i ' A .e"1e.i7'?:f'LffZ"L'-ffff' P- ' so '- 1-wean.-V' 2 1 . 1 2' '-1 f 'ff'f-4-7I.Ji172- f'a:."?'.L9"l,2' "f -ff ff fha, 2 Syn fevf- .- -..?sMf'gj-yn JL, 11-1,1 1' ., -151.--. 'fi-1--. f " V- .559-5'1w .' . -vii wr-7'-1 1 J, , - ,,,f, -.441 ,J .up 1 ,- .f..--,.,,,a..4s,.., .,, .- ff ug-1.i5ZQ,,fQ1m, - 13- 4, -'-X f ,rg1,w,Lfg,,-554: , -Q .if-' '- sm' Q - 4' .jg in if :11'L'f- ' '-.555 E, :rgii-,xii gj.f'v3:i, ' S , " M ."1'29"faiP."f ' " 4" 64 J' " - auf- '5'l'Vl'15:'J3': " 9.--, 735' 1 . 31.1,-L' if" if 'f f,:f:?.14'2 . - - -. '-va '. ' ' 1-V +'..':- . . -. . --.4fwff:.'f' ' f - -.LJ -.j.'vi'g5.L'1-, an 'g. " - Q, A, .fgiwz -', .- A -'M' f'-sf J' ' .L A' 3.-r . , '. W N - ' gif,-f"T:"'f1:2'.3' -L , iQ,w,z'9'-- In- 3 'Q-5. , ' -1 , 5 ff: , ' g4:1'2JZ'15'1A:8,5.:'1s'ff77':fa.. 5?f7"ii1'13f17?"'j" 5' ' - -57117 'WZ' 1 '73 - "Vi '.' -7, If. .. V4-'Q . - -FIM Z -'H-..1 1 I, M nh ,- .gm-A -1, I. f ,,A,.gwL .3-.5-1-f , .Jigga Q 1 'Y- ' wwe ,V . if . ff-5,1 '- w- - :ff-'g,.. -fm., - v . v i4:,?"-,'.-lv' f' ff 'ir ' 'Q ,fp ' 1 ff-15' '14 , . 1 H: 1 9. F: 'X 'Ji' . fg A . - - "': -. - 1 ,",. , - 5, ,' - Q'-'h , 4 ',f'Q42Af -r ., , 'VY if 7.57459-" .w4...f4,. .w e-,WNW - .4 ' 44 ' , ' , X , V ' 1 Q 5- 'JN "fi, .4 "' '.V 1. A J ,- :fr ' 1: w ' , Z,-7? '-'- 'W'45'Q" f "Af -. ' - ' '3 fi 1" -' I 1 I 1 uf -hr .' A ., 'um " 1, -az:-f ','5'M.-fi-ifff'-' , EW? ' . :.', ., :5,,.- ,- 4 ' , -. . .L aura" . I -gif . 55,355 ' . . ' iw' Mfr 4, " vf' . 1 4 H f 2 -- f'-fyg ' U I L' Q ff ' M.. , :Inga-gig H1 nw, - 6.47 FZ .A LEM M 235.1 in w 4, 4- "1mr'.',. 1. -.f::1'?A-fl' V. 1 -'ng ,e,-vi:-:fairs-. .. yfvfff' 5 Q I-. my g . - fl'--" -' an r, 'H..1g,,-PHL' , -- V.: ii22'1" 'wgngf , -ggi' YQ, xg ' f '- , ,. . ,,-3, . -'-, ' ,f 'A '. , ' - , . V- '- . -'- -- Q- 'g-gy , ,ug - 3: , "gf:-,f.,' K -. ' I-, 1 -f Fy,?J?rk 3- Y 1,5 ,aa ,M . ld, .Tffv . ,wit , . ., 49, - F fbi Q .A y,'5,p - la- ,f.-yi. , gf H, 51, J A-Q :I 92 y fig?-f if 'Z Hi, J -F .qw ,az 9' , . .:, , 5,. ijjxfig, 45155, , in 'kd Arif!! f' 4,..Af:g' -. 434434, , 1:1 f 1 ,93 4: W -5 .' zftn , . . '- .41.,!g,,,v:x I ff?-"5av5l' 1 , -,V 13, U ..,xfFfPf'-aflfia-'. "EE,-fi, - 'va ,f,:.g2" -M-gf - '34-3'!57"V'-'T' fififwig 'EF-gy., 5.13245 f 2 . TE . " '- -. ., - -, ffm f A - ri v . " f Lf . if f -- f ' ,, ,, , w,'.:1-fsfmd ,' P' 1: fa If - .I ,VAI . E f - gf, I '. I, '- 75, ,Q " ffm ...,. ,.:gv3k:,'-.iw iffii ix' f' 7 -ff g ,-sfl I ..1,. "'Y7.'- Midi' .I AQ' 'ffq!45 Z'?vSWNy7,v4-y,?,'xe':'ff:f'f?4?Gifrf,:-.uw-p?,gM.'1L:L- ' "?':.f1 , , -'z - . ' f "1 f ' f 17 ff' 3 . 32,5 dy, ,.ffm.f,.'.- f-3' -aff,--ag1,g,5, .' A ' '31 :gg O 5 0 c Q Q00 33?q,go3.wwwoweowesseioweswqe0005355 Q0 vga 31 V89 Q69 oo o gi, CLASS HYMN gg o 0 SZ 2: .,- e oo Wa OP 70 0? Dear Alma Mater, we corne today pg 5 we wg: To sing our thoughts to thee our friend: sg me Within thy walls we hnd the light, 50 Q o gi The truth to which we all would bend. DL 7 Z5 Shed thou this light on life's long road, gg Da a 43: Help us to nolaly do and dare jg, 25 To give our best to each day's task, ig og With each and all the gifts to share. C52 Q D Bo 13" EQ Dear Alma Mater, fare thee well! gh on ZZ We are going forth in joy of youth. 4? 0 an We will keep thy preceipts in our hearts, ig Deg And first of all, H Live to the Truth. " C53 is im '55 '53 nl, 0 CFB 551, CD Og, xy SB - 000 Q- o o 'VU Uogxogoibzswqosmgqowhzwbawkaaeqa'26calbgg Q Z EDITORIAL STAFF Editor-in-Chief Marian Bodfish Assistant Editor Marie Lewis Business Manager Frances King Assistant Business Manager Catherine Shurtleff Assistant Business Manager Anne Callahan ASSOCIATE EDITDRS Faculty Editor Marjorie Dean H. A. Historian Helen Seavey Regular Historian Dorothy Pickard H. A. Statistician Dorothy Fifield Regular Statistician Mary Eldridge Club Editor Rosemary Antin Art Editor Vivian Parsons Art Editor Esther Hayden Grind Editor Marian Delano Athletic Editor Mary Sanford .. 1,4 W Axe N nm f 5 0 WMM M MTW 5' 1 1 k K x x w i l 1 1 iliatult JAMES CHALMERS, Principal Undergraduate work: Eureka College, Univers- ity of Michigan, Graduate work: Two years a Special Research Fellow of the University of St. Andrews, Scotland. Degrees: A.B., Ph.B., LL.D., D.D. Country school teacher and high school princi- pal in Michigan, Head of Education Department in Eureka College, Head of English Department in Uhio State University, Principal of Wisconsin State Normal School, President of South Dakota State College, Superintendent of Fitchburg Schools. Author of School and College Text Books pub- lished by Sanborn Si Co., Silver, Burdett Co., D. Appleton Co. , MARY H. STEVENS French, English LOUISA A. NICHOLASS Head of Department of Household Arts FREDERIC W. HOWE Chemistry, Dietetics, and Household Sanitation B. S., New Hampshire State College. Assistant in Chemistry, Government Experi- mental Station, New Hampshire. Chemist, D. Whiting 81 Sons, Boston. Assistant in Chemistry, Massachusetts In- stitute of Technology, Director of Food Lab- oratory, Floating Hospital, Director of Food Laboratory, Infants' Hospital, Director of Garland School of Home Making. Member of American Chemical Society, Mem- ber of American Public Health Association, Member of the Home Economics Association, Member of the Massachusetts Board of Health. EREDERIC W. ARCHIBALD Music Diploma, Tufts Summer School, Harvard Sum- mer School, Normal Music School. Supervisor of Music, Public Schools of Eastern Massachusetts, Instructor in' Music, Salem State Normal School, Instructor in Boston University Summer School. Baritone Soloist, Chorus and Choir Work. ANNIE B. PENNIMAN Household A rts Diploma, Framingham Normal School, and WCHCSIGY College, Teacherls College, Columbia University. Teacher of Cookery, Public Schools, Concord, New Hampshire. FREDERICK W. RIED Industrial Training and Drawing Diploma, Massachusetts Normal Arts School. Supervisor of Practical Arts, State College. Amherst Summer Session, Art Director, Green- field, Thayer Director of Manual Arts, Lan- caster, Assistant Director of Manual Training Leominster, Substitute Director of Art, Hyannis Normal School, Supervisor of Manual Training, Normal and Practice Schools, Salem. Member of Copley Society of Boston, Member of Boston Manual Training Club, Member of Eastern Arts Association, Member of Beach- combers of Provincetown, Massachusetts. CHARLES E. DONER Penmanship Diploma, Zanerian School of Penmanship Columbus, Ohio, Doane Academy, Dennison Uniz versity, Granville, Ohio. Heliley School of Commerce, Brooklyn, Spen- cerian Commercial School, Cleveland, Editorial Staff, Business Journal, New York, six years Supervisor of Penmanship, Beverly, seven years Supervisor of State Normal Schools at Framing- ham, Salem, and Bridgewater. Member of National Commercial Teachers' Fed- eration, Member of New England Penmanship Association, Zanerian College. WILLIAM H. D. MEIER Biology, Bacteriology, and Practical Science Diploma, Illinois State Normal University, A. M., School of Arts and Sciences, Harvard University. Principal of High Schools, five years. Superintendent of City Schools, thirteen years. Member of Framingham School Committee. THE DIAL ELIZABETH C. SEWALL English, Hygiene LINWOOD L. WORKMAN Pliysics, Physiology. and General Science A. B.. Colby College. Instructor in Sciences. Colby Academy. Wake- field High School, Watertown High School, Principal of Higgins Classical Instituteg Prin- cipal of Southboro High School. LOUIE G. RAMSDELL Geography and Educational Psychology Diploma. Framingham State Normal School, Pl1.B.. University of Chicago. Member of National Association of Geo- graphers. ZETTA M. HARRIS Chemistry Diploma, Framingham State Normal School, Teachers' College, Columbia University. ANNA M. ROCHEFORT Mathematics Diploma, Bridgewater Normal Schoolg B. S., Columbia University. MILLICENT M. COSS Dress-making, Millinery, Textiles, Methods A. B., Indiana State University, B. S., Teachers' College, Columbia University. FLORA M. GREENOUGH History, History of Education, Civil Polity Diploma, Bridgewater Normal School, Posse Normal School of Gymnastics: Harvard Summer School, B. S., Teachers' College. Columbia Uni- versity, Columbia Graduate School. Member of American Historical Association. HELEN P. SHEPARDSON Physical Education Diploma, Department of Hygiene, Wellesley College. Richmond Virginia Y. W. C. A.g Rhode Island Normal School. EVELYN I. FERNALD Biology and Botany Diploma, Fitchburg State Normal School, A. B., Vassar. BEATRICE A. HUNT Household Arts Diploma, Framingham State Normal School. Miss Farmer's School of Cookery, New Bed- girdx Y. W. C. A.g Winona, Minnesota, Y. W. MARY H. CUNNINGHAM Chemistry S. B., Simmons College. Social Work, Public Employment Oflice, Bos- tong Chief Dietitian, Boston Floating Hospital. MAUDE B. GERRITSON English, Language, Literature Diploma, Framingham State Normal School, B. S.. Teachers' College, Columbia University. LOUISE KINGMAN Reading, Physical Education Diploma, Framingham State Normal School. MARION I. FORD Diploma, Massachusetts Normal Art School. Instructor of Freehand Drawing, Design and Craftsmanship at the Fitchburg High School, Miss Evans' Private School for Girls, Boston, Friend's Academy, New Bedford. GRACE CARDEN Sewing Diploma, Framingham State Normal School. EVA E. HEMENWAY Secretary and Treasurer THE PRACTICE SCHOOL IDA E FINLEY LENA CUSHING B. S. SUSAN M. EMERSON ALICE E. JOYCE MARY L. CAUNT NELLIE A. DALE GRACE S. ARMSBY ALICE V. WIINSLOW FLORENCE I. WARD Principal Assistant Principal f Ninth Grade Eighth Grade Seventh Grade Sixth Grade Fifth Grade Fourth Grade Third Grade ELIZABETH MALLOY Second Grade P IENNIS L. GRAY First Grade , Glass igahp 6!Eli5ahetiJ louise Qllummings Qgs 629112 fear Eaugbtzr nf jflilr. anh jlflrs. Eusepb Qllummings Ciilhia jflilarsballb Seniors Fmmingham State Novmal School AHEARN, EILEEN AGNES '4Eileen 16 Green St., Milford, Milford High School A' Kempis Club Fine Arts Volley Ball Team Mass. -.-so AMBLER, MIRIAM LOUISE "Midge, 8 Concord Place, Natick, Mass. Natick High School Y. W. C. A. Glee Club Lend-a-Hand ANCUS, JENNIE "Janie 26 Hammond St., Waltham, Mass. Waltham High, 1915 A' Kempis Club Canning Fine Arts Club THE' DIAL ANTHONY, MARION J. 6'Marion J 24 Manomet St., Brockton, Mass. Brockton High, 1915 Y. W. C. A. Lend-a-Hand Play Canning ANTIN, ROSEMARY "Fuzzy Wedgemere Heights, Winchester, Mass. High School Practical Arts, Boston Assistant Librarian Glee Club Class Pin Committee Club Editor-Class Book Lend-a-Hand ARMSTRONG, MARION COLBY "Sammie' East Sandwich, Mass. Sandwich High, 1915 Y. W. C. A. Lend-a-Hand Canning Basket Ball Volley Ball Tennis Fine Arts 1 Framingham State Normal School BALFE, MARY LOUISE 377 Norfolk St.. Cambridge, Mass. Cambridge Latin School A, Kempis Club Fine Arts Volley Ball Base Ball Basket Ball BANKS, BETHEL LENORE "Bethel Banks" Lyman St., Westboro, Mass. Westboro High, 1914 Y. W. C. A. Lend-a-Hand Volley Ball Tennis Fine Arts BARRETT, EDNA M. l'Ef1ltIi6,, 53 Weston St.. Brockton, Mass. Brockton High. 1914 Y. W. C. A. Lend-a-Hand Canning Basket Ball Volley Ball FR - ."z"i..fp. 2 E., W Q -rart .,.,,',,,g',. , if THE DIAL WINSLOW, MILDRED AMANDA 4'Mildew 34-99 No. Main St., Fall River, Mass. B. M. C. Durfee High Y. W. C. A. Fine Arts Volley Ball BELGER, ALICE ROSE 72 Cook St., Newton Highlands, Mass. Newton High A' Kempis Club Orchestra BENNETT, IRENE 84 Highland St., Marlboro High A' Kempis Club Fine Arts Marlboro, Mass. GLA! c'Rene Framingham State Normal School BENT, HELEN ADELAIDE 'gCurlie" Pleasant St., Medfield High Glee Club Y. W. C. A. Fine Arts Valley Ball BERTORELLI, ROSE '4Bertie', 15 East Walnut St., Milford, Mass. . Milford High BLASSER, RUTH 47 Aldie St., Allston, Mass. Brighton High ' Y. W, C. A. Fine Arts Lend-a-Hand Mediield, Mass. in G. '4Ruthie" ,,..,. .3 3 T H E D I A L l BODFISH, MARIAN 'sl-Yodfish , Vineyard Haven 4 Tishury High, Vineyard Haven, 1912 L Northfield Seminary, 1914 X Editor and Chief of Class Book Y. W. C. A. Treasurer Lend-a-Hand Play Basket Ball President Experimental Kitchen BRECKENRIDGE, ISABEL Williamsburg, Mass. Williamsburg High, 1914- Y. W. C. A. BREITZKE, MILDRED M. hllflil' 228 Langely Road. Newton Center. Mass. Newton High. 1915 Glee Club Volley Ball Captain Framinglzam State Normal Sclzoo BRENNAN, ELLEN G. Bradstreet, Mass. Dickinson Academy Glee Club A' Kempis Club Fine Arts Basket Ball 7 " 1 53 .f BRENNAN, LOUISE Medfield, Mass. Medaeld High Mount" i Y. W. C. A. A' Kempis Club W Zvzi? . , ng .. 1, "- . if K 4 iv ., Fine Arts Club BRUCE, LILLIAN SARAH MLN" 39 Charles Street, Westboro, Mass. Vfestboro High Fine Arts Club Volley Ball THE DIAL BURLINGAME, ALICE "AF 54 Washington St., North Attleboro, Mass W' North Atileboro High, 1915 Y. W. C. A. Glee Club BURR, BEATRICE M. MB" 481 Lake Ave., Worcester, Mass. Hartford High, 1915 President Y. W. C. A. Lend-a-Hand Volley Ball Tennis Champion 1917 Fine Arts BUSH, DOROTHY RUTH "Bushy" 239 Madison St., Malden, Mass. Malden High, 1915 Y. W. C. A. I Lend-a-Hand Play Fmminglzam State Normal School CALLAHAN, ANNE A. "Ahnie,' 49 Juniper St., Winchendon, Mass. Murdock High, 1915 A' Kempis Club Play Canning Volley Ball Fine Arts CARDEN, GRACE "Mother" 588 Haverhill Street. Lawrence, Mass. Lawrence High 1905 Class President, Middle Jr. and Senior Year Y. W. C. A. Fine Arts Faculty-Sewing Teacher CARLSON, HILDUR L. 6'CarIy" 10 Apple St., Framingham, Mass. Framingham High Base Ball THE DIAL 2 ii if . 2 f , CHAPIN, MARION E. '4Chapin 165 Chicopee St., Chicopee, Mass. Chicopee High 1915 ' Y. W. C. A. Lend-a-Hand Canning CLARRIDGE, ELLA FRANCES c'Pipgr, 280 Purchase St., Milford, Mass. f Milford High Fine Arts COLESWORTHY, FRANCES E. c'Ff.ll1. 9 Sylvan St.. Worcester, Mass. South High 1914 Y. W. C. A. Lend-a-Hand Fine Arts 9 Framinglzam State Normal School COMISKEY, MARGARET MARY Main St., Dover, Mass. Sauger High, Dover, 1915 A' Kempis Club COREY. ANNA E. "Annan 1309 Washington St., Canton, Mass. Canton High 1914 Y. W. C. A. Lend-a-Hand Secretary Glee Club 1 Play COTICHINI, VICTORIA R. "View 59 Riverdale St., Allston Brighton High Glee Club A' Kempis Club Volley Ball Base Ball K W THE DIAL lx J CUDMORE, DOROTHY G. "Dot 145 Sycamore St., Somerville, Mass. Somerville High A' Kempis Club Fine Arts f if - 4 .fi . if CULVER, GLADYS E. c'Gla1i' 394 Broadway, Chicopee Falls, Mass. Chicopee High 1915 Y. W. C. A. Glee Club Fine Arts CUSHMAN, LURA OAKES Duxbury, Mass. Panridge Academy 1914 ' Y. W. C. A. Play Canning Fine Arts Foamingham State Normal School DANAHY, ANNA IRENE uDanny', Cedar St., Hopkinton, Mass. Hopkinton High A, Kernpis Club DEAN, MARJORIE L. "Marfly', Union St., Millis, Mass. Millis High Class Reporter Glee Club DELANO, MARIAN S. "Dellie" 889 N. Union St., Rockland, Mass. Rockland High 1915 Y. W. C. A. Lend-a-Hand Play Canning Treasurer Experimental Kitchen Fine Arts 5? :Q v,, WW ,f Sr 35 " -' af. ,,-. H ' X :E5EjEQEgI..:.,, Q ' t. ,... " Q25 . , 3 THE DIAL DONAHUE, MARY .IOSEPHINE uDu:zie 29 Clark St., Framingham, Mass. Framingham High A' Kempis Club Fine Arts Volley Ball Base Ball DOWLING, EDNA B. 'Teddy' 21 Riverdale St., Allston, Mass. Brighton High Valley Ball Basket Ball Base Ball DRAWBRIDGE, HELEN M. "Fluj' ' 66 Hayden Row, Hopkinton, Mass. Hopkinton High Glee Club Fmminglzam State Noomal School DUGGAN, KATHRYN R. 9 Elm St., Peabody, Mass. Peabody High 1915 President A' Kempis Club Play Basket Ball Fine Arts DUNCANQ ELIZABETH P. ccKays uDun 43 Robin Hood Road, Auburndale, Mass. Newton High A' Kempis Club Base Ball DUNN, ANNA RITA Main St., Framingham Center Framingham High Glee Club A' Kempis Club Basket Ball Fine Arts 'aBanana 5, T H E D I A L e ,-' ' .A ' EAGAN, MARY THERESA P. ' '6Pat' is Temple St., Framingham Center, Mass. b A lxempls Club it :mp J 1.455 Y , u-sv. Q- - Fine Arts ELDRIDGE, MARY ELIZABETH "Molly Northborough, Mass. Northborough High Statistician Class Book Y. W. C. A. Fine Arts FAHEY. ELIZABETH BERNADETTE "Betty 167 Maple St., Hudson. Mass. 'Hudson High ' A' Kempis Club Fine Arts .. vw Framingham State Normal School FAILEY, MILDRED SARAH uB0lSI'Li'll6'l1Ii,, ,,,Q '43 Packard St., Hudson, Mass. Hudson High 2 Fine Arts if iq fk. " ii '1 K . , 3 gf FEALY, MARGARET MARY ll East Milton Road. Brookline, Mass. Brookline High A, Kempis Club FERNALD, RUTH LOUISE 44- Amity St., Amherst, Mass. Amherst High 1915 Y. W. C. A. Lend-a-Hand Fine Arts Glee Club Play ,gk -:1, 5 .5 "Migorortti7' 7424. ' - ,. T" - :ffifha - 1 1 1 ' - H 1 Q 53 4 , '.f.6.p'f.f3"3'-" ,f 4 ' 1az:vsYvG? 4 . ' 2 ff THE DIAL FIFIELD, DOROTHY BURNHAM "Dotter 113 Norfolk Ave., Swampscott, Mass. Swampscott High 1915 Y. W. C. A. Lend-a-Hand Assistant Statistician Fine Arts Club FLYNN, HELEN GERTRUDE 120 Howe St., Marlboro, Mass. Marlboro High A' Kempis Club FREDRIKSON, EBBA I. MEF' 83 Toplill St., Dorchester, Mass. Concord High Fine Arts Y. W. C. A. Lend-a-Hand Fmmingltotm State Normal School FULLER, EDITH L. 14 Monson St., Mattapan, Mass. 3 High School Practical Arts 1915 Y. W. C. A. Fine Arts Lend-a-Hand GARDNER, NYLLIS 'gNyl" 351 West Elm St., Brockton, Mass. Brockton High 1915 Y. W. C. A. Lend-a-Hand Secretary Canning 5 t Play Fine Arts v GIBBONS, AGNES c'Gibby" 13 Acre St., Clinton, Mass. Clinton High A' Kempis Club THE DIAL GREGORY, ANITA V. nNi!G' 4 Gregory St., Marblehead, Mass. Marblehead High 1914 Lend-a-Hand Captain Basket Ball Volley Ball Play GEOGAN, ELIZABETH A. "Betty 152 Edinboro St., Marlboro, Mass. Marlboro High A' Kempis Club Fine Arts 177 Main St., Spencer, Mass. - David Prouty High Y. W. C. A. WILSON, EVELYN MAE MED' Fmminglzam State Normal School HARMON, DORIS CAROLYN 4'Dot', 36 Summer Terrace, Springfield, Mass. Central High Y. W. C. A. Lend-a-Hand Delegate to Silver Bay 1916 Fine Arts Volley Ball HAWLEY, ELIZABETH "Betty,' 150 Weston St., Waltham, Mass. Waltham High 1915, Y. W. C. A. Lend-a-Hand HAYDEN, ESTHER F. "Haydini,, 131 Boston Ave., West Medford, Mass. Medford High Art Editor of Class Book Fine Arts fi li EE -s l 5 T H E D 1 A L g E 3 l HAYDEN, MATILDA CATHERINE uTilly,, 'X 36 Orchard St.. Amesbury, Mass. Amesbury High A, Kempis Club Fine Arts ' Y. W. C. A. 7 Volley Ball R HILLIARD, PEARL MARY "PearIy', , 13 Weir St., Auburndale, Mass. Newton Classical High Y. W. C. A. i Q F i I HODGES, MADALENE AUGUSTA "Marin 43 Maple St., Attleboro, Mass. Attleboro High 1 Y. W. C. A. Fine Arts Framingham State Normal School HOGAN, CLAIRE 6 Oliver St., Milford, Mass. Milford High A' Kempis Club Fine Arts HOWLETT, MARION E. 6'Howlett,' FRANCES "Claire 30 Palmer Ave., Springfield, Mass. , - Y. W. C. A. Glee Club Fine Arts Lend-a-Hand JACKSON, EDITH ALICE "Eden Children's Village, Chauncey, N, Y. Good Will High, Hinkley, Maine Y. W. C. A. Lend-a-Hand Glee Club Fine Arts Central High 1912 ,A ,gg 19 THE DIAL JENKS, ELSIE LOUISE "L'sy South Milford, Mass. Hopedale High Y. W. C. A. Fine Arts JOHNSON, GLADYS E. Second St., North Grafton, Mass. Grafton High 1914 Y. W. C. A. Lend-a-Hand Play Canning Volley Ball Fine Arts KATZEW, FRANCES RAE "Fannie 65 Washington St., Fall River, Mass. B. M. C. Durfee High Y. W. C. A. Fine Arts Basket Ball Framingham State Normal School KEEP, MAREON P. L'Keepy'l West St., Monson, Mass. Monson Academy 1915 Y. W. C. A. Secretary Lend-a-Hand Glee Club Play Basket Ball Tennis Champion 1916 Fine Arts KEITH, MARION ARDELLE "Nan" 5 Central St., Concord Junction, Mass. Concord High Y. W. C. A. Fine Arts I KELLEY, MONA MARGARET "Kell' 18 Donnybrook Road, Brighton, Mass. Brighton High Glee Club A' Kempis Club Q" -, ff? .3 .iff-' . --.fv ggilfff. . 5' ...A ' 5" 5 . 9' . y , 'K 'i wx I ' U .- iififff ' . ' i i? ' 112, 2 'X , Q' .yy A .4-'I THE DIAL KENNEDY, A. ERVA "Minerva 69 Cottage St., Whitinsville, Mass. Whitin-Lasell High Fine Arts Y. W. C. A. Volley Ball Basket Ball Tennis KENNEDY, E, CLAIRE '6Carrots' 69 Cottage St., Whitinsville, Mass. Northbridge High Y. W. C. A. Glee Club . Lend-a-Hand KENNEY, MARGARET H. "Peggy" 23 Westford St., Allston, Mass. Brighton High Glee Club A' Kempis Club Basket Ball Volley Ball Base Ball Fframinglzam State Nownal School KING. FRANCES C. 'Tran' 6 Lincoln St., Westfield, Mass. Westfield High 19141 Secretary of Class A' Kempis Club Fine Arts Business Manager for Class Book KNIGHT, ELIZABETH 4'Betty 210 Salem St., Wakefield, Mass. Wakefield High 1914 Orchestra Y. W. C. A. Vice President Experimental Kitchen Lend-a-Hand LEWIS, MARIE H. "Myra" West Berlin, Mass. Clinton High Assistant Editor-in-Chief Fine Arts Y. W. C. A. Delegate to Silver Bay 1917 Lend-a-Hand THE' DIAL ' .3 Q l 5939 ' "' 4 fi? Q Q .1. if ' "1 ff- - EQ: fr 3. A '- ' re, 1 kr' - N' - F1155 3-Til' . E I LOVERING, HARRIET H. i'Hza 83 Waldeznar Ave., Winthrop Winthrop High 1915 Y. W. C. A. Lend-a-Hand Play MACGREGOR, JESSIE OGG HJILY Fort Hill. Northampton, Mass. Northampton High Y. W. C. A. Fine Arts MACNEAR, ELLA PAGE "Ella flint" Leland Ave.. Ashland K ,N Ashland High Fhaminglzam State Normal School 47 MAGNUSSON, ELLEN c'Dimples" East Sandwich, Mass. Sandwich High Y. W. C. A. Fine Arts Volley Ball MAHONEY, MARGUERITE LOUISE "Tzoitty'7 49 Spring St., Walpole, Mass. Walpole High Fine Arts Volley Ball' MANSFIELD, GERTRUDE "Trudy" 52 Webster St., Rockland, Mass. Rockland High Lend-a-Hand A' Kempis Club Fine Arts Y. W. C. A. Volley Ball W' -K THE DIAL MARCIONETTE, BLANCHE L. "Bla7zclzezte South Street, Medfield, Mass. Medfield High 1915 Glee Club Play Canning Fine Arts MAY, BESSIE TUTTLE "Bessie May 12 Adams St., Pittsfield, Mass. Pittsfield High Secretary Class Junior and Senior Year Vice President Y. W. C. A. Fine Arts Lend-a-Hand Orchestra WF, Basket Ball Volley Ball MCEVOY, MARY ELIZABETH "Mary .Vac 'Southboro, Mass. Peters High Fmminglzam State Normal School McGOVERN, BEATRICE "B, McGovern" Q 56 Oakridge St., Dorchester, Mass. .9 V Dorchester High 1913 A, Kempis Club Canning Fine Arts MCKELLIGETT, EDYTHE M. "Erie" 39 School St., Warren, Mass. Warren High 1914 , A' Kempis Club E Play Canning Basket Ball Volley Ball Fine Arts MCNAMARA, CATHERINE "Katinka" 91 West Street, Milford, Mass. Milford High A' Kempis Club ' Fine Arts -1 iff A n 5 R if 50 THE DIAL MERRIAM, MILDRED E. Ashburnham, Mass. Cushing Academy 1914 Y. W. C. A. Fine Arts MONEHAN, MARY F. 4'May 4 Lake Street, Hopedale, Mass. Hopedale High A' Kempis Club MOORE, EVA M. HEUCYIIIOTC 3 Hooksett Ter., Worcester, Mass. Worcester English High 1914 Y. W. C. A. Lend-a-Hand Canning Fine Arts MURPHY, M. EVELYN Framinglzam State Normal School MORAN, HELEN AGNES 'LHeIene" 4-33 Medford St., Winter Hill, Mass. Somerville High A' Kempis Club Fine Arts MURPHY, EVELYN RUTH Pleasant St., Gloucester, Mass. Gloucester High 1914 A' Kempis Club Fine Arts 12 Elm St.. Hudson, Mass. Hudson High A' Kempis Club THE DIAL MURPHY, SARA AGNES "Sadie Main St., Hopkinton Hopkinton High A' Kempis Club Volley Ball i NIGHTINGALE, G. LOUISE 238 West Boylston St., Worcester, Mass. High School Practical Arts 1915 Play Basket Ball Volley Ball .Z , ,' A W .,'i 6 trtr . '-'v :" I 4' 3':E:j2'?f2? , ' . 4"?iQ4sZi6'3.,5'52i1 " ,wi ,.,, , ,A ,V M Q I 1 , . , OLESEN, CARRIE HUNTINGTON West St., Lunenburg, Mass. Fitchburg High 1915 Framingham State Normal School OLIVER, ALICE MAE 12 South St., West Bridgewater, Mass. West Bridgewater High 1915 Y. W. C. A. Lend-a-Hand Play Fine Arts PAGE, MARION P. HPagie', 11 Dean St., Worcester, Mass. Worcester South High 1914 A Y. W. C. A. President Lend-a-Hand PALMER. ALMIRA B. 4- Chestnut St., Amherst, Mass. Greenfield High 1915 Y. W. C. A. Play THE DIAL PARKIS, HELEN W. 4'Prac.' 99 Cottage St., Whitinsville, Mass. Whitinsville High 1914 Y. W. C. A. Treasurer Lend-a-Hand PARSONS, VIVIAN REBECCA 'Win 8 Forest St., Gloucester, Mass. Gloucester High 1914 Y. W. C. A. Art Editor of Class Book Glee Club Play PEABODY, IRENE S. Court St., Groton, Mass. Butler High, Groton, 1915 Y. W. C. A. Glee Club 3 . PENDLETON, ESTHER g'Pen', 239 South Main St., Natick. Mass. Natick High Glee Club PEOPLES, MILDRED " fi 5 Hillside Road, Natick, Mass. Natick High 1915 PICKARD, DOROTHY EDNA "Def, 6 Highland St., Concord Junction, Mass. Concord High Y. W. C. A. Fine Arts Glee Club Framingham State Normal School THE DIAL PORTER, GLADYS MAY c'Bunny' North Main St., Randolf, Mass. Thayer Academy Y. W. C. A. Glee Club Fine Arts PULCIFER, IDA WRIGHT Hides, 31 Leonard St., Annisquam. Mass. Gloucester High ROBINSON, REBECCA S. uBc'cky 1292 Commonwealth Ave., Allston Ipswich High Y. W. C. A. Fine Arts 9 Fbamingham State Normal School ROCHE, BESSIE R. 'LBess" 90 A. Highland St., Marlboro, Mass. Marlboro High Volley Ball RUFE, IRENE E. 32 Seventh Ave.. Haverhill, Mass. Haverhill High 1915 Y. W. C. A. Lend-a-Hand Eine Arts RUSSELL, DEBORAH MUNRO 'Debbiey 4 Hudson St., Worcester, Mass. Worcester English High 1915 Y. W. C. A. Canning Fine Arts THE DIAL RUSSELL, RUTH HINCKLEY "Ruthena Cale St., Northboro, Mass. Northboro High Y. W. C. A. Fine Arts Volley Ball SANFORD, MARY E. "MoZlie' Maple St., Plainfield, Mass. Northampton High Class Treasurer Senior Year Fine Arts Club Clee Club SAWIN, ETHEL '4MissY Say-win Southboro, Mass. Peterls High School Fine Arts Y. W. C. A. Fmmingham State Normal School SEAVEY, HELEN 70 Page Road, Newtonville, Mass. Newton Classical High 1915 Y. W. C. A. Lend-a-Hand Play President Fine Arts Canning Jr. Representative Experimental Kitchen SELLOY, GERTRUDE EVELYN 'SChuInby" 34 Saunders Brighton High SHEA, HELENA MARY 42 Claflin St.. Milford, Mass. Milford High A' Kempis Club Fine Arts W. St., Allston, Mass. THE DIAL SH EA, MARY ELLEN 17 Torry St., Framingham. Mass. Framingham High SHEA. M. GERTRUDE "Goo' 346 Corcord Ave.. North Cambridge. Mass Cambridge High and Latin School A' Kempis Club Basket Ball Volley Ball SHEEHAN. DOROTHY "Dot" 585 Western Ave., Lynn, Mass. Lynn English High Vice President A' Kempis Club Glee Club Canning Basket Ball Volley Ball Fine Arts Fmmingham State Normal School SHURTLEFF, CATHERINE "Kay, 67 Green St., Fair Haven, Mass. Fair Haven High 1915 Y. W. C. A. Lend-a-Hand Play Assistant Business Manager for Book Red Cross SMART. AGNES M. HSm.affy'f 'gi "" f" 59 High St., S ringheld, Mass. I ii wa f Palm Beach High, Fla. Y. W. C. A. mf' fri' Orchestra Fine Arts F' SPROTT, HAZEL C. 56 Farverill St., Natick High Y. W. C. A. Basket Ball Natick, Mass. "Zelle,' 24 4 , y fm' Q51 . W. . f ".x Ani , , . .,,.,' ,Q 3 x x THE DIAL STANKARD, MARGARET M. "Peg' 136 Brown St.. Waltham, Mass. ' Waltllam High A' Kempis Club SWEDBERG, EDITH B. c'ErIe 535 East St., Dedham, Mass. Dedham High Glee Club Y. W. C. A. Fine Arts SWEEN EY, MARY ETHEL uPutty 24 Everett Ave.. Framingham, Mass. Framingham High A' Kempis Club Base Ball e Framingham State Normal School TABER. HELEN CERTRUDE MCutz'e,' Hopkinton, Mass. Hopkinton High TAYLOR, GERTRUDE ELIZABETH fiom" 1',W,. s e A 55 8 Library St., Framingham. Mass. Framingham High Basket Ball if .B,, Fine Arts .X ' X, 5 EY TAYLOR, WINIFRED M. 525 Chelmsford St., Lowell. Mass. Lowell High 1915 Canning THE DIAL QQ: Wise , -9 1 Y.',.q g-Q1 THOMPSON. MARY ELIZABETH '4Mary T., 35 Brookline Ave., Brokline, Mass. A' Kempis Club VAUGHAN, RACHEL E. "Ray 39 Williams St., Worcester, Mass. Worcester North High 1915 Annual Member Y. W. C. A. Canning Lend-a-Hand Fine Arts Ed 1 5' , '51- ,Lx Q TQ?2"g2?.L- rf, ' Y' ' if, fn , ,, VIALL, MARGARET HOWARD 4'Peg 19 Hancock St., Lynn, Mass. Lynn Classical High 1915 P. G. a Framingham State Normal School WARREN, OLIVE 14 Clearview English High Worcester 1915 Y. W. C. A. Lend-a-Hand Fine Arts WEBSTER, FLORENCE R. Corner High Stetson High Thayer Academy 1914 Y. W. C. A. Lend-a-Hand Fine Arts WEINCOLD, ENID F. "Nibbs" 31 Samoset Ave., Mansfield, Mass. Mansfield High Glee Club Y. W. C. A. C. Ave., Worcester, Mass. and Gold Sts., Randolf, Mass. 1912 THE DIAL WETH ERBEE, VIOLA A. Hudson, Mass. Y. W. C. A. WH EELER, ELIZABETH W. Betty Summer St., Framingham, Mass Northfield Seminary 1915 WHITE, HAZEL M. 150 High St., Readin Reading High 1915 School Pianist Orchestra Pianist Glee Club Pianist Y. W. C. A. Mass Fmmingham State Normal School 61 Bowdoin St. Newton Hi hlands 5. T 2' Newton Hi h 1904- W A .Q .+- - .1 ,- fo WHITE, 'HELEN LOUISA Q 1 X 53 f M " f :.' - WILLIAMS, LELIA C. "" ' A 70 Orange St., Nantucket Nantucket High 1915 Y. W. C. A. Fine Arts Qhhenturzs Zin The calm uf illizacberhnm One morning very early when the days were full of fun, I I rose and found on ev'ry hand a new regime begun, There were hills and stairs and stairs and hills backed up in stem array, By visions new and lessons strange and teachers all the day. On that seventh day of September in the year A. D. 1916 began, technically speaking, the history of the latest adventures in the realm of teacher- dom. First, the school asembled in what we new arrivals afterward discovered was May Hall. Some obtained seats in the center of the room, while others stood in the rear. Suddenly a bell tinkled, silence reigned, and roll-call began- Seniors first and then Middle Juniors. Would Mr. Whittemore ever get to us? The regular Juniors were divided into six divisions4l03 of us and all pretty much scared. Then, "Mr, Work- man will read the program," and a slender, wiry man with glasses came forward. Every lesson was to be held in a different room and the rooms ranged anywhere from 4, the penmanship room, to 87, the geography room. Just think-fourteen different teachers every week! One of our first lessons was English in room 67. I got lost on the way and had to ask a man with big tortoise shell glasses where the room was. He led me right up to the door, through which I passed to meet the English teacher, Miss Moore, a motherly looking lady with a pleasant smile. Here we were asked to write our auto- biography in a personal letter to her. Don't teachers ask queer things sometimes? As Miss Shepardson had to give all the Juniors a physical examination at the beginning of school, we did not have any "gym," for a month. We had to go walking, or "exercise",just the same though. Early in the year came our organization as a class. Mr. Whittemore presided until we had chosen a president. With Marion McLellan, a Household Arts Junior, as our president, and Bessie May as our secretary, we began our career as a class. No longer were we just individuals but-the Junior class! Mr. Ried was our handwork teacher. His sense of fairness appeared on the very first day when he said that he would give us a square deal, if we would give him one. A sense of humor is a valuable asset in a teacher, too. We certainly afforded Mr. Ried ample opportunity to display his. After we had worked hours on our port- folios, he calmly ran his finger-nail along the edge and behold-the whole cover was loose. Re- member how he made fun of the handles to our baskets, too! But, he never called for our note- books after getting us all excited about them. Geography was different from anything we had ever had before and was really very interesting. Towns that had never risen to the height of hav- ing written histories came suddenly into prom- inence in the geography class, for all the girls in 4-, 5, and 6 had to write "books" on their home towns. No doubt we astounded Miss Ramsdell by our brilliancy, because the first three divisions were allowed to make graphs instead. Do you remember the time when we arrived at buttonholes in sewing? One girl made a sample in a few minutes before school. Miss Cushman looked at it, then went for her -glasses and ex- amined it more closely. In great surprise she said, "Why, that's good. That's really quite good. With a little more practice it would be very good." Wonders will never cease! Our social activities began when the Faculty and Seniors gave us a reception in May Ilall- to help us get acquainted. To facilitate intro- ductions and offer an opening for conversation, all of us Juniors were asked to pin on papers with our names and home towns. Framingham State Normal School 69 Later the Middle Juniors gave us informal afternoon teas in the Experimental Kitchen, in- viting us by divisions. A slip having the name of some well-known person was pinned to each of our backs, and we went around asking ques- tions until we discovered whom we represented. In the fall, too, every one who could play basket ball came out to try for either the Har- vard or Yale team. Excitement ran very high and finally the great game itself occurred just before Thanksgiving. There, once more, Yale proved its superiority to Harvard. Right after Christmas came our first attempt at entertaining, when we invited the Middle Juniors to an Intercollegiate Class Meet-every Arithmetic was in charge of Miss Armstrong this year. Here we gradually progressed from a study of the four fundamentals till we were able to compute with a fair degree of accuracy the amount of materials necessary for building any given house. More than that, however, we learned not to take ourselves too seriously, and we were glad to have even this brief opportunity of knowing a person as buoyant of spirit and kindly helpful as Miss Armstrong. One day Mr. Whittemore asked the Juniors if they could not find some way to raise money for the Amelia Davis Fund for Indigent Teachers. Our committee finally recommended that we sell pencils with "Framingham Normal School" one was to come in middy-blouse and bloomers. M. A. C., Comell, Princeton, and Dartmouth were all out in full force. Rivalry was keen enough to make the meet a grand good time, and the prizes fa jumping-jack, dump cart, suit- case, etc.l furnished a further source of amuse- ment. The end of January marked the beginning of our last half year. The first three and the last three divisions changed programs. We all ap- proached History with fear and trembling, and were rather surprised to find that, if one did anything at all, it wasn't half bad. Still, one would hesitate to borrow those precious ihistory books or outlines without permission. printed on them. The whole school responded splendidly financially. With approaching spring came increasing ac- tivity. Why are divisions 4, 5, and 6 always picked on? Miss Kingman decided that we had better do a little construction work and gave us the buildings on Normal Hill to make out of card-board. We had to have exact measure- ments for everything. I think we could con- struct almost anything now, especially after our experiences with May and Crocker Halls. Outdoor gardening started early. Each girl had a special plot all her own. Mr. Meier ex- pected great things of us and in no time some seemed to have "got the notion." 70 THE DIAL What is spring without a circus? We in- vited the Seniors to a regular circus from Podunk. There was everything from a fat lady, an elephant. and a giraffe, to an educated pig who played the flageolette, and the usual crowd of sight-seerspfrom the country had not failed to be attracted by the chewing gum, lollypops and pink lemonade. Every pleasant "gym" day we donned our middy-blouses and bloomers and went down the street to play baseball in the field. We are sup- posed to be able to teach baseball, but let us hope none of our future pupils, particularly of the masculine gender, ever obtained a glimpse of our extraordinary ability! By spring we had one final recompensefour course in solo work with Mr. Archibald was almost over for one year. We never entirely re- covered from our stage fright at appearing in public, but we became more used to Mr. Archi- bald toward the end so that we dared to smile once in a while. At the end of our first year we discovered that we were to lose both Mr. Whittemore and Miss lreson. lt seemed strange to think of another year of school without these two friends. We shall always remember Mr. Whittemore's quaint humor and fatherly interest in all of us, and Miss Ireson's wonderful personality and wholesome optimism. September 1917-Seniorsfdignified? Well, yes, on occasion! There are three divisions this year and the work for each is divided into thirds. one-third to be spent in Practice School. Speak- ing of Practice School who will ever forget Nob- scot, our nearest approach to the world famous Podunk district? Practice School with all its varied experiences deserves a whole topic by itself. Certain it is, at any rate, that there are few girls without more or less vivid memories of the days spent in trying to adapt themselves to the different stages of their three months of prac- tice work. As to the teachers themselves it would be difficult indeed, to tell now the extent of the inspiration offered, the scope of the am- bitions aroused, or the value of their strong per- D sonalities on the lives of the girls looking for- ward to greater successes 'fjust over the hillf a Those who were Middle Juniors last year were Seniors with us this year, and when we met for organization this fall Grace Carden, a House- hold Arts Senior, was unanimously elected presi- dent, Bessie May, secretary and Mary Sanford, treasurer. Our first big social event this year was the re- ception to Dr. and Mrs. Chalmers. We know that the affair was a success in that Dr. Chalmers had already been received into our hearts, and we trust that his cheeriness and "gumption', may help many girls to realize their ideals more nearly. Once more this fall Yale won in the Harvard and Yale basket-ball game. lt doesn't seem fair for another state to step in and walk off with all the victories, as Yale has done in the past few years. We ought to be more loyal to our home state. In January the Juniors gave us a Yachting Party, guests to come in appropriate costume. The girls who did the Sailorfs Hornpipe were splendid and Mr. and Mrs. Vernon Castle worthy of their name. Dr. Chalmers has proved himself a real Msportf' He organized a series of coasting parties down Maynard Road this winter, and included not only the different classes, but also the faculty. You should have seen Miss Sewall and Miss Emerson making a target of Mr. Howe with snowballs. We had one new teacher this year, Miss Rochefort, who had been on a year's leave of absence. Rumor said that she was very firm and particular, but rumor had elaborated and twisted facts, for in her classes we have had some of our best times, in that we have been led to actually enjoy the subject under discussion. ln the life of everyone there are always a few people and events that stand out more than others. So, in our lives this year stands out the character of one whose high expectations we have not always reached, but whose honest frankness and genuine sincerity have quietly and unobtrusively made their appeal to all of us. There is one thing that will pass down in history this year-the Intelligence Tests we have had in Psychology. If you should ever reach the point where you think you know a little Framingham State Normal School 71 something, we recommend that you apply to Miss Ramsdell for a few 'gintelligence tests." The result will probably be most disillusioning. A poster was wanted for the Health and Tuberculosis Demonstration to he given in Fram- ingham this June and a prize was offered for the best one from the Normal School. Mr. Ried made this problem a part of A division's reg- ular work. altho every one in the school could than the girls of the other divisions, because one has just had actual experience. ln almost every class some question on psychology or education is started. and one really should get right up and discuss it. Woe be unto you if you have not taken the initiative! Later in the year the Fine Arts Club was started. Helen Seavey was elected president, and Dorothy Pickard, secretary. We hope that t 1 -ww 1 . . .1 'wi' 'S ' ...vw ,-,,,g.'. fy A ,V 2' ' Rv- ' 4 J: . . 25-Q-.5--J., V ' . 1,13 sl' , compete. Really we were surprised to discover that we had so much 'fartistic talentf' Mr. Ried was splendid about helping us all. Helen Taber received the first prize of five dollars and Gertrude Taylor second prize of two dollars. Practice School, an essential part of our life here, has its drawbacks nevertheless. All the teachers on the hill expect one to know a great deal more and to proceed much more rapidly this year will mean the permanent establishment of the club, and that it may mean something really worth while to every girl in the school. Our first public meeting was an illustrated stere- optican lecture by Dr. Hopkins of Boston Normal Art School on "Joan of Arcf, Now with our baccalaureate sermon by Ex- President Taft, our Class Day exercises. and graduation itself to look forward to, the best is W THE DIAL yet to come. We have formed new included in inner spirit of the past be ours as we go out to take our spent two happy years together, P1309 in the Wfffldis W0fk- friendships, and learned much not the Course of Study. May the deep, "Circumstances are the rulers of the weak- that has marked Framingham girls they are the instruments of the wise." S 93' ,,, 5 - Q ', -fa 2 2 ? -.f 2 gf?-3525 1 +x. 3539213 252 55212 EEE sis gs - an - K. A ,fr ggsgl ds, , 255 2 Qi 5 'ESQ' Q -X 4,5 .I wi- Wzw-kg 2 ' 3255, 5 35? 5113753553 2 35 g E' ,I .f. J'-E .. ,S '3 52 53' E KSE38 mg' 5? 35 522 an ff if 5 -gg 5 sg 5 542 V 05'-1 E PE gif Q If 39 E 522 Qiafigig fm? THE DIA L 5355 5515 gg-U 2,3 "' PM ' 9193? "' 42 ig E533 5:2525 3255 L P- . 2 5555? 323526, 5,55 5, -if 55 5555 E35 -few Usd R U1 ?1?laf 553035 53? 5 if "' 535, -gear I E fa gj32i,Es gig 07. '- 5 L53 is P215 F IS N ZSIZ fi is if ' I gigffz 5552 12- 6, S :,- f2'!E 9' ', i2 5 'fg fe? if 6, 5 5 QQ Wg gina .5535 5152 'ilifsiif W2 rw? .,- ,' -f? 32 33535 D' T' . 3? -z E2 ' 2 If 8, -if 1253 ? +-Q Qggssi ,.?E3 'xi 1 56 ls? 5 5 5 f -fa , L , 4 f 1522 ii? 51? agp BEE 2 if 202. av Qflbi- P13 . THE DIAL 59- ill -u ' -vs 0- Q: an W 4 . ' 425 5552? 552 -,ff - ,Q 565541 5? 3? . msg-EE? 253 522 gg 535 5, 'w x eos'-P. gf'-,u5 35-5 W5 0.2 ..-gr---.Q - -5036 HV " . 5?-5 52225 +255 Qgif is f if EE, S235 555 QMEQQ 5 f .s 3235 f' 2315352 3 E 5 .5205 --2 ' 33 25 ii 25 4 0,017 Q u 0 I I egular uttme NAME FAvomTi. Exl'm:ss1oN FAvon1'n: PASTIME Am IN Lin: WHAT F. N. S. HAS DONE FOR HER Eilleen Ahearn, Oh. dont! Studying. To look older. ' Made her m re care free. Miriam Ambler, Honest to goodness! Crushes. To be Miss Grey's Made her more enthusiattic than ever. assistant. Rosemary Antin, ,Heavenly Betsy! Chasing the dust. To teach arithmetic. No place like home in sickness. dj Mary Balfe, Oh, good-night! Going to Central Sq. T0 lnve one jolly Taught her to be optimistic. Alice Belger, My goodness! ! Knitting, earing for To become mature, Prepared her for all wordly slams. CQ Irene Bennett, Oh No! ! Laughing at her own To go to Alaska. , To get up before breakfast. SA thoughts. xi Helen Bent, Glory bel ! Trying to look sober. To have one break- Taught her to avoid pins. U1 fast a year. 3' Rose Bertorelli, lt isnit true! Seeing the "boys" University of Miehi- lntroduced her to her "future," S' off. gan. Ruth Blasser, Oh, ye Gods! Dressing. To grow old grace- Made 21IJpr6Ci21I6 the art Of tC21ChiHg- 5 fully. Ellen Brennan, No! honest? Hairdressing. Te teaeh in Nob. Made her a iperfect 36." Q scot. N Louise Brennan, Really! ? ! Being a detective for T0 be Miss Green Can't see her for dust. gl i0SI b00kS- ough's assistant. 5' Lillian Bruce, l don't know! Being sarcastic. T0 leve and be loved, Taught her the art of dressmaking. Q. Hildur Carlson, lsn't that funny? Knitting. To he a Red Cross Turned her mind toward matrimony. nurse in France. Frances Clarridge, Mercy sakes! Motoring. To be an aviatrice. HOW i0 100k dignified- Victoria Cotichini, Give us a ride? The Spa-with? Life job - helping Bigger fiirl than ever. .l- with his re- ports. Dorothy Cudmore, "Everyone to his own Meeting with acci- To get ahead. Br0k0 her Shell. taste," said the dents. old woman when she kissed her cow. 3 0'-:gow DEB? as WO OZUEDDEEW as 252 -QSM MO beam .Hamm N as 352 'Egg .HE 1553 HW 252 .Emi ZMOEU: Q5 wig 2 SOB KNEVNMV WEE 2 5: Ewsgk .WHEQEEN5 E '55 WVEWQEE L A .ng 305 B: 352 I D .DEH-O: tg: HE 530 E H :Em '55 Eiga T QEEEMMOS 15: 33205 hmmgaigg as 33 2 as Hamid .WEEE wEEgOa2w F-O33 2 swam .Em Q5 29:33 M E: 232 .EE as wgggm in Sh! MEOQ gm tm 'Z gm 'EFS S HI BNQBNAO: .EEG Q22 ESE 2 DEM 3 2 E420 E ENE N 3 Or-L 53295 HW 3 CF .Sigma N mgw Ui EH L33 OH .Egwmmg WLS-On Q2 Us OF -E303 be HE 'gm 0511306 DA OH .OEHESE mg? EE NW M5 OF .EEC Ima Ewa: B OH 'UEOL EOC mga .EE O2 ig OH .EOF-Om DMEOEL 0:2 :M I: geo A33 OF .QOMOSOMWQ :SWB OF 2655 EPO: .QOEEQEYA E HEUMB sg EEE .Egg 2: E 325 gt :HW USM OH .HS M0030 Ewmmv 2: F-23 OH E5 ZH E4 2-SBU Nm H O mg mgcmgb AME: U O U Q W mizugsnm .wiwgm KEN? ,mv M ui OH wigs? -EHS EDEN m-:gm IBEW? :im Qt miruam ICOENDUW NM: me EW wigs! lrmvwgg miggm W EW wizsp .Egg 2: MO bm 'Ocmgg 2: F3202 .WEUENQ 'ESMJEE 2 ,Sami :TE mimi Iwata wicca 'gwwmm as MSEOO 2 wirrw .EERE 'Ei 3:2 mimga WEHVHMQHH WHHMOPQHH M m mam: Ee so NE: Us Ugg we wigs? mcg: Em New MEF: :QA WHCOU JEHN2 S3 'OZ N32 ig :zgs NME io 2-Bw NME do T5 2.30: Bm mug? gamma so mime-Nm WEB 2: Eh E25 rigs: .DUQSM Eau! H2 L3 5626 25.002 mba Sw 5:3 MW 22: WH :New :WE fc: mga :O zgmmm-ECG EKEQSQ DMEEEQ 6:53 .535 AWCOHEMU mmawq rCOwMUC3vEh REM 'CAKE Comm mrgwrm Bama? SCENE! 35:2 :Gig Ebnggm SWEHEM ENE rgwlmm F52 AEEQ E141 JSOCDQ emigmm 'bw-again CRUZ twiggn gem nge-HEOQ ENE 'SOD 25262 :Egan SEQ MEZZ I, LL P! 'L 0 0 Sch Z 'Will 7 am. State No gh in 'Gm F1 'HES IH mam Q5 553 wig: WO RSM 2-F 'NQOHGE KQSEBMW as WEQOEZD 'Wagga Q: wgsw wo :N 2: '55 Ewzgk .QE :SHS-W-E HW as 232 -8E2EOOI:Uw as MENU imegig E253 '55 83055 dggmigc 5:3 ,HE HEROES UEHEOQEM E2 as 255 'WEHE E5 Eg WCEUEO E 2095 SN EL 252 .MEN-Ham HE D-H52 Args HW mm BEM QEBEOQ mbgrw -N62 M353 EQCEUUE EN SE Ew imaged Q EEL 'DUE 'EAW Tggmwpga 2: as E EQOEZQ Imam MOH! HZOQ min .W 'Z .rm 9452, ,wgbg EN 3 it .ENE mira! N BDE OH .DOEEVW 2 Ow OH 'ii EE JOSH Bt: 58 UEOW .EEZ L32 OH .3556 M22 OH Dawg? Om OF .EHEOC E OH 'Egg HW 2:83 OH .3565 53 OH .EE 'EO SNES: Q Us OF :GOO1-1 EE 323 'EE QE: :mi :EF .Em 'Ein 359758 M22 QEOOME OH E5 E E4 'mga WFUPQOME wi DHOQQWDWEH wi-USE .REOU MWEVQE ,gain S E262 wigs? nwiwim .QC-OSOQQ wcgwgw .WWE uw C O M Q A 2235 wiiag -USN wigs .mgmgnv MEHEU 2:5 wiv-QE .mv-OOD EERE wC::WUm 'MBE IH H D O weismwgiu .Emi CO wiggw Nile w:EOgQ2pHL .WWUEU6 E wioc FEEQL E-maid 25539 S53 ,535 :OC Eu H CZ .mi 'VS-DCO? uma gg H NEDEE EQ ,Oz M :bw 'EB ESE we Eg M Wggm Lzbgm E: EE: 620: gtg EN How QPDOV EO ow SEZ M? 'swag EE EOE? H wmv-O2 gmc do magic je muxgmve Sw Om DORA Em HE? ZOGWWIMMH HF:-OPQM 'NGQGCMWM MEEU i0:0M EOE :EDM :GENE JSQNQM Swish Miz: DEM 'Coming :EMM rcmwom NEED rmMuw1O: 32352 ine-mm :SL 55: EEE iggm ELEM dogg! ESD C320 e3HNN:m EEZ f -1 H bg 1 L2 I fa TH u' .CZ E E 'S "1 S 3 3 3 2 AL rn ... Q 3' Q3 - an ng.: , - E .':f"' E VP v-... Q H Z O '41 M '5 2' :E ki -1 Q-.35 .-. ' I- fd Ou-1 8 gf Q S Hug ,Eg E Q 3: .Ci gbg 3 5 a 3 ga -33 ,. M 'E 1 Q an EEE 2 2 :U E O-L: 5 Us DD if U 210 5 . I: 0 .aww 3 .2 E 'D " H C .-on O O E I N A H: O o .H Q, cu .5 J: E 3 IQ H L: dau '-1 3 J: u. ,Q Ov as -.., 1-1 : 1, as H D Pt? ,L L. mE E ,H '., E A -' ' 5 Q, 2 P-2 2 5 Q 5 5 C5 'U "-Q' 3 'C 'B Q 'U vs- 3 'U 3'-1 O 'U S. E gg lg Q -S E -4 un H E 43 5. 3 5 :I -E zu J 3 -2. - A an L- U o . U . am .5 1111 -': ca. Q E .Z Q .-1 . Eg U ,Q O 5 E2 .ss 2 2 A TE 1, S L5 S -.3 -Z .U -Q .. 2 L E .H o V7 ' F U7 Q - 1' 1 das A Q E . E 5 aa, : E S To L 50-is as "" W Q 'W ST: 'Q C 4:5 -Q 5 Q 5 U" D uw-3 3 0- 3 2 E3 5 's L' Q 2 ua .. ,q o eu . 5' 9 1: Q.: Q E julia .2 Q.: A '5 M .gg ,ns .:u, Z Q O :D .-U 5 :gag '32 P ga-. -U "'.. x-4 1-N 1: ...N HF: Eh 5 Cv EU 2545 5, zz. 3 Q.. 0 .. Q33 Q .3 cl' 2 :: 'U LD Q I-1 O 0 dl 5 DH -'-1 fd UD co - SSS z "-' U : U' 'H' cu'- - 50 GPN- Ha-0 Q ' : -F ."' Q -so QU as -1 -1 --bn O ,U NFQ ID ,Q U .: 2 gi, -g.sg0Hq5miE 5 H eg- d P4 "".:'-1' o"-5-sg -- U -2 'U ap" :O EE? ma, U-Quvogigigg.. 5 QQ33-ESQ af Q'--0.21 TPJ2'g',:UOQQg'.0 :s 61620 hi -5,.O.UQ,s-. , ':-'UJEAA Of,-cg 3 -U Pb P 5, '- Q ' ME cn".i:"' ' 2 if gg. 2 CE-55 Sgcmm 0: o QCD - Q-DC GJ '-1 -gg Fc. as vifglfai' Q-55:2-1,20 -E E., :Q w.::E---W440- 52:2 mi .AZ gf :g'E-'Eos-F,-53 EH: .EE cd 5 '. 6 3 -2'5:fv5' 3 30- W , '-'QD O "- UO C - bn " O bm PN r-JW "'.-5250 ggi-4 " gg ld -5 :J :I 'U Pm rn CBO.-. n-4O "" " - " 2 x-.5 ,E cn 5 p.. 'L' 5 E 'E 2: 45' -5. ff Q 5 'U .E-. 'E Q fn EE Z E Z E n-sig UD -I cn": E Q P' aff 2 Q Q so W -21 5: Q .4-1 C 2 5 G H K . 1-T "" cu LE 'fi Ei, 4 'gf-I - : an . 'D .1 53 G .5 C33 5 -so . Ev '-' 5 EE N 2 'G ma. eu Q ,,,-E .5 0 ,U Q.: 'Hg 2 Z 'neu "' E C 4' u 52 E 8 .E 4 .0 CI U G in on Q 3 5.15 eu 2 " 5 QE 2 .4 v Q2 S50 -U - Q Lilo: 5 5' .4 3: 3. ni Z 1... 4 O Z gp 7 U 'F LE Q 5 ug E Cv cp .JI CQ 5s .2 2 "' E o 2 U 2 4 E cd U E ?4 4 1 8 Z 0 0 Sch, Z 'Will N01 State nglzam Z 'WL Fm -rggu EOE V7-EH 'SL BEE .saw OEQ20 EW :O MODS EEE 2 El Ewing 'WEEE ,E mg- NW ,sg :EG -Macaw 2: 0:26 EEE? Q:-cmwOEw EAU SHE OH .EZ ENE ESU -ug ,Egg :cw as DEE -mgEN:2gOO :Rig E E225 EN EE WEUEQSE S3 MEEDOU 2: E Hwagi EN UEOTSUQ :SEEN Ucmgra HE EQOEZG .56 HN WEE: 'SOM Hmmvwmw OH 'RSHUDHHOO WMEMWVMUMQ mwggrw OF .Gmini WO 5530- as Ewzgh 23:2 Dig S 302 HE? :dw 3 :BONW Eg ZQOCWEEQO mciuigg ESL .EWEOLS Omg N Ee Us 2 ww 8:25 MO UEOUEO OLP .WEE xg? H2 N v:-2 2 as Ewigk -QE: qgw N SHE OF 73500: M 2 OF .EWEEE EW 3 OF M23 :WEEEOU .EEUU WEEE? 2205: Or-L 'SEM QWLEOOT :WE CO Hmm E uw:-3 .3330 Us 'LEOBUCSJQ M 2 OH 950206 N63 G 0583 OH -KEOECEE WO Him 2: QED OF .Amcigg MOE ME -23 2: E Bw OF Immun: EE FEB wi N :O 3: OH .Emma ,OE 03:60 HN DJ OF :.3O:OE3: OE 'GWOQ wiiigg OD 'WOCQEEE WO H2062 N D583 OH .GEOS E QE EQ 532 at .HE EE L32 .WDTQW be ETS Q: wing! AEE IENEEE winiggm gmac 2 WEEEE lwiggm 'wiezq mwE5wEOL 'wg 1:3 E5 QDZUNOW H23 w::EOQwU:OU .swim '35 wbasu wigs 'wianwgw :EESE E EU: I2 Da OD: wikga FEPQ1: E wiemgm wDHDg3IwEvzEV 2 i wimedmrlv DOES czmeggn miami imgolamm was-ugm 'AEE M ,EE L E OO: :me ow ig so N m m mmm .Eslnuw HWSQA -H0530 HO: EL :ggi Ea :O wwe? jo :EE do MOSES-U M Q5 .WRVEUOOW do .wmiw EGU :H-ww: M500 Tag H5 .NEW ENE :Elm 3:-:HOU aim MSDE: rgzmww 062:00 'ERSHW-m Tim ngoramm NASE tzwagm EDM Bodom wmgm 502-EOM NUUUQUE "E':23m GE AEE QED GRADE NEHSOD AEOEECDL .6-twm BREEZE H-Nam 'NEEDS Cram 'Swan ws: S3 gb WO :Em EH EE EQ ETS 2: OH .weiwmnv N NOW Wim :xg EEO? 533 Nam MOL EZOQ Zim .W 'Z .HH 1:53 IEA 7: H54 Ezpmd-HH IFEOPQHH ZOEMEQMMH FHEOPJH E342 pang:-HHS .M-:Esau S39 Hwdnunmllulnlqxlzl E" :Lx 41 X R 2 xl I 4 L A I D E m H T 3 qu b .533 Eg 3:53 as 352 .mga 530 OH as Ewan? .wiv-Q3 MO HE HE iw-:WF S:-:gsm whim LE:-U 2 as Emi: .Eg EE :Rag SL .HDL Sw wma HN-lt .GDL ULH H50 Hgmihim WO 2 at E Egg 'Emzwzm Egzm :WE -EQHQ OHOQQHME CM HWUHUHCM 'Hmvx 10203534 .gcc HOUWHOQ N ROHM .DUCU1cCOOI':0m HQ: EOPMQ .ow-:Em Mgommwgoa N gg 530 nwiawgmm 'Bac 2 232: E-Umm DCO dam MON! ESQ ENE nw .Z lm H455 .2210 SGW JOB OH .V-H03 E5 S2 mg: OH 2.253555 TEC? 'ggi N MED-ug OH 'mam' SQE MEN 2:20005 :NU OF 35:32 mining HW M5 OFF .5532 EEE-'ZEN EW M5 OF H5332 as EN 3 OF A-Um:-OO MO isdn: 'DDQ 95522 yum N 0583 OH .803 'EEZ E L32 OH 'Eggs EOE: N 0583 OF ix WO DEE EO H53 X52 UGO 9:3 OFF 'M 22 EE 2 Or-L NEA ZH EIN zizmzg 5 H M 3 w:T:::m .EDEC wigehq IWEENEQ QE? wgggm Egg 2: WEEEWE lwiviwa dwgw me miami, QUT: HE? wisgm 'WMEEWZ R3-U -Saw CO Em Bmw 'O Q Q C wCEG:2Cm AEN: 0 F: H Om gleam 'megan HO wigiwu .Umm-JE WEEE: Hfihkmdm W'-LMOP4m 65559 65:3 B39 N EIFEEO iwiggs 305 :ESM mag RAE jo 'EEC mam SE ic IDE: WO 2-mg, MW WLS: do SEE! :EQ dwgw DE: E5 50 :ta WE: :B 2: W2 354,122 :OEEO2 wiggm .U-'AMOS N DFNZ :gm E EO EBM HE do ZOHmmKMhNm HFHMOPQYW ggmib? EHEME :Emma Cram A322103 32? A309559 ECM 503525 NCME ,High 35:50 gist 512 igggm BEM rgoegm EE hmzgaigm 55,432 Spam H052 Jggm W2-wg Ejiz l' 0 l' Fvammgham State Normal School 83 F- "' fu : eu - . , 5' ,E . 5 E E ,E .'.: 5 at U 3 O UD cn 3 I-4 H cd :s 0 I-ll 9, -U 8 .E gg '-o-4 'E O 'U : 'H ... - . an ..: ' E Q Q 3 -51" " ,2 0 4: H 23 O G4 -' CU -"' : --' -'1' "' L.. "" .aa O U U1 O En E H 95 o C: ..-. H cd 3 N .,.., .2 ul 03 'U cp ' W 45 H- E "' ru CU an 0 .-L' 1, -5 0 'U z 1, E 1.3 'C' 'g lv 2 an 55.3 if gg Z gg A-:Q E -C' E .':'. E P- Q UL'-' F: o . 3 3 3 O t: cd gg 'UCDID 2 .cu "' U1 'Q E E -U Q H Q 3 E Saw Q- Q Lg go ED CU 5 'D l.. Q4 055.0 O Cd I 3 :D G, E FED cg w -ED 2 Sung 3 3-og Q .Q ' 4 4-I ug 3 w 5 in .E gd -g .2 3 E l-:EE 0 E - o '-' o x-. QQ o +-H N Z ..:: FE 'E ,E -G:-3 2 an 2 263,55 -' 5-E10 Q 3 In 1- "' .- eu "' 3000 1-' 35 h E B EW S X- -. 'G S-C,s:Q'E,, E EWS C' 3 +2 L.. C'-: -Q 2 QJ '55,-C:-QQ QD -gl? 'U .pg E '-' -'U 4-1'-'... '-' -5 Hg Eu 30 5 -U -5 Um L, -5'-'P .::'-N.: CI F:-gg EIU' eu q,,-- D-P-... If bf!-'50 593 5 C G.: Q9 f-1 .CIC OCG- Q23 2,223 5 2 -gs 2333.508 ff' .E ga T5-gin He aaa-as 25-'MSQCEHELZ Q S-4 4-A an a.: 'U bb :I F-'H Q5 H ..- - . .,-. 0 O OU I :Q Q gm p., pg v-I dj no D: CI H-H 3 as O on -.-. ..-1 v O O C51 O Q D03 cs 'CJ ua 2 H Q, T6 53 Q75 Q E Q, .:3s: "" 5. 0 . ,,,, In L: 5 fi .: F E ww ' E4 ,E 'g .3 E 3 2 E qi f-1 Q Q - "' - 1- "' -- M .-rc-Q 4- Q5 .+-' z 33 0 .2 3 'NE 2 Fcgjm .cv aagx-4 3455 'Q ,E S: H 0 1: DD - Q2 Q wb .emo 'szffffd .- , H fn C, CU .1-49... D4 CUP: gl-1 H Q-1 DL'-'Lrl cv "5 ,Q cv :I C1 up HEDM- E 8290.2 .-. Q. . :xl H as E cd ,C mm - ... ,ww 'Du-'cv 3-U ,lv - f-' .,.. 5 V15 gg GJUQQCUL.. C' P0 4-9 'U Q. mv EX" o.QE,.,v-+- up-cs "W-Pu m 0:22 zs'-'mm -C OFC .: com : UQ-"',:e"'o -Q 'U I-94:3 3 Q Q'-' DUDE +-1 w-...Q cum: 2 O UD'-' O O H H H M 5 5 Q EE 3 Q gag gag E-gag-C Q5 5555 .:: .L Q w - if 5. A ,U o nz C gn: .: H- c: 0 3 .,. 9 no Q E g C..-.H 3 .3 .E 415 Q- GJ 0- :gl i -4 qi ""'O an o Q L1-1 Q ' "Q U7 H ,,,"U H: rn ,-4 'U Q . rn H:-5 no ed , Us as Q-4 :Ugg f-' cu E 'E wmgfggggdui 52 E -E' 5-Eh 53 g H "' -H .A UD """' O,-4 cg +-I . eu ' 5: 3 iwgogbnig gg ,g52'3:Szs U w 'aio TS r Q as-.E-: 2-E 2 me 11 w"'U-Q an 3 S-Q a 'E UD s:"':.2an P on no QD, QD... g: un 'H-.H Q., O Cl' --Jews'-1: "Y-'Ct lv C' cubil --1 "' 0 P -- -Hf!1,DQ.,..l-149qg.,.. ,EL-UCI an E ug DD W 1: 7--'J"-10334-'QP-M 20. Aaoioano-5 ::"1mQC'D:',C .E all CU gg.-Qow-1 .E Q ..- Ag ..-.5 C -- In .-4 do Q Q' Q'-' FSH-Quzqom hggg--2: 3: CM bd LD LJ E Z a LD E71 9- 5 M 555 Q 5 Z 5 LN- fn bn o Q H 1- Q C ,gg o Q 5 73' M 2 --- ax. 0 5 H '- W 4-"'x"F' '5 "C: U3 'D t 'S 9' W ' W . ... 1-1 Q 5753 F' D- CU 'D -as fo 3 7.39 2 yi 'UCIDO -- Q.: Q9 FJ -J : 26- 'sm is : ,,, wav H E o A4 ,X an .-1 W ggi GJ gash, ... gg Q 3 4: 'Eg cu rr Qwk E ENDS 5 U M QE gg IC' 3 ,.,5, 3 -. E C-'Aa Q '-1 o H rc O-Z"-fm "" go -C E3 cz 1:1 ..':'. -':'- Q9 ' uno fv':"'-4- 3 O'-4 U' UD Q die Q ww ina Jalan. 6 M r P' . "" ,., Z fi is 5 :Emi 5 WS fam S3555 o Q - - rn. O Q 5 5 . ' :Q UD Sn .sz 5. ' I: - QS 1: on Vw O 'U an an CI ' "' as E . .O 'M 2 5 E 5 uf J E E ff SL f: .e C '-55 'Q "f H J "' -cs .M '53 r: " W is 50-fv Z an C E F: E Q U I-' "" 5 5 cu 'U'd"5 O 54 ,Q Q: fn ng Q QQ 3 no 1 CQ fr: : 550 U 3 4-5 .2 S g - CQ 2 M E 53 2 ,Q Cs vgg es 5, 1: ': ': E M -5 T5 L' 0 'E - 47.7 vow CU C Q L.. 'U O 4-1 O Q"-'C 3:0 cd as rl zu 6 .U 5 -2 5-' .... nu 1-u E mam L.. gg -1 "' v-1 GJ O 1... C5 o Q 2 2 cr: La 2 ,gn 2 fr: no cz fc 0251 2 2 r r fi, . Zi. utlme, Qlnntmueh i NAME Ffxvonrra EXPRFSSION FAVORITE PAs'1-IME AIM IN LIFE VVHAT F. N. S. HAS DUNE ifotz HER Gladys Culver, Have a heart, wo- Frying pancakes. To glide through life Taught her the value of week-ends. man, in a seven-seater Studebaker. Lura Cuchman, What's this I hear? Making her room- To have a Tin Lizzy Changed her angles to curves mate's bed. of her own. Marian Delano, Are you getting Playing Jack-in-the- To let George do it. , Taken away her appendix. ahead of me? box. Kathryn Duggan, I gotta be goin' now. To eat, sleep, drink A rich old man with Made her worldly-wise. and be merry. a bad cough. Ruth Fernald, As I understand it- To tell a bigger one. To ride bare-back Bored her to death. is out West. m Dorothy Fifield, Hello, mother. Being original. To go back to na- Given her an extra mother. Pj ture. Edith Fuller, Say, what do you Being seen but not To Hll'er Fuller. Taught her to dance. U think you are do- heard, except once N ing? in a while after 10 gg M. Nyllis Gardner, S421-Hy! DiSCUSSiI1g When the To be an old-fash- Taught her how to earn a living-if neces- bi war will end. ioned wife. sary. Anita Gregory, D0 YOU IOVC HIC? Cf-Ittillg H HCW COT- To have a fur coat, Changed her from Miss Independence to respondent. money, automobile, a sedate school marm. and man Elizabeth Hawley, By gracious! Keeping the iron hot. A bungalow built Given her a hoss. for two. Marion Howlett, More darn scandal! Taking her laundry Love without senti- Shown her the folly of making one's to the P. 0. ment. own hats and dresses. Gladys Johnson, Aw you go-wan! Astride the hoss. To live on a farm. Made her a seamstress. Marion Keep, Whe1'e's Al? Being popular. To be Havarah Hub- Made her a perfect gentleman. bard's understudy. Frances King, Not so's you'd notice Writing C. To have a wedding Given her its business to manage. it. minus presents. Elizabeth Knight, Listen to me! Playing for beans. Not to be a school Broadened her scope Q?l marm. Harriet Lovering, Well, my land! Taking care of the To live on bread and Turned her thoughts from matrimony Royal Linen. i milk. D Gb ::: : 113 : Q 'si J S: ri -o 4- 3 si I D NAME FAVRITE ExPREssn0N FAVURITE P.-xs'rIME AIM IN L FE VVHAT F. N. S. HAS DONE Fon HER Blalwhe MafCi0nClfC, 'Stage WhiSpCrl Hey, Filling Amos with To out-do her sister- Taught her how to quiet squeaky stairs. kids! filled cookies. in-law. Bellffifle MCGOVCTII, Oh, I wouldn't be Making sweets for To bring up the Made her a Mildred Champagne for Viv. bothered. the sweet. family. Edythe McKelligett, 'magine. Amusing the crowd. To run a novelty Taught ber how to titrate more muriatic E Sh0p like ESSCX acid for Chem Lab. Pierces. E Mild1'f3dM61'1'i3I1b Silence. Disturbing the dorm To be a loyal sub- 'Caused her to Show more of her dainty in study hour. ject of the King. ankles, tg, Eva Moore, You go chase your- Makingj herself To be evermore for- Taught her Color harmony, E self. heard. ever. n ' Evelyn Murphy, Listen! Accidently sleeping To teach school. Tried to show her blue and pink, although U1 over class time. "Frenchy" aren't a la Coss. H. Louise Nightingale, Keep calm, Louise! Welding the broom. To become as famous Shown her that all roads lead to Boston. 2- as Melba. fb Carrie Olesen, Never heard tell of Doing something for Not to teach in Poo- Made her even more independent. it. someone else. dunk. 5 Alice-Oliver, Honest?? ? Getting her beauty To teach one year Wait and see. N3 sleep. only. S Marion Page, By jingo! Helping somebody. Good +. Taught her how to fall in and out of it love. Almira Palmer, My Gosh! Reading letters from To be a successful Made her a good boy. UQ H. Chem. Profl 3 Helen Parkis, Well.l'll be bumped. Pleasing her room- To get a job. Made her practical. S mate. N Vivian Parsons, Wh-a-t? Doing Hoola Hoola To make it possible Taught her that absence makes the heart stunts. for two to live as grow fonder. cheaply as one. Irene Peabody, S'pose l"ll get any Getting up at 5.30 Not to weigh more Taught her to eat rice and enjoy it. mail this morning. A. M. than 110 pounds. Mildred Peoples, By links! Canoeing with -. To model herself Found her twin. after her cousin- Made her. Mme. F. mo t Street. 29, C '- I W 56 J-U O o E C f- TH U 2 Q T, E D 'I-l . o w L5 tw I 2 WE 3 2 AL Z 53 -Q 3 cu S bs -.. m .cz Q C au 3 an In u: -U 9 '-'5 5 E s: ,,, cj, Q . rv cu ..1 ,c -5 H 1: - 3 'E 5 - .E '-' as 9, va W 0 ,H o r: O :1 ,.. A ,E o U -2 F-' U' E by ,... -1 H c-1 ,- Z 1: H O o f eu as .-. do -ca .. f U J: 3 Li fa Q 25 H chi' 2 .Q H -Q E 1- :-.S-1 -C2 Q 2 EE ::'. I-1 2 C H 41 22 "' .ww 3 O cu N m LEG 1- 'D CD 5-.E -U E '5 ' 3 -5 Q.: -C: -id Q9 3: 41: 55" 5 En. S 3 25- E 73 Ev 'VU E +-3 W 3 ca. 3 '51, ND- :EO rn ,II gg EO 3 3 2 S N Uh" an 20:19 F:-3 M cu o,cS.. cg C'-' -cs L ""'O'DQ- 3 . cn u U Vg H .zgcg D T6-C E '-' go 'D EE -2 N an gg 0 C -22 5 'C -CE-Q15 fi 3 F: fn . 2 CDE Q, cs E B.: "P 2 ,J 23,5 O 'D 51 I3 'U wg-H2 I L' z CMDHEZ 3 4: gl :Qin E -Cf' : P-1 Egw E, CU 4' Cdqgg-2.3 3 ca P 21323 lv 'Q .fo '5 :M P' 5L"'- E 3 :1 :QP W au "H 'J G5 9 4 S2 0 22 Q L -52 . .nfvgggmj O RNLAF: gains: .34 ZH' Gb MUUEMSU m,.,,.,3x-:Deng Ogg .Z 5.-.::3wEn1,.Q gg Q, ,H p,-.N 5 " r.. no Q4O,.,:uJ:,.Q3: -1 33. td OO mu D U '5 Q :GUN ',.,L-4 3 as E"' Q-G... Q6-'Logobn C5 'ng Eg Q E H 2 wing ..Eo:2,...m JE "' bd OO'-2 "'x-...f Hnagp, cn Q, an F ma, -Qggicv zz. ' Cf I 65 as H 5255? 3392. EE H2 5 ZQQGNQQ-3 'S E 2,-Sr: 2 Q, H C4213 ...ggi ' E bb ':-20,151-1 E cg, Pao? 21301-01716 E 5 SMS? gn 3 jj - H .DEE B- Q uo:L'5'csfv1 ,:10-"'-',... E 'E .co F "' --. gh,-ML.: -QV -1 o F2 pd-,Q 5 'ao'-.2 .Q -5 3 3 e.a5.E w ,uzO 5-150-'-an '.-1. 3 gg UF z Q'U,g-E56-Qs: 1:.w H iogkf an O rn O 2955.5 NZME 2 :lj ww m 2. '-4 039: "C 55' E302 5 af 2 U me was w wav H ,. ... Bm -EBSQ.: C1125 -f: 2 F: 3 Q s Q33 E55 EO " fi ui Ag E EWG-J u"2 fa-.EDEEJE -,,, CQ C H5558 O CJ Dzimuwv E ei O rf "M 5 ,S fiT'5..:2fQ?.J E .- P' .S x.. 42 'Q-. an 0.42.5 O '-4:1 L- arg- W S 1: .L g pg ,Sa-3 S-5 5 Q Ln .63 49 0 C -5 un"n cv 1: -5 'DCU ,.. O S "" 'Tjgrcfg :EEE rn: : I Q OJEC' --N2 3 Q 2 -Q Q-.. Q ,dugg mmm 'U 5 . A.: -, Fm 85.76, 49515 'U Q 5 ww g'.4g.Qi5.gE Q Z ,5 ui tcm? -'i 5 as 0-J Q :CE 'C D5 5- .CI U Q 'D gp . O -5 Q QE S 'gi 2 "' 0 cn 51:1 "": M ca rn Wan . .-Q 5, qg ND ": 5-1 as F: .5 gg 5"cu .rv-1 GJ I-7 Q 2 - -E -as 5 5 as 2 E 2 gg fs- .. E -3 3 5 .. :S 3 gg 3 -2 W S:-C1 eu E 3 . U "Q an as gg , BCE 1-4 D 0 -G -,.. 'D E .P 5 'G -5' E .:'. ,., .Q B if O 2 'U ,., .-. I-1-1 cd III -5 I'-1 CJ A sm nmiturp 1 Q A s-4 gm qv I . .f . if -' r ' GRM T With anxious hearts and mind we approached Miss Corey's office that first dayg for there it was that we were to learn what the fates had in store for us. In what great suspense we were held while we drew forth that slip of paper on which was the number of our room. Who were the other girls in that corridor? Did we know them? After the greetings were over and we had found our rooms, the life and fun in the "New Dorm." began. First a mad rush to the trunk room. With great patience searching in and out among the various sized and styled trunks until at last we found that one precious box marked "Podunk." Out came the first layer which must be carried up one, two or three flights of stairs. Numerous and weary were the journeys up and down, until finally all our earthly possessions were transferred to the regions above. It took a few days to settle down to the reg- ular routine, once this was accomplished every- thing went along smoothly! Did you ask what smoothly means? Listen and I will attempt to tell you. Z Z Z T ! I 6:30 bell. A new day is ushered in upon the dawn, a door opens and some early riser breaks the surrounding stillness. Another half hour or more passes and then things begin to hum until the last call for breakfast sounds. A wild rush for the stairs where the dressing is completed. After break- fast upstairs to the rooms to cram for a while. At noon back to lunch and then a quick change into "gym,, suits or HH. Af, dresses. Quietness reigns supreme until about 4 P. M. when the in- mates are let loose. The first thots turn to din- ner, and the odors which Hoat up to us prepare us for what's coming. From 6:30 to 7:00 on Tuesdays and Thursdays dancing is enjoyed when an exhibition of the latest 4?l steps is given. 88 T H E D I A L Sh! ! Here's the mail. Great is the suspense II. when a shout breaks through the room-'4Oh! a Ware glad y0u,re enjoying the farm and its letter from France! I'm so tore up!" Study bell rings and the procession moves upward to spend the next two hours in silent study! ? ! ? ! Will nine o'clock ever come? Here it is at last. Echoes from the various corridors during the next hour-"Sandwiches 3 for Sc," '6Kisses 5 for a cent," "Arms, forward bend-upward raise." "Who's taking a bath? May I have the tub after you?" "I've worked on that Protein Chart all night and I'm not half through yet." "Got anything to eat?" "Come on in the tea's ready." "Who's going down with the mail?" etc., until -lo and behold lights out and you're left in total darkness. A door softly opens and pitter patter 'down the corridor comes "The Lady of the Hour." Never a sound in the barracks after 10. U! Slumber holds full sway. After our stay of about a week we decided to have a House President, to which oliice Hazel Fairfield was unanimously elected. Time passed until one day Hazel came to 1 with an ideag for each girl in the Dormitory to write a letter to Mr. Whittemore, which we all did. I'll wager that more than one letter-carrier had to carry his mail that morning. One bright day in October visitors arrived and what a delightful surprise it was to us all. The girls just screamed and clapped with enthusi- asm as Mr. and Mrs. Whittemore walked upon the platform. Imagine that of future teachers if you can! After many urgent requests Dr Chalmers finally persuaded them to stay to din- ner with us. Throughout the meal we girls sang school songs afterwards singing a special one to our guests. Tune, Old Oaken Bucket. I. Welcome back, Mr. Whittemore! Welcome to Normal With joy in our hearts we greet you today, 'Tis here that we've seen you on every occasiong So now let us sing girls with all our might. products Arising each morning at 3:45 And having no longer such troublesome students To keep you awake during all the night! The dinner ended too quickly and Mr. and Mrs. Whittemore left us but not without the promise to come again. For Student Friendship Fund. PALMS READ 5c Come Early ........................ Avoid Rush Learn your future-6'Eventu,ally-Why not now? that this was a means by The news spread which money would be earned for the Student's Relief Fund. Soon every girl in the Dormitory was doing something to earn money to help out. To advertise their work large expressive posters were hung on every girl's door. The tasks varied from washing windows to dragging girls out of bed in the early morning hours. October 31, at five forty-five something mys- terious happened. All of us girls started down to dinner but found the doors into the dining hall closed, stationed at each was a girl serving as guard. When the dinner bell rang and the doors were opened what a charming sight met our eyes! The hall was decorated for a Hal- lowe'en festival, and one could hear the girls saying, "Oh isn't that lovely!" "lsn't it per- fectly great!" Jack O' Lanterns and witches were everywhere. Each table had a pumpkin with a candle in it,-the electric lights were dimmed and the candles lighted. We' could almost see the witches riding on their broom- sticks followed by black cats. At intervals dur- ing the meal Dr. Chalmers told us most inter- esting stories, making the hour more thrilling. The apples and nuts must not be forgotten, for the thirty-first of October would not seem Hallowe'en without them. lim sure every will agree that this was the most complete sur- prise we have enjoyed here on the hill. After like one Framingltam State Normal School 89 dinner a voice said, "Let's go through the tun- nels." All agreeing, the lights were turned out and we formed a long chain. There is no place in the world darker than those tunnels at night, every few feet something weird would evolveg a feather brush your cheek, a pinch on the leg, a drop of water on your face, etc. We finally arrived at the "gym" half dead with terror. There we danced awhile, after which we returned to the "Dorm," declaring the evening to be the best yet. Christmas is the happiest and best season of the year, the true spirit of which pervaded our festivities at the Dormitory. The dining hall was beautifully and appropriately decorated, Dr. Chalmers invited all our pastors, the Practice School faculty and all our faculty with their families to enjoy our dinner with us. During the intermissions when the orchestra was not playing, speeches were given, and songs were sung. After dinner, the hall was cleared and dancing was enjoyed by all. At eleven, three big pungs arrived. the "Carol Singers" jumped in and off we started to sing carols to the sick people in the hospitals, at the jail, and on our way back at all the faculty houses. The true Christmas spirit is not in getting pleasure for oneself but in giving to others who might not otherwise receive any of the Christmas spirit. The next day we began our journey home for the holidays. The time passed only too quickly and before we knew it we were back, rested and eager to resume our regular duties. .W it... Q- tanker 1195111 .-32" ' "AK kink' 5 In September, we as Seniors arrived at Crocker Hall, which was to be "home" to us the coming year. Some anticipated the day too soon and arrived twenty-four hours early, in time to wel- come the others. Things progressed smoothly, especially for our esteemed matron, until Halloween Night. Walk- ing apparitions and alarm clocks caused a riot in the room occupied by the "two Milsf, From this time on various views of honor were ob- tained resulting from our follies. Dr. Chalmers started the fever for sliding, which caused wear and tear on a cushion and many pajamas. After celebrating Kay's birthday one night, we experimented on the digestibility and assimilation of Frozen Pudding by blanket tossing which was mistaken for one of the features of the minstrel show rehearsal. We advocate this as being a very apt way of obtaining the best results. When anyone is lost or strayed, we all know that Room 16 is the rendezvous, especially be- tween seven and twelve, and we search no further. Hereafter if we have to serve a luncheon or re dinner we all know that anyone on second floor can give good advice and suggestions. We have all enjoyed House Practice and no longer is there the question, "Why are the back stairs worn outf' nor is there any doubt as to what water bugs are. "My youngsters!" is the favorite expression of the teaching division. Glen: lub A "All THRLL THE, Nts:-4 T." A L XX 1' X. g R,o 'VVWK V ' lf C A Y' I g f 5 Leader, Frederic W. Archibald Treasurer, Gladys A. Leonard, '19 Secretary, Anne M. Corey, 718 Librarian, Hazel M. Fairfield, '19 Assit. Librarian, Rosemary Antin, ,l8 Pianist, Hazel White, '18 Business Manager, Frederick W. Ried Can any member ever forget this year's Glee Club? "Never!,', is the unanimous answer. Opening with forty-six members under the fine leadership of our good friend, Mr. Archibald, we elected our officers and settled down to work and play. To say that we enjoyed the work is putting it mildly, for many girls have been glad of a chance to sing something besides popular music. Though we have a smaller club this year we think it is just as good, if not better, than ever before. Mr. Archibald thinks so too, so what more is needed in the way of praise? In October a triple quartet from the club sang at a Missionary Conference held in Grace Church, and later in the month, the same quartet sang at the County Superintendents' Meeting held in Crocker Hall. At the "Framingham Follies," given by the local Red Cross Chapter the full club made its first public appearance and was most cordially received. Then we began to learn our music for the annual Salem-Framingham Concert. Practice! practice! practice! and with dire threats ringing in our ears, of what would hap- pen to us if we didn't know our music, we went home for vacation. At last, we were on our way to Salem, where we were received most cordially. After a jolly good time and supper we marched onto the plat- form every one of us very, very conscious of Mr. Archibald's last desperate instructions, given at the afternoon rehearsal. Thanks to our leader the concert went off suc- cessfully, and we were quite sure that a better one was never given. As the hands of the clock neared eleven we began our eventful journey back to F. N. S. Only lack of space prevents us from describing our wonderfully speedy l?l return. Never be- fore, and we hope never again, shall we have such a fine opportunity for making a close study of the North Station. and its floor washers! Suffice it to say that in the wee small hours of the morning, we tumbled into bed, tired and sleepy, but above all, very thankful for a Mr. Ried whom even the Boston Elevated could re- fuse nothing. The following Friday night we gave the Tech- Framingham Concert. The enthusiasm shown by our large audience more than repaid our labor. After the concert the two clubs had a dance, the first of its kind ever enjoyed at F. N. S. The entire entertainment was a huge success, and to all who helped us attain this success we ex- tend our hearty thanks. Now we are busy with the graduation music and enjoying every one of the few remaining rehearsals. To the girls who love music we can only extend the hope that they will "make', the Glee Club or Orchestra. The tbrcbestra 4 QW ff! Q t ' f'N.X, p Qt.. . f , Director, Frederic W. Archibald Leader, Etta Buckley, '19 Treasurer, Dorothea Allen, '20 Librarian, Ardelle Kempton, '19 Ass't. Librarian, Eleanor Breed, '19 Manager, Linwood Workman The Orchestra opened this year with ten pieces. Laboring faithfully on every Monday afternoon they were soon ready for public work. At the Faculty reception to the Juniors and again later in the year at the Grace Congrega- tional Church some of the Orchestra played. Of course they performed at the Christmas dinner, for it would not have been complete without them. They played so well and so cheerfully that we felt as if we were listening to a Hnished orchestra. The Patriotic Dance given by the Orchestra was a splendid success in every way. Each moment was filled with joy, but the striking feature of the dance was the moonlight waltz with a radiant full moon. At the Salem and Tech Concerts the full Orchestra played and did much to make both concerts successful. Again thanks are due to Mr. Archibald and Mr. Ried, and also to Mr. Workman for his suc- cessful managing of the club. It is to be hoped that each year will see a larger Orchestra and a better one. That some day in the very near future we will begin to see the music room at F. N. S. where the Orchestra and Glee Club will at last have a home of its own. 013131: xpetimental itcben -.. - ' J -N 'ff If r ll ff 7, ' . Every Normal girl knows that the Experi- mental Kitchen was founded several years ago for the use of the Household Arts girls in their experimental school work, usually connected with chemistry. During the last few years, however, that idea has become partially submerged under the more popular one that the X. P. K. just fine-you could get a key any time make candy-for salesfor soldier boysg you could make a cup of cocoa if you were a reg- ular and had to wait for a late train .out of Framg you could iron an apron that just had to be done somehow or a waist that must be passed in tomorrow, and so on. Of course the idea of experiments hasn't been given up altogether. No one would think so if she saw some of the baked potatoes, rows of little custards. fudge lgrainy or salvyl, baking powder biscuits which would bound and rebound without a dent, or any one of a dozen other uexperimentsf' The only ob- jection we ever had to the X. P. K. was that with ten or twelve girls wanting to cook there at once, the kitchen wasn't half large enough. What fun we had last year making candy in the X. P. K. for Mr. Howe's dogl Witli what patience girls beat fudge with first one arm and then the other. or with what care dropped the mixture in little mounds onto the waxed papers! Can one forget soon, the peanuts we skinned and fried for our candy sales? WHS and When we were Juniors, Helen Seavey and Marian Bodhsh were on the Junior Committee. Then when we rose to the position of Middle .luniors and took charge of the X. P. K. Marian Bodfish was chosen presidentg Betty Knight, vice-presidentg Helen Seavey, secretary, and Marian Delano. treasurerg Betty Davenport was Senior adviser. Marian had her hands full thinking up ways by which to earn money, and keeping track of keys which were bound to dis- appear. Betty took a walk every morning and often returned laden with boxes and packages for replenishing the stores. After putting up her set of rules for the proper use of the kitchen, at the beginning of the year, Helen was quietly busy with her secretarial duties while Marian learned what it meant to collect bills. The housekeeping was assigned to two girls at a time who were responsible for a week for the order and cleanliness of the kitchen. l think every girl felt that she had practice enough in clean- ing a stove by the time her week was overg and as for the floorfwe hope that it will be easier to keep clean now with the new linoleum on it. This year the kitchen has been used very little. In December it was closed, that we might help in that way to save coal. The ofhcers this year are: Olive Foster, President Hazel Fairfield, Vice-Presidelzt Dorothy Murdock, Assistant Vice-President Priscilla Colby, Secretary Doris Nelson. Treasurer Hazel White. Senior Adviser. One day when planted some ivy we were Middle Juniors we by the side of the X. P. K. We hope that the vines will grow and cover the little house, symbolizing our loving interest which will always remain with the little kitchen and those who in the future will use it. lamb: at og 223 ' 'ff ' 1 'Director, Miss Abby S. Perry President, Marion Page Secretary, Nyllis Gardner Treasurer, Helen Parkis A chapter of the National Lend-a-Hand Society was started here at the Normal School many years ago by Miss Perry and still remains under her careful guidance. The meetings are held every Tuesday ,afternoon in the "lighthouse,', the use of which was given to the club by the late Miss Alice Macomber. This year the club has meant more to the girls than ever as it has been a true lighthouse during this winter which has brought us so many new problems. Many of these have been solved through the question box by Miss Perry, who has given us such a broad vision in her whole- some and inspiring heart to heart talks. While the girls have listened and joined in the discussion of the present day problems, books, and topics of current interest their hands have been kept busy with knitting and making of surgical dressings, sewing for the Boston Floating Hospital, dressing dolls for the "Children's House" at the North End Union, and making layettes for French babies. The club also has a room at the Framingham : itaanh Hospital which has needed very little attention this year because of extensive repairs and re- furnishing done last year. There are sixty members in the club, who wear the crystal heart and practice their two mottos. 'Through love to light" and "Look up and not downg Look out and not ing Look forward and not backg And lend a hand." E. E. HALE. 2 A .i Ziaistnrp uf the 6 0 O 0 W", a When that much talked of Billy Sunday came to Boston during the winter of 1917, we wanted to hear him, so a group of girls went into the tabernacle one evening in December for that purpose. We liked him so much that we planned to go again in January. This time Mr. Meier arranged for special cars to take us. there being fifty of us. To say we were much impressed with Mr. Sunday and all that he stood for would be putting it mildly. We "hit the sawdust trail" and shook hands with the noted evangelist. On the way back, those who were fortunate enough to be in the same car with Mr. Meier had the privilege of hearing him "preach a ser- mon." He put into words what each and every girl had felt after listening to that famous man, namely that there was something lacking in our school life on Normal Hill. Mr. Meier asked, "Why not have a club that will meet Sunday afterno0ns?', We asked ourselves, "Why not?" The result was that we did organize such a club, and at first used to meet in the Assembly Hall, then finally in Crocker Hall Parlor where we spent a quiet half hour together. The outcome of these meetings was the feel- ing for a Student Young Women's Christian As- sociation. Miss Helen Farquhar, student secre- tary for the Northeastern Field, came to us the last of March and helped us organize. The girls who were interested met with our guest while she explained what the association meant. Then, at another meeting, we elected our oflicers. They were Beatrice Burr, presidentg Bessie May, vice- presidentg Marion Keep, secretaryg Marian Bod- fish, treasurer, and Rachel Vaughan, annual member. These officers formed the cabinet which met that evening with Miss Farquhar to hear what their duties were to be. She told us that the ideal of our association was Jesus Christ and its purpose was to help girls to become better Christian women -by'-personal contact with Him. She showed us how we, as officers, representing that Ideal, should live so that we might help others to know Him. The wonderful personality of Miss Farquhar and the message of love and service she gave to us that evening have ever been a source of help to us. The chairmen of the different committees were chosen. These were also to be a part of the cab- inet. They were Marion McLellan, social ser- viceg Bessie May, membershipg Elizabeth Knight, missionsg Dorothy Murdock, publicityg Helen Parkis, programg Marion Page, conferences and conventions, and Gladys Leonard, social. The Social Service Committee have done a great deal. They started work on fracture pil- lows and convalescing gowns for the Red Cross, and in June put out bags to collect articles for the Morgan Memorial. In the fall they started us at work again knitting for the Red Cross. At Christmas time, we were trimming Christmas trees and doing up presents for children in the 96 THE DIAL village. A few girls made some little pies and took them along with some fruit. candy, and a Christmas tree to Johnny Farrel, the little man at the Maple Street railroad crossing. We also packed cheer bags for the soldiers. The Social Committee planned uhikesf, We have been to Violet Hill, the quarry, had a bacon bat on Nobscot Mt. and a corn roast at the other end of Grove Street. The Conference and Conventions Committee earned 3100 in the spring selling refreshments about the campus and in the lunch room. With this money we were able to send four delegates to the Silver Bay Students' Y. W. C. A. Confer- ence on Lake George. The delegates were Beatrice Burr, Rachael Vaughan, Marie Lewis, and Doris Harmon. The Mission Study Committee started special Sunday School classes in most of the churches for the F. N. S. girls. ln one of them Fosdick's "Manhood of the Master" was studied. The Membership Committee was busy during the summer sending to each of the upper class- men the name of a new girl to write to, wel- coming her to F. N. S., so that the latter would know there was one at least, ready to receive her. Were the ,luniors lonesome or homesick those first few days? Ask them! In the fall a large membership campaign brought our number up to 200. The losing team gave to the winning team a children's party at which we all enjoyed our- selves immensely. Being such a young organization we were very much honored at having the Cabinet Training Council meet at Framingham. Simmons, Boston University, Emerson, Mt. Ida, and the Conserv- atory were represented. There were many fine speakers there, Dr. Richards of Boston, Kyle Adams. and Marie Bashan, an Armenian girl, being of the greatest inspiration to us. We have had an association meeting every week on Wednesday and have always had fine speakers. Our Vesper services on Sunday evenings at 6:30 have been a source of great help and pleasure to us, and we shall never forget the quiet influence of that half hour, where, led by one of our own girls we have felt the higher spiritual things, which, after all, are the only ones that really count. The Y. W. C. A. has done much for the girls of F. N. S., for it has, in many cases, brought out the very best there was in a girl, which seemed to have been sleeping all unknown to her. We have never reached the height of our Ideal, but shall always, even after we have left our dear Alma Mater, keep on striving. As Franklin says, "We are better for the attempt than if we had never tried." We, of 1917-18 are very proud to have been the charter members of such an association, and to its future we wish long life and happiness. May the spirit of helpful service, the spirit of our Ideal, never die out, but become ever strengthened by the years. x 11: nrn 5 npn 'gsqypq 'nga 4 ' -1sma,:ax.'32.4"-'tt4. tx-rea :. 9223312 ' nys QE!! f Ol.,Q lywvbotr hiv'-I 'ia 'QA f1'sf'- x' ,1. ,g' fu x-6 , w ' -7 f2:,x.f .1 - ' 5, -'15 ' 9 X . vb".-f 'Q 5, Ax, 41 3' Q- 8 sd-JQQSZ' 9-gl 'ii' , ... ..... ......... ff ,Q Vfjd X f-tgK4l f ll-F' I I W , 1- f ' 'F . Ks? A F' ' -C3 his s N ' .v .- la, - I T 3 'Sz -?' " T T nuff", .k .,A,. --g.-,..., In December Mr. Ried talked to our Senior Class telling us that in previous years the school had had a Fine Arts Club. The aim of the club being to have for its members only those girls in further the Senior Class who wished to gain knowledge in the fine arts. He asked us to think it over, and if we decided to have such a club, to tell him. We organized in March, rather late yearg still we hope that we have done it in such At our in the a way that the club will be permanent. first meeting we chose Helen W. Seavey president, and Dorothy E. Pickard secretary and treasurer. We also decided to have an entertainment com- mittee. Their work was to obtain a speaker for the first Wednesday in every month. Our first stereoptican lecture was one on "loan of Arc" by Dr. Hopkins, President of the Massachusetts Normal Art School. The meeting opened with a selection by the school orchestra followed by the "Star Spangled Banner." Then the Glee Club sang, "Keep the Home Fires Burning." Dr. Hopkins read a letter he had re- ceived from the girls in Chateau-Briand College only seven miles from the old home of ,loan of Arc. It was a beautiful letter and full of the feeling of France today. As further introduction he said that the only way to tell the story of .loan of Arc, and to tell it in an interesting man- ner would be to use the language she herself would have used. The pictures shown on the screen and the lec- ture accompanying them were so full of interest and so inspiring. As he flashed the picture of Joan of Arc on her white horse, holding the flag of France high, with her troops marching on to victory, the orchestra struck up "La Marsellaisev and the audience rose singing it as only a patriotically inspired group of people can sing it. The evening closed with a selection by the orchestra. The club will certainly be a great success if it continues as it has started. We sincerely hope that its future members will make the club more worth while than ever. Y r ! E ' asmpss ,g , f zswlmhill' 1 ' .a.....-.-, 4 i "iE.F:H'-2 Rev. Dr. O'Connor, Pastor Socielatis Kathryn Duggan, President Dorothy Sheehan, Vice-President Ellen Walls, Secretary and Treasurer. The Framingham Normal A' Kempis Club which is our youngest organization, was estab- lished in the fall of 1917. It is an outgrowth of several attempts during the past few years to unite the Catholic girls at Framingham in a club which would replace the girls' club in the churches at home. So it came about that the girls were called together at the rectory and there they organized and elected officers. At the next meeting the club name was chosen. This re- quires a word of explanation since few outside of the club know why the club is so named. Thomas A' Kempis was a prominent writer in the 14th century. His best work, "The Following of Christ" is a general favorite, which brings forth many high ideals. Selections from his writings were read at meetings through the winter. The club meetings were intended for good times as well as work and for a long time knit- ting and reading of books, suggested by our di- rector went on. Just before Christmas the girls filled and sent to "the boys over there" a num- ber of cheer bags. These meetings were held at the rectory or in Wells Hall usually under the direction of Dr. O'Connor. The A' Kernpis Club became known to Fram- ingham at a party given at the rectory during the winter. The people of the parish joined with our girls in a general good time. The shadow play, "Maw Jane," gave the girls a chance to display their dramatic ability. Many songs were sung and the Scotch songs were especially en- joyed which were sung by Dr. Chalmers, who with Mrs. Chalmers. was the guest of honor. The A' Kempis Club is still young but we have great hopes for it and we are sure that under Dr. 0'Connor's leadership it must be a success. A 1, fi M an JI my 0 Vw Elph Qituaa Mark Though we have notdefinite organization for War Work. a good deal has been accomplished since we started in October. Our two principle lines of work are the knitting and making of surgical dressings. The results are turned over to the Framingham Red Cross League. At present we have ten girls who are qualified to be monitors in the making of surgical dress- ings. Under their guidance, Room 7 is open three times a week for two-hour periods. Stu- dents and faculty alike volunteer their services, and though much has been accomplished, we still hope for more. Approximately 1,500 dressings have been made in all, about 250 bandages being a weekly average. The Household Art Seniors, in their dressmaking period, turned out 800 compresses and 20 tampons. Much knitting has been done by members of all classes. We have used 25 pounds of wool in the making of sweaters, helmets, socks, wristers. and scarfs. At Christmas time twenty well-filled comfort bags were distributed to soldiers. That these bags were a welcome gift to the men was clearly shown by the letters received. ln the practice department some of the sewing time is given over to Red Cross work. Under the guidance of our girls the practice classes have made over twelve dozen handkerchiefs, two dozen comfort pillows, and six dozen felt socks. We have 109 Red Cross Members in the school and are very proud of our one and only Red Cross Dietician. As long as the need for Red Cross work exists, F. N. S. will always do her part. Let us re- member that not only in war does the Red Cross need our aid, but also in peace, for quietly and gracefully her doctors and nurses perform their deeds of mercy among the needy. Let us hope that all the girls who remain here and all those who come, will put forth a helping hand to the Red Cross Organization. 1056 N L Y ,A i- Q 4456-Q'?F.lzS5J L If A Q , ' ' f 5 Xl I ' fx- . ' I 'w e ' Summvr Svrhnnl Glanning flllnurar Six o'clock on the evening of July 16, 1917, saw the majority of the summer workers on Normal Hill. We all intended to visit the Drug Store after dinner to indulge in chocolate "sodys" but Mr. Meier had a surprise in store for us. We were to report in Dr. Chalmers' garden and pull enough rhubarb to keep us busy for the next day. So, of course-we reported. We met our new principal's family in their garden and they all helped in the pulling of the rhubarb. Our Hrst day of work! Can we ever forget it? Organization took place in Crocker Parlor, after which we all went to work in the kitchen of old Normal, each having her own particular duty. The Chief of the Fire Dep't. found it pretty hot standing over a red hot stove! This 1 Q. 5 y . f if V , .4 ,' f 'f' . f 1 I so they recklessly took a three-cent ride to White's Corner and back all in the same evening. Another trip which found favor with "us girls" was a trip around Framingham which took in such sights as Camp McGuiness, the business section of So. Fram. and the main thoroughfare of Fram. Ctr. A scheming capitalist could take this trip for 3c by not paying her fare until after reaching the Junction. Anne's birthday gave an excuse for a cele- bration. Even Miss Prouty became interested in the secret preparations. The birthday cake was a work of art but why oh why do certain species in the animal kingdom have a fondness for icing? Nevertheless none of it was thrown away. Blanche met with what almost proved to be an xf' A , A L 'Efjiiii-' Q .l ii - , -T- e S W W jr' I' ' ' first day was cool compared with some of those accident. To see her hand covered with gore following. Dr. Chalmers came up with his family to visit us during our working hours. From canning rhubarb we went to gooseberries, making jelly from some and canning others. Currant jelly came next and then beans-never-to-be-forgotten -beans. In the hot sun we went to the garden, picked and prepared them for canning to the tune of our bean songs. Strawberries, nbeets, blueberries, lima beans and other fruits, vege- tables, and jellies were prepared for use. To relieve our tired minds and bodies we went to the movies. Shall we ever forget Saxonville or its Queen? Others preferred to see their own country first was a sight to instill fear into any human heart but our fears were allayed to find it was only catsup. -Before making another trip to our re- frigerator you may be sure she took no chances, she found out the exact location jar. Our trip to Nantasket! If we of the amusements down there, it was because they were closed for the day. The sea-lions will never know how near they came to getting human food for their evening meal. I wonder what caused the great discrepancy in the amount of walnuts in Crocker pantly? Excitement! Miss Prouty discovered that her perfectly good can opener was gone, nothing is of the olive slighted any Framingham State Normal School 103 safe around here! In the midst of our course Ray left for Lenox. From then on, our watchword was not "Where do we go from here?,' but "On to Lenox thru' Podunkf, Lake Chauncey is very appealing during the hot weather but beans come first so a business- like spirit pervaded the Hill in place of the friv- olous one. Mr. Meier arranged a swimming party for us and we took our lunch down to the Sudbury. We erected our own tent but our esteemed chap- eron and several others preferred their own not always indicate the approach of man. When Blanche had the evening off and was unable to plan the refreshments, many a quart of ice cream found its way up to us. We had one newspaper reporter. Conscientious Grace sat up in the small hours burning the midnight candles while she wrote her items and good they were. Fly catchers even though thoroughly sterilized are not appropriate for straining tomatoes. Think what we could have done with those ten quarts of tomatoes if they hadnit been thrown away. Day by day we increased the number of jars K 1? 141. private bathhouses. After returning from our swimming party we slept out under the stars. Said Debby in the dark, 'gl didn't like to sleep out doors nights, my feet seem so far from my headf' Miss Fernald, because of her good conscience, stuck her head out the window took the roll call every two hours. Irene, desiring to be exclusive, chose her bed petv came to and faithfully up in the grove. A "woodland keep her company so she fled like a white ghost down to the rest of the party, leaving her slipper behind as a souvenir. A rustle of leaves does of string beans until on one banner day we broke the record and canned eleven bushels. During our last few days we exhibited our canned goods in the front rooms of Normal Hall. We were proud of our three weeks' work and many were the compliments given to us by our visitors. We stored all our goods for the winter, carry- ing most of them to the storage room in the New Dorm. To make a good and memorable closing we had a party Thursday night, with Mr. and Mrs. Meier and the girls for our guests of honor. And so to the tune of the Bean songs let's 104 THE DIAL draw the curtains on our three weeks of work and play. I. Beans for breakfast, Beans for dinneig Cold baked beans for tea, Oh how I wish I were a bean How happy I would be. II. Beans for your breakfast, Beans for luncheon Beans for supper time. Pick beans, wash beans, blanch beans, beans, pack Beans rain or shine. We never can ham, chicken, or lamb, Sad as it seems, I love my school but I get so sick of Canning beans, beans, beans. III. To:-"Where do we go from here?,' Where do we go from here, girls? Where do we go from here. Any place from Podunk to Lenox over there. Lake Chauncey seems so awfully swell But-canning beans just make us yell Oh joy, oh boy! Where do we go from here? CANNING SCHOOL ANNEX How deserted and lonesome Crocker seemed after our co-workers had left us leaving only four behind. For a while we feared no dinner was forth- coming, but after a few hours Miss Prouty, out of the goodness of her heart, even forgave us for stealing her private bar of soap and gave us some dinner. We felt of great importance as we ordered our supplies at the Centre stores. Our work for these two weeks consisted in making jellies, using the drier, planning and trying out bean recipes. We prepared our own meals and lived in high style. The sound of the telephone ringing awoke us from our slumbers. We shook, fearing calamity. It was merely a future candidate for entrance to F. N. S. looking for information at 11:30 P. M. As a chaser of mosquitoes, Nyl can't be beaten and even a pillow comes in handy when nothing better is at hand. If you hear and can't see them, light a lamp and pursue them. Our peace of mind was disturbed for a few days when the men took up some floors in old Normal. The rats came down in force to visit us. Hot water and stamping of feet was not effective. Even level headed Jenny was scared of them and spilled 7 lbs. of jelly on the floor. The day Mr. Meier went to Boston was a memorable one for us. Jelly, if allowed to boil hard, will boil over and if enough heat is at hand, will catch fire. When such a thing happens ask .lenny why you should not throw cold water on the flames. One afternoon we laid aside our work to at- tend Miss Halbower's Lecture in So. Fram. Framingham State Normal School 105 Over the week-ends we prepared for the com- ing week by washing our uniforms and aprons. Never try to say your prayers while awaiting your turn at the ironing board-then the watch- man's appearance in the kitchen will not prove embarassing. Again we sought recreation at the "movies,'i but our attention was not alwa'ys on the screen. The new styles in hair dressing for men are often displayed when one least expects to see them. We were honored by having Mr. and Mrs. Whittemore and Mr. and Mrs. Meier to dinner one day. We had worked hard to prepare a good meal and there's no doubt but we all en- joyed it. We gave another party for the Meier girls and one night we had Miss Prouty for sup- per. We had the big front room in Normal for our dining room. After dinner we enjoyed our short rests when- ever opportunity let us. Miss Prouty proved a faithful mail carrier and she was especially thanked the day she brought the cake that Anne had sent to us. Mr. and Mrs. Meier invited us to their home one night and we had a delightful time. "Noth- ing but the Truth," was in vogue that night as we entertained on Crocker porch. This was fol- lowed by "See yourselves as others see you." 12:30 A. M. has no terrors for some young men. We found by experiment that whistles mean much more at night than in the day time. Let us hope in the years to come we may sit on Crocker porch and hear incidents of life in France to take the place of those of the West. Our work was over and we were to separate for the summer. Mr. Meier kindly braved rain and mud to carry some of our bags to the sta- tion. Nor was he the only gallant on hand. As a future hint: When riding on the Boston and Worcester cars, be sure to carry your car tickets as they may come in handy. lf possible, provide shelter for your new friends as well as for the old. Here's to the two happiest weeks we've ever spent at F. N. S.! Mihhlr Junior lawn When we started as Juniors, we numbered seventy-eight, and, although rather shy at first, we were soon made to feel at home by the wel- coming smiles of the older girls, and their friend- ly calls on the first lonesome week-end. lt did not take us long to become accustomed to the routine of work, and soon we were suffi- ciently settled to become a class. With the help of Mr. Whittemore we organized and elected Marion McLellan president, and Bessie May, secretary. We were introduced to the X. P. K. by the Middle Juniors at a series of teas, and found it a very useful place. Dorothy Murdock and Hazel Fairfield were our members in the X. P. K. association. Social affairs were quite popular,-both those given to us and those which we gave. The Faculty, the Seniors, and the Middle Juniors all made us feel at home by entertaining us at social affairs. We were eager to do something our- selves, and so gave the Middle Junior Class an intercollegiate track meet which was very suc- cessful. Then came the circus for the Seniors, and if smiling faces are a sign of enjoyment, the Seniors certainly had a good time at our Podunk Circus. When it came time for the Yale and Harvard game and the Christmas party, we were eager with expectation, and in both cases it was better than we had anticipated. It was well worth the suffering of the cold to stand out- doors and watch the Seniors enjoy their man dance. How many of us wondered if we should ever reach that height! We Juniors worked hard selling pencils, and, with the help of the students and the Alumnae, we raised 3108.10 for the Amelia Davis Fund. With all the gay times the year passed quickly, and we Juniors were made use of in many ways. When we returned in September, we numbered but fifty-seven, and we made up our minds that what we lacked in quantity we would make up in quality. It did not take us long to become settled in the New Domiitory, and soon we were back in our regular routine. Our class ofiicers for the year were Dorothy Miner, president, and Vivian Richardson, secre- tary and treasurer. Our social life soon commenced, and after having entertained the Juniors at teas in the X. P. K., we turned all our attention to the Soiree. The hall looked very pretty with our bluebirds and pink boughs, and we made thirty-three dol- lars for the Whittemore Memorial Fund. We were nearly as excited as the Seniors when it came time for their man dance, for it is the Middle Juniors who serve for them. With envy and longing we watched them dance and thought how long it would be before we could have such a privilege. There are no words that can express our feeling when Dr. Chalmers announced that, as the Household Arts course was three years and the regular course only two, it was but fair that the Middle Juniors should have a dance. The Middle Juniors to have a Man Dance! We could hardly believe it, and yet, while we scarcely dared believe our ears we were, in the back of our minds, planning whom we should ask, and what we should wear. It was a splendid dance and such a good spirit of fun and sincerity pre- vailed! We can never thank Dr. Chalmers enough for our man dance, the first that the Middle Junior Class ever enjoyed. Our play conunittee has chosen "The Piper" by Josephine Preston Peabody, and we are work- ing to present the play early in May. Some of our biggest and best things will come at the end of the year and must be saved for our class book. Framingham State Normal School f Zuniura How happy it makes one feel to arrive at a new school and feel she is really welcome! Where is there a school which extends to its new mem- bers a more friendly welcome than the Framing- ham Normal School? With this wonderful spirit of cordiality and friendship and with some of the most beautiful scenery to be found in New England surrounding us, we Juniors were filled with the inspiration to so work and live that the school might ever be proud of us. Our class numbered one hundred and twenty- five. It was our privilege to begin work in the school with the new principal, Dr. Chalmers, and so we shall always take pleasure in feeling that he is one of our number, and do our best to live up to the ideal that he has set before us-of work, cooperation, and happiness. Early in the year our class organized, electing Ruth Kunhardt for president, and Phyllis Winkler secretary and treasurer for one-half year. Then, as the class of 1919 and ,2O, we immediately did our "bit" by buying a Liberty Bond. From the the faculty first day the upper classmen and did all they could to drive away those haunting feelings of homesickness, and to give us a good time. The first Friday night the girls at Crocker Hall gave a "get acquainted" party. We were highly entertained by the antics of Romeo, Juliet, dancers, and several beautiful dolls. Later, the girls in the New Dormitory gave a dance for us in the gymnasium. Although we Juniors wore green ties, it did not hinder us from having a most enjoyable time. The Middle Junior teas gave us an opportunity to get acquainted not only with the girls, but also with the X. P. K., Dr. and Mrs. Chalmers and the Faculty entertained us at a "War Party," and what real pleasure we took in capturing German towns, and sticking pins into the Kaiser! At the party given us in May Hall by the Seniors, we proved ourselves to be real wild Indians who were on friendly terms with the kindly Puritans, the Seniors, and in return for their kindness, we invited them to a Yachting Party. One fair night in January the yacht, filled with sailor boys and girls, set sail in May Hall Ocean. The big feature of the evening was a vaudeville show. What excitement there was behind the scenes when we learned that one of our most im- portant characters would not be able to perform! She had hurt her knee, and was lying on the basement floor in white flannels, blue jacket, green tie, and a facial coat of burned cork, all of which transformed her into a real ,Rastus. However, our class did not dispair, but found a substitute, and the entire performance was given. Our sailors danced the hornpipe better than it has ever been done before. Minuets and songs hy professionals were fine. In the pantomime, how sorry we felt for the poor man who tried so hard to get a wife! We prided ourselves on be- ing able to show our guests a child who grew into an old woman before their eyes. For the closing act Mrs. Blake's' Black Beauties per- formed. They displayed the latest costumes im- ported from garrets and ash cans as they sang the new Southern songs, danced clog dances, and told jokes and stories. When, at half past nine, the yacht returned from its voyage and the voyagers disembarked the salty breezes wafted back to us many expressions of great enjoyment. Having completed our first half year, we are now setting forth on our second term's work. At our first meeting of the new term we had our second election of officers. Sarah Cuslunan was elected president, and Margaret Harmon sec- retary and treasurer. That our class may be as good a class as has ever entered the school is the wish of every Junior. We have all tried to do our best, but we are not going to stop there, for we are going to "Do to make the best better." W J PH HSDPLS 76 JBasket JBaIl As Thanksgiving time drew near everyone was on the alert for the "Harvard" and "Yale" game which was scheduled for November 211-, the Sat- urday before the holiday. At the beginning of the basket ball practice in the early part of October, Esther Preble was chosen to captain 'LYale's" team and Dorothy Murdock "Harvard'sf' A week before the game the teams were chosen with the following line- up: Y ale. H arvard. Susan Shearer, f. f. Hazel Sprott Esther Preble fCaptl, f. f. Elizabeth Goodwin Dorothy Miner, c. c. Anita Gregory Alice Carroll, s. c. s. c. Louise Nightingale Marion Keep. g. g. Bessie May Marion Armstrong, g. g. Dorothy Murdock1Capt.P 'cThe night before" the air was thick with ex- citement. Great plans were made for putting up banners on the piano side of the gym. A party of Harvard supporters remained in the gym. after their final practice was over at 8:30 P. M., and patrolled the place in the dark. Some of the girls from Stone's came up as a flanking party about 10 oiclock and as Yale spies were posted all through the buildings and tunnels, the party came in the window and down a ladder into the gym. All was quiet, suddenly a re- flection was cast on the ceiling from the 'abugn lights of the Yale scouting party. Then darkness and quiet reigned once more. Again the alarmg this time from the inside and all at once, headed by "BU Burr, a Yale attacking party came "over the top" into "No Man's Land." They made for the doors of the gym, behind, and in which were stationed a dozen "Red Supportersf, Several at- tacks were repulsed, when, with a concerted movement, there was a rally and the "Blues" got in. Dancing was started to Hll in the time be- fore midnight, but about ll P. M. one of the matrons appeared and sent all of them back to bed. So the next morning the two captains tossed up and Harvard won the piano side. The 24th dawned bright and clear. finding all in high spirits. At last it was time for the game to begin. Framingham State Normal School 111 The teams were in their places, all was in order. Then Miss Leslie Perkins, our impartial and matchless referee, stepped forth, calling in a clear voice, "Referee! Timekeeper! Linemen! Scorers! Captains! Teams! Ready? Play! The fight was on and fight it was from the word NGO." The teams were well matched and each had a fighting spirit. The supporters led by their most able leaders "Ray" Vaughan and "Denny" Haskins, did such noble work that one could hardly hear himself think. Even the whistles of the linemen were scarcely audible above the din. ln the meantime, Sue Shearer was gaining a reputation for the ease with which she made baskets from all parts of the field was most remarkable, to say the least. She and Yale sat down together to a dinner fit for a king. The teams, according to custom, occu- pied the places at the tables on the platform. From this point on until one marched from the dining hall, the toast mistresses had charge of the evening. Toasts, cheers, songs, and speeches were intermingled with the other good things. But the banquet finally came to a close, as such things have a way of doing, so we adjourned to the gym where dancing, cheers, and songs were enjoyed until half past nine. THE "SUB" GAME Yale sub-team, challenged by the Harvard 'fSubs" set the game for Monday. Dec. lil, at E fm . 2. VV.. ill -MQ ff' certainly was the star of the game if one were to be chosen. All too soon did we hear the final whistle and then the announcement, Yale 32, Harvard 22. For another year all was over but the cheering. One must lose for another to win, and Harvard accepted the defeat with good spirit. Dr. Chalmers, who with his family was present at the game and at the dinner following, remarked that it was the hardest fought game of basket ball he had ever seen. After the game, followed the banquet, held in the dining hall of the New Dormitory. The signal given, the march around the tables began. The Yale men with the winning team entered last, following out the usual custom. There, amid the simple though delightful decorations, Harvard 4:15 P. M. The line-up was as follows: Yale. Harvard. Ethel Dow, f. f. Fannie Katzew Marjorie Skinner, f. f. Ellen Brennen Ruth Kunhardt, c. C. Elsie Eagen Gertrude Shea 1Capt.J, s.c. s.c. Olive Foster Estelle Crowe. g. g. Alice McCool Isabel Breckenridge, g. g. Etta Buckley 4Capt.P Miss Shepardson served as referee. One would hardly expect the sub game to be as exciting as the regular game, but still it furnished several thrills. Both teams put up a good fight. When the final whistle blew, the score stood Harvard 15, Yale LO. be Eennis In the fall of the year when the tennis court was never lonesome. and buoyant, youthful spirits were at their height, the terrible contagion of tennis fever came to a climax with the announce- ment by Miss Shepardson, of a tournament. Thirty entries were made, and then came the ex- citement of knowing who was to be one's opponent. We played those games off at the queerest times, at 6 o'clock or 6:30 in the morning, be- fore breakfastg at 8, after breakfast, or during the afternoon. All through the games one felt strange qualms at what one might meet farther on if Fate spared one elimination from the tournament. Gradually some were dropped out and excitement became tense. OI.ll'l'lHl116l1t At last, the semi-finals came with Sam Arm- strong and Bee Burr fighting for existence. Bee reigned, with scores, 6-1, 6-0, 6-0. And then- those finals, played before breakfast with Dot Murdock and Bee on the court! Bee carried off the game with 6-3, 6-3, 6-4, but, I'm staking my hat on Dotty another year if she could come so close to Bee. In Assembly, a week later, Miss Burr was pre- sented by Dr. Chalmers with a silver cup, the trophy of the tournament, accompanied by a few words on the joy of victory in athletics. Do you think we losers were sorry we had en- listed in that fight? Never! Even if we didn't win we loved the thrills of the joy of the game, and the feeling of good sportsmanship. Qld , ,f- I 'ff -- M x .t.,' In a room that is in Wells Hall, At the foremost end of Normal, We spent many an hour in drilling, Marching, forming and in dancing. In this room of booms and baseballs, Room of ladders, and of ball nets, We went through those long day's orders, Through those orders that so vexed us, Vexed us when we had to teach them. For 'twas then our teacher marked us, Marked us high, or low, according To the way in which we gave them, And the way the class responded. After all the drills and dances, We girls were supposed to gather In our gym towels, and bath caps, Ready for the cooling showers, For the showers that should rest us. But not always did we do such, For there were some girls who objected To the showers that so refreshed us, And out from their lockers went they Gym To a room far from the gym room, Where they rested from their hurry, Rested there until the others Joined them, ready for the next class. For the next class on their program. Now, not always in the gym room Did we drill, or dance, or play, But instead, with bats and bloomers, We proceeded to a meadow, To a grass grown field, or meadow, Where we showed our skill at baseball Showed that girls as well as boys Could enjoy the game of baseball. When in later years we think back To those dear old days at Normal, regret the days we faltered, we faltered and forgot drills. wish then that we had listened more patience, to our teacher, We'll Days Weill With As she gave us helpful judgments, On those lessons that we taught there. a-:"-:Z gpg 'lub qfl-2 ra-v YW' 1 I -:3:I:- ' W ,. --ni my Q ',1.:.j.' '-2 Qh P X, D A .iv ' be 1Regular curse I. Oh, there are a great many subjects Assigned to the "Regular" class. In hopes that we'll all make good teachers, And uphold cherished hopes of the past. II. We're glad we're not Juniors this year, For Gardening hours are long, But worse than that is our Music When we're called on to teach a song. III. A little of Sewing and Cooking Are found in the "Regular Course." But English is that which will teach us The right way to write and discourse. IV. Arithmetic, History, Drawing Are all of importance you see. In Writing apply Doner Method, And don't slight 'gBugol0gy.,, V. Geography teaches us place names. Psychology how to think right. To keep us well versed in world news, Current Topics we study with might. VI. The teaching of Reading is hard, too, But a course in Methods solves this. While Hygiene is strict Sanitation, And "Gym" we surely won't miss. VII. For studying favorite authors, "English Liti' is what we've enjoyed. School Management starts us to thinking, While Education keeps us employed. VIII. As Juniors we had two more subjects, The "like of which cannot be beat." There was Handwork and General Science, And that makes this whole list complete. SENIOR A Attention! my classmates, and read today Of that group of girls in Senior A. Each day, every month, and so thru the year "Renew Bennett is always the first name we hear. She is slender, and small, and ever so fair, Not a day goes by that she is not there. Who comes to the rescue when deep silence hangs? Why, L'Mardi', hops up and shows off her bangs. Claire Kennedy next, expressing thots rare, Soon has all out of the depths of despair. Edith and Jessie, preordained so by Fate, Upholding class dignity, keeps us sedate. Helen made herself famous in Science one day, "Go right on, Miss Moran," Mr. Meier did say. Many seemed to be artistsg only one proved to be, Look at Gertrude's Prize Poster, and then you will see. Louise plays the piano. Our singer is "Vic," Marguerite and "Gibby" in athletics are quick. Our Bessie and Ruth are tall and quite dark, Come early, leave late, and are making good marks. Did you know that E. Grogan is one of the kind Who studies so hard she may hurt her mind? That Claire and Helena have interest afar For they always run for that 2:30 car? That Marion and Mildred, the inseparable pair Study together at night as oft as they dare? "Betty" Fahey lives up in the dormitory new, When she's here week ends, we never get blue. E. Duncan and H. Bent having lessons prepared Walk into class without looking scared. Do you hear Madalene with her answers debate, Undecidedly pause, and oft hesitate? But Ethel is quick, and knows what to say When reciting in History, for that's the right way. "Dot" Pickard is an "all around" girl at her best, And all that she does, is done well and with zest. We're called the Smart Seniors A, we gladly confess, But whv that nickname, we leave you to guess. Framingham State Normal School 115 DIVISION B Gather near all Juniors Come and listen to me For a tale I would unfold Of the girls of Division B. Rose Bertorelli is quiet One we're sure will succeed, For she's efficient in action True blue in word and deed. Anna in classes is sober And speaks and looks very wise Outside of classes she's carefree And never believes in sighs. Margaret Kenney and Edna We must never separate Such close friends are they That they must meet at eight. Anna Dunn and Mary Eagan Are the babies of our class But you would never guess it So business-like each lass. Esther Pendleton and Ebba Deserve a verse each one For a jollier pair of pals Can't be found neath the sun. Fanny Katzew excels in history In English Margaret Fealy's the star For a better all-round girl than Edith You'd search both near and far. Esther has the strength of convictions A fact we can't gainsay And to see Hazel Sprott play ball ls a treat we can't have every day. 6'The Heavenly Hills of Holland" Is Mona's Waterloo While Ethel's motto is "To see, to try, to do." A careful and conscientious student Ella MacNear has proved to be But teaching will not hold Ella Is the humble opinion of me. We send our best wishes with Evelyn And we're sure she'll succeed For a girl with grit and dignity There always is. and will be a need. Why bless us, if you want to see Bessie ,lust step into the Science classes For Bessie's an authority on cows, In this she all others surpasses. When classes are dull then Miss Lewis Who appears to be quite dignihed Arises with visage serene And elucidates far and wide. Mary Monahan is not heard very often When she talks says something worth while, While Ellen is a girl we all like, And Mary MacEvoy is a girl without guile. And who of us can forget Viola With her sense of humor so droll, And Enid with courage undaunted Rushing wildly on to her goal. Gertrude Selloy and Mil Failey Although almost left to the last Will call to our memories always The light hearted days of the past. Becky was not born to worry But always has lessons prepared, While Alice, quiet in class Outside has ideas to be shared. This is a tale that will show All Juniors who follow our lead The road that they must travel To be professional in word and deed. 116 THE DIAL 1 .rfa 5 . Inst! Strapehl ivtnlen! Everything is very quiet in the history room until 8:45, when Miss Creenough breathlessly makes her appearance. She comes to her desk, and after recovering her breath begins, "Where are my keys? I know I brought them with me today. What shall I do,-I cannot teach a single lesson without my outlines. I simply cannot do a thing until I find them." The keys soon ap- pear and all is well for a few minutes. Louise Brennan then calmly announces missing one "Thwaites," one "Bourne Si Benton," and one of the priceless "MacDonald's Charters." "There now, Louise, you must not let those girls have books unless they can bring them back when they should. I cannot tell how many val- uable books have 'evaporated' since I have been here. They were all Lworth dollars' and many can never be replaced. There's Martin's 'Evolu- tion of the Massachusetts School System' gone,- who knows where? That book is out of print and cannot be replaced for 'love nor money."' Louise then quietly ventures, 'Tm sorry,-Miss Creenough, I'll see if I can't find them for you." Then she disappears. Miss Greenough thinks she has gone to look ,for the books. Louise thinks diHerently. By this time Miss Greenough, exhausted has fallen into her chair, only too soon to resume her everlasting accusations. One thing I am always glad to hear Miss Greenough says, and it is this, "My Seniors are the best class that I have ever had. I have never known of a book being taken by one in that class. It's those Juniors,-but they will probably learn by next year to distinguish between 'mine and thine.' " At 3:30 P. M. it is not uncommon to hear Miss Greenough wailing again, "Where's Louise this afternoon? I haven't seen her since early this morning. Where can she be?" She calls out to everyone who goes by, "If you see Louise send her down to me." And in this way she rambles on. At 4:30 Louise comes into the history room once more to listen to long dissertations on the lady's trouble. "Have you seen my flower pot? It's only half full of dirt now. What do suppose has become of the rest of it? I've just got to have this stopped,-and I'm going to talk right up to those Juniors today. Whenever they want to build a fort they just take a handful of dirt out of my Hower-pot." She next holds up a miniature straw matting house which is almost falling to pieces, "There you see, when anybody wants Xa pin they just drop in and take one out of my house." It seems as if she had been picked on -enough, -but no. She walks over to her desk, and look- ing at the top it, she drops into her chair, and in a fitful rage exclaims, 'LOh my, oh my,4my own personal property,-that desk I paid 'dollars' for,-just to think, some girl has stood up on it to look at that map. Big shoes,-big nails in them." "Oh dear,"-and at 2:40 she races down the hall to get the janitor. In a few minutes both come back. Miss Greenough shows him you the marks that are defacing her property which is 'gworth dollars." The janitor has to put on his glasses to see them. and after casually glancing at them reports, 'sNot easily seen,-no harm done." Can you not, my reader, now more easily rea- lize why Miss Greenough is always rushed to death. Valuable outlines which she spent years in collecting, and books 'fworth dollars" are always disappearing. It is now impossible for one to go near the history room without seeing in flaring letters on the board, or hearing the echo resounding in the room Lost! Strayedf Stolen! Absent-Minded Madalene Hodges WHO'S WH6 AMONG THE Wittiest Brightest Most Class Class Most Most Best Most Most Most Most Class Class Class Done Efficient Pessimist Optimist Argumentative All-Round Looking Independent Artistic Musical Domestic Fashion-Plate Punster Bluffer Most For Class Best Sport Most Class Most Most Dignified Grind Obliging Dreamiest Sleepiest Most Enthusiastic Most Diplomatic Most Loquacious Class Flirt Man-Hater Most Attractive Class Baby Most Athletic whats who Esther Hayden Elsie Jenks Mary Eldridge Lillian Bruce Ellen Magnusson Rosemary Antin Esther Pendleton Ethel Sweeney Marie Lewis Helen Taber Louise Brennan Dorothy Pickard Ellen Brennan Helen Drawbridge Doris Harmon Bessie May Edith Swedberg Edith Jackson Elizabeth Grogan Margaret Fealy Viola Wetherbee Gertrude Selloy Marjorie Dean Mary Sanford Erva Kennedy Gladys Porter Agnes Smart Gertrude Mansfield Margaret Kenney Hazel Sprott REGULARSQ WHO'S WHO IN CROCKER Winiest Brightest Most Efficient Optimist Most Argumentative All-Around Best Looking Most Independent Most Artistic Most Musical Most Loquacious Class Flirt Man-Hater Most Attractive Class Baby Most Athletic Faculty Pet Most Domestic Best Dressed Class Punster Class Bluffer Done Most For Class Most Absent-Minded Dreamiest Sleepiest Most Enthusiastic Most Diplomatic Most Obliging Best Sport Most Dignified Grind yN,fQ 4 .,,,- ...g ,- ,MA ,- ,,,,... , K! 32:1 .A?l Edythe McKelligett Marian Bodfish Marion Page Olive Warren Evelyn Murphy Anna E. Corey Helen Seavey Dorothy Fifield Anna Corey Blanche Marcionette Dorothy Sheehan Kathryn Duggan Bethel Banks Anita Gregory Edna Barrett Marion Keep Beatrice Burr Harriet Lovering Dorothy Bush Marion Delano Rachel Vaughan Grace Carden Marion Chapin Frances Colesworthy Lura Cushman Louise Nightingale Grace Carden Anne Callahan Rachel Vaughan Grace Carden Deborah Russell AV'IcI SHOINHI EVIGCIIW illllihble Eiuniur Blap There will be a very important meeting of the Middle Juniors this noon, Wednesday, at 12:4-0 in room 41. Very important! Pleace all come. FRANCES KING, Sec. And so naturally we all went knowing that the big issue of the day was Our play. We were all interested and anxious in making our play even more successful than the one of the previous year. After much work on the part of our faithful committee under the leadership of our little HK" they succeeded in presenting to us "Prunella" or "Love in a Dutch Garden." One night soon after, "Keepie" read it to us and made it seem so good that we accepted it without any delay at all. At last the time for "trying out" came, on a Thursday afternoon I believe, in the drawing room. We all journeyed thence with more or less palpitation of the heart, some more and some less. We were all gathered in the Geography room and one by one allowed to pass through the door of mystery after having given the countersign. Here we were faced by the com- mittee, consisting of Miss Stevens, Miss Shepard- son, Mr. Reid and Nyllis. Then we proceeded with all the dramatic ability possible to impress the committee that we were the one particularly suited for that particular part we were trying for. In due time the choice of cast was an- nounced as follows: Prunella .... Plerrot ............... Scaramel, his servant .... lst Gardner .......... 2nd Gardner .... 3rd Gardner. . . Boy ............. Prim, her Aunt .... Prude, her Aunt. . . Quaint, a maid. . . Queer .... . . . . . . . . . Alice Oliver . . . .Anita Gregory . . . . . .Marion Keep . . . .Dorothy Bush . . . . .Ann Callahan . . . . .Helen Seavey . . . .Almira Palmer . . .Marian Bodfish . . . .Vivian Parsons Privacy, her Aunt .... . . . . . . . .Harriet Lovering Edythe McKelligett . . . . .Marian Delano The Mummers Circus Troupe Kennel ......................... Lura Cushman Callow .... ..... G ladys Johnson Mouth .... . . .Louise Nightingale Hawk. . . . . .Marion Anthony Tawdry. . . ....... Ruth Fernald Doll ..... . . .Catherine Shurtleff Romp ..... .... ....... H e len Parkis Coquette .......................... Anna Corey Tenor, a hired singer ....... Blanche Marcionette Love, a statue ................. Kathryn Duggan Learning of parts and rehearsals began imme- diately. Rehearsals twice a week, rehearsals, thrice a week, and then to rehearsals every other day, and twice a day. But it wasn't drudgery it was fun-especially when M- would come out with, "ls that my clue?" And so as time went on we gradually got our dramatic powers to working and the play progressed thanks to "Nyl." Now of course we realize that learning and acting a play isn't all that is involved in pre- senting it. After people worked just as hard as wc did, in making it a success. For instance, "Pagie" worked more than faithfully to make the stage so effective. Also Lelia as property man- ager, Ray' on costume committee, and Edith Ful- ler on candy committee worked hard. As the play progressed and May 18 was draw- ing near we realized the necessity of a profes- sional coach. We found her, in Miss Hayes of Leland Powers. She certainly worked and through her work made the play a success. Be- fore we hardly realized it the day of the dress rehearsal was at hand. Excitement reigned supreme. In spite of a few mistakes such as "Doll and Croquettev this final rehearsal was a success, and we felt encouraged. A sigh! Dress rehearsal over. Next the real thing, the thing we had been working for, our goal, was here, and in spite of the fact we felt confident, we almost dreaded the ordeal. Guests began to arrive. The hall was be- ginning to fill. Time was creeping on. 8 Framingham State Normal School 121 0'clock, 8:05, 8:10. The audience is getting im- patient. Clapping is heard without. At last the curtain rises disclosing a dutch garden scene, with three gardners at work cutting the hedge, etc. The boy speaks, "Oh, you naughty, naughty birds, now will you come into my garden and I'll kill you!" The plot of the play is very simple. Prunella is a little maid who lives in care of three prim aunts in a secluded garden. One day a troupe of mummers passes by and Pierrot comes into the garden. Here he finds Prunella and makes love to her. She, ignorant of the ways of the world, returns his love and is finally persuaded to run away with him. Later he deserts her, but finds he cannot live without her. He returns only to find she is gone. He buys her old home in hopes sometime she might retum. This she does after a few years. Everyone then returns to happiness in the reunion of the two lovers. One of the fascinations of the play was the piano accom- paniment very well rendered by Hazel White. Everyone did just great, to speak frankly-yes everyone--but I think Love, the statue demands special praise She it was who sat perfectly still during the whole play, and had very few words to say. If you don't believe it try sitting in one position, say, for instance, ten minutes. We had a most interested audience who applauded pro- fusely at the slightest provocation, and showered bouquets at many of the cast. From all that was said and done we concluded that our play was a howling success. A success it was in every way, dramatically, artistically and financially. Yes we were very proud of ourselves. Do you blame us? We, the members of that class ask you, who witnessed the performance, frankly, if you blame us. So our play was soon a shining example of that well known saying, "Gone but not forgotten." For weeks, yes and even today, one is quite likely to hear such reminiscences as these: "What do you think the weather's going to be?" "No, No. No. Do not waste time turning pages. Discover the whereabouts of the passage by means of the index placed in the book for that purpose." "Is this it? Can it speak as well?" "The man in the moon came down too soon And lost his heart to a maiden. With hunger and thirst, she burned his mouth And left him heavily laden." What I say is, "give me life." "Bread? Dry Bread? Oh, no." "Scaramel, I feel sorely tempted." "Always yield to temptation." "Then tonight." WEEKHEMHEEHREESHMWHHREFFQWEEKEQHMKHEH55 To Mr. Ried HCR your help in moments of dis- couragement: for the clearer under- standing of the Work that lies before us, and for the realization of the beauty of the everyday world that you have instilled in usg for the personal interest you have taken in making of us true teachersg for the enthusiasm you have shown, and your efforts to make successful our every social affair, We wish to express our sin cerest appreciation and gratitude. '33 '33 HHHHEHQHHHEHHHHEWSHKEHHKHK555555 Ebe Ilbinstrel Show On April 12, 1918, occurred the famous Minstrel Show given for the benefit of the Y, W. C. A. Great was the applause that filled May Hall when the curtains parted, disclosing the cabaret scene with all its action. The various signs on the wall attracted a great deal of at- tention, especially such ones as these: "Buy a Liberty B-ond," 'glf we please you tell us, if we don,t please you, tell others," and "Tip the Waiters per order of the Management." A pause! then in walked the members of the .lazz Band followed by their leader. The signal to start was given and instantly the band Struck UP the Opening chorus. From the first note to the conclusion of the performance, the watchword of the whole affair was HP-e-p," Was it a Success? "Ask me, I don't knowf' But from the fat purse, the applause and the smiling faces we should certainly say it Was' The quick Change from the cabaret to the min- Stwl Shfw Surprised and pleased the audience. The waiters, transformed from their menial . posi- lions to the foremost places as '6End Menf, Cer. UUUIY carried on their new parts with as much life and fun as they showed in the Cabaret The famous Mr. Black arrived just in time to fill the role as lnterlocutor. SCCHC. cc . , MThe H. A. Diet, was an event of the evening. r. Howe appreciated how popular he was. The strains still linger with us: "Oh, that awful diet, That H. A. diet, It's making a scarecrow of me, The more l eat, the more I fade all away. his just like eating so much fodder and hay. For the diet's taking, No tissues making, And I leave it to you to See' Science tells us people sure can live on just straw, Eat tough alligators and devour eggs raw, But oh, this awful diet, This H. A. diet Is making a scarecrow of mef' , Tune-"Wild, Wild Women." The two Dots were side shows in themselves and their double shuffle along with other fancy dancing indicated that the talent for aesthetic dancing is not dormant among us. Everyone of us join in thanking Viv's friend for her kindness in helping us. She surely was a high light on our program. Bessie May may, in time to come, convert us all to the cause of Equal Suffrage if she uses the same convincing arguments as she did in her stump speech. Although two of our friends from the Sunny South were present, they favored us with only a few selections, keeping their regular per- formance until a few days later. The "Long, Long Trail" was sung in a very forcible and convincing manner and an appre- ciative audience presented the dusky performer with a token of their esteem. Another member to be thus honored was our friend from Podunk. "He" gladly offered his services for such a great cause and very feel- ingly sang, "You Make Me Feel So Foolish, When I'm Making Love To You." Good jokes, most of them showing not the least sign of wear and tear, were given in be- tween times throughout the performance. The Faculty were not spared either. Perhaps the most surprising one was on Mr. Ried: In many, many years from now When all the Faculty have gone, And most of them some-way, some-how Have passed through the pearly gateg We're willing to bet St. Peter will say Well, Mr. Ried I see you're still late. Dot Carter's pleasing "Thank youu when her jokes were applauded showed her pleasure at "getting them over." I "Nothing is complete without a tribute to our Country so with our representative Columbia in the foreground the Company and audience joined in singing '5The Star Spangled Bannerf' A crash and a bang! and the ,lazz Band played their closing number. W Mr. Whittemore 1898 - 1917 WHEN it was announced in the spring of 1917 that Mr. Whittemore was to retire as principal of Framingham Normal School we thought that surely the school would not go on without him. It was with regret that the class of 1918 saw him go. For who of that class is not proud to have known Mr. Whittemore and to say that for at least a part of .her course she was under his guidence? The influence of his teachings is shown by those who have gone out from here in the last twenty years. To Mr. Whittemore Framing- ham owes more than anyone else, the high place which she holds today among Normal Schools. To us he is more than a scholar and pedagog. We prefer to remember him as our counselor and friend. Ebe TL cture GZ urse We have :had some very interesting lectures this year given by people who were particularly well fitted to talk on their subjects. Near the beginning of the school year Dr. Chalmers re- ceived from Mrs. C. P. Dickinson and from Framingham Alumnae Association of New York a sum of money to be spent for some form of en- tertainment for the school. Dr. Chalmers chose to use it to provide a speaker the third Wednes- day evening of each month. These gatherings were made possible, not only by the money and Dr. Chalmer's efforts to obtain speakers, but also by his thoughtfulness in releasing us from some of our school work that we might attend them. The first lecture came October 17. The-Hon. Samuel L. Powers of Boston spoke to us on the subject, "Great Men I Have Known." We were very much interested to hear incidents from the lives of Grover Cleveland, William McKinley, Henry Ward Beecher, Phillips Brooks, and other famous men. On November 21 Dr. Frederick W. Hamilton of Cambridge talked to us on "Some Funda- mental Concepts of Democracy." Dr. William Allen Knight of Boston came December 19 and, it being so near Christmas and at the time of the Red Cross Membership Drive, his talk was greatly appreciated. The theme was "Christmas and the Red Cross." Many of us had heard Dean Sarah Louise Arnold of Simmons College but were very glad to hear her again, on January 23, when she set before us our duty in Food Conservation. Dean Arnold renewed our efforts in this line, and no one, remembering the picture she gave us of the world seated at the table with all the food at our place, could resist doing her utmost to share with others. On February 20 Dr. Albert F.. Winship, editor of the "Journal of Education," gave us an in- teresting account of the "Industrial History of New England." Our evening in March was given up for a con- cert by the musical clubs of the Institute of Technology and those of our school. In April, the 17th, Mr. E. W. Sargent, a rep- resentative of the Amoskeag Mills of Manchester, N. H., gave a very interesting illustrated lecture on cotton manufacture. We are looking forward to a lecture on May 16th by Prof. Paul H. Hanus of Harvard Uni- versity which will be on "Hampton Institute and Negro Education." We feel these lectures have been very bene- ficial to us as well as giving us many pleasant evenings and we wish to express our gratitude here to those who have made this course possible. gs! 'I mul tj' 452 Sf aQX3s.7'-Hjuqv up aymlrff, i .' , Mffiy 'ilt 0- H 7 -, -. 5- 'H V - - . - pw Sgpsgk, ,.k.mef,- Iliff x..,--.,.. ,., . , . .. ...,,., .. .t.f-,,,.,., w""2"'4 57'fQ 91:31:44: 'gl N l ,iff xi' ' 135124: 5:9555 yin, gn iy541 . Ii? hay' ki, 5? :',": ' EJ .1 'Iss' Senior an ance On a Saturday night, the twelfth of January, the Seniors had their first "Man Dance." Night of nights! lt was all that one could wish it to be-a wonderful social success. The party was an informal one. This helped greatly to make it the enjoyable affair that it was. The hall was transformed into a garden of peach blossoms and cut plants. For this we give much credit to the artistic Middle Juniors, who worked so tirelessly for us in making both the hall and reception room so pretty and effective. We had Newell's orchestra from Marlboro and it certainly was good. One-steps and fox-trots were the favored dances. Good fun was enjoyed in the Novelty dance, as some people had diffi- culty in matching numbers-but we noticed they didn't sit out! Dr. and Mrs. Chalmers were our chaperons and held a brief reception before the dancing began. Although they didn't dance we believe they had as good a time as we Seniors. Owing to the conservative work of the Dance Committee our expenses were cut down a great deal. Inexpensive dance orders were given and presented through the kindness of Mr. Ried. A short intermission was held at which ice cream, fancy crackers, and cake were served by the Middle Juniors. There was punch on hand throughout the evening. Dancing was enjoyed until eleven thirty. but dreams went on indefinitely. :bum jfrnm he vm Utmutnrp "Oh! good, a letter for me.-Girls my man can't come. What am I going to do? Only a week before the dance, and I'll never have time to get another one." "I can get you oneg don't worry." "But I've never seen him." "Never mind that, I can vouch for the fact that you will like him, and you will get along well with him." "What are you going to wear?" "I donit know, what are most of the girls go- ing to wear?" "Some have planned for evening dresses, and some for afternoon." "Mine's going to be afternoon, no, I guess I'll wear my evening dressf' "May I have the seventh?', "Yes-oh, no! you can't either for I have that one taken, but you may have the twelfth." "I have that one with somebody else. Here's one, the fifteenth?" "All right, the fifteenth it shall be." "There's the telephone. I'll bet it's for me saying my man can't come. On the last day too. -What a relief,-it was only my sisterf, "Are you going to sleep this afternoon? I certainly am not. My dress isn't even ready yetf' "This is the quitest place. Every girl getting her beauty sleepf' "We have dinner early tonight. Come on, let's go down. Oh! how lovely those red lights are in the hall! just look at those beautiful baskets of sweet peas fastened to the chandeliers in the dining room! !" "Baked beans tonight of all nights! I'll never be able to eat a thing. I'm just beginning to get so excited." "Don't eat so fastg you'll surely choke. You've plenty of time to adom yourself. I must hurry to be down to the car to meet my man. Good- bye girlsg here's hoping your men all come too.', "The telephone! For me?-He's come, girlsg he's downstairs nowg no more worrying about him." "1 wonder how much longer I must wait. He would surely call me up if he weren't coming." Peeking over the banister, "Whose man do you suppose that is, all alone?" HI know to whom he belongs. Isn't he good looking?" "I don't like him a bit!,' 'LHere she is! Isnit she lucky!" "Don't forget your dance orders, girls. Let's make a dive for the alcove during intermission." "How many people do you think that alcove is going to hold?" "It's time for the grand march to begin,-and he isn't hear yet fln despairj. We'1l just have to go in late, that's all." PK Pk il' PF Pk "I'm so tired, but I've had a perfectly wonder- ful timef, "I think he was a wonder of a dancer. You should have seen him dancing with me, I was so short and he was so tall." "Wasn't her dress pretty?', "And we can't have another one until June." 015304 ig!! E 'Flin 'nag M4 affine' 'avg ' Q4 wx 41 " 19-'S' aff e' ' vs 2' ' . 1 ""'i9'9?"i-Q-'9'Qi"1a-tin" t ' f 9? i shoes jfrnm rocker 391111 "Oh, dear! ! I did not get a letter from my man this morning and I don't know whether or . - 79 Eb not he IS comlng to the dance! Cheer up, Nita, it's a whole twelve hours before the dance. Maybe he'll call up during the day," was her companion's sympathetic reply. Along the corridors the girls strolled back and forth each with a tale of woe. Eva's evening gown was sent special delivery but had not ar- rived. To be on the safe side, she was nego- tiating with one of her chums for the loan of an extra gown. Bur-z-r-z. Bur-z-r-z. g'0h, there's the phone I'm so scared he can't come." I hope it's for me." There was a mad rush for the phone, and a casual observer might have been reminded of the celebrated picture as the fair maidens grace- fully balanced themselves at all angles on the stairs watchfully waiting. "Hi! Nit! Nita Gregory, it's for you! A chorus of high pitched voices brought that young lady on an aeroplane trip down the stairs. "Thank goodness he's coming. I'm so relievedf, These same actions were repeated throughout the day by several of the Senior members. Preparations for the big event started early in the evening. A professional hair dresser offered her services for the second floor. Nevertheless more than one was heard to moan, "My hair is losing all its natural t?l curl tonight. What shall I do? It will be a mess!" "Oh, forget it. What's that compared to being manlessf' "Who has some extra hair-pins?" "Do you like my hair up high or low?" Shall I wear this tulle scarf or not?" It will kill me to dance all evening with these as cc new pumpsf, The like questions and remarks caused such commotion that we were informed that it sounded like a second rate boarding house. Never hav- ing had the privilege of living in such, we were unable to compare the sounds. In a conspicuous place in our dorm were in- scribed these words: DEAR GIRLSZ--' Miss Finley will kindly act as hostess in my place this evening. Let the halls upstairs be quiet while the guests are assembling as they would be in a well conducted home. After the dance you will find the parlor lights lowered and there must be no lingering there or in the entries except for simple good nights. You are expected to retire promptly and quietly. It will be Sun- day A. M. I am glad that the weather is good and I hope you and your friends will have a real good time. ELEANOR J. DAWSON. Moral: Do a good job quickly. Per. Shingles. The above instructions were extremely well carried out and the party broke up with "Simple Goodnightsi' neath the sheltering rays of dimly lighted lamps. The morning after the night before found some early risers in the living room long before break- fast time. Fran was wise when she donated an alarm clock for E-r-e sure called in time for breakfast. News came that the aviator Sam-was so used to being in the air that his feet refused to walk down the hill the night before. A hungry group gathered in the dining hall where break- fast was served. "Some roads led east, some led west, We leave it to you to imagine the rest." Uacation EDax3s Framingham. loneliest village of the plain Where once the carefree Normalite did reign, Where smiling ,luiniors their first visit paid, And departing Seniors ling'ring looks delayed. Dear lovely bowers of idleness and ease, Seats for our rest whenever we did please, How often have we frolicked on thy green, While sedate faculty gazed upon the scene, How often have we paused on every charm, The The The The ivy-covered walls, the cultivated farm never-failing brook, the grinding mill, 9 crystal lake beneath the neighboring hill, many quiet roads with a wealth of shade, Where faculty and students their evening visits paid. How often have I blest the coming night When toil remitting took to fiight And in my dreams fantastic figures see Destined so by the art of chemistry. Poor silent village, among the hills withdrawn, Thy life is fied, for all thy girls are gone. Upon thy paths no skipping feet are seen, Nor do they ruthlessly tramp down thy green. Desolation marks thy whole domain, But still the books of learning do remain! No more thy well-kept gardens reflect the day, While choking grasses work their weedy wayg No more thy timely trolley cars must wait While girls rush down in half-dressed state. The village thou dids't know is now a silent place Whose desert walks a few lean figures grace, In silent gloom thy red-walled turrets rise As if complaining to the near-by skies. Times are alteredg vacations somhre train Laid waste the land and scattered wide its reign. I U' :' Q ' - Q V EP- 'E Q Q , gl, EK K L xv c, Q Q X Ju N' ' ' an Q. 9" f -Buena fix 132 T H E DIAL THE PRACTICE PIECE Take up one-eighth-inch, pass over a half Thus stitches are taught by one of the staff Take up one-fourth-inch. pass over the same, This one is basting, you know it by name. Stitching and hemming, practised so neat Till perfect enough for a bag quite complete. Plain seams and French seams, hemmed and stitched fell, Plackets and fumes-some done so well That teacher is puzzled just how to know Those who into the next class should go. Fine garments are made, with painstaking care Such beautiful work youill find is quite rare! Then mending and darning. to some a lost art, Bring problems anew to every stout heart. 'Tis thus an embryo teacher is made, But as yet unable to teach without aid. Comes the next year, a new phase of work! That of making a shirtwaist and skirt. A equals shoulder-CD, the full length, Fractions to test the best mental strength. Five-sixths of a half-such sounds are wafted Where shirtwaist and skirt are both drafted. Then models of cambric are builded so fine With bastings of blue that test to a line. Collars and cuffs in fashion quite tailored 1Although as to collar, it sometimes is sailoredl With seams and new plackets all stitched by machine In fabric of poplin or fine French linene. A pattern commercial is studied with care And a frock is soon made with the best to compare. Middle Juniors pass on with "methods" replete Their training in sewing is not yet complete. Dress-making now demands the attention In yet other ways which now I will mention. Beautiful fabrics are spread for selection And samples are studied with much predelection. Courses in Textiles have not been in vain For to know how to buy is surely a gain. And so every girl then hies her to town This time to purchase some cloth for a gown. As well as a gown, a hat must be made And so other stitches quite new are now laid. Frames made of buckram and sometimes of wire Make a foundation all can admire. Then Io, a-gliding down the aisle Passes a Senior, all dressed in style Passes indeed quite out of our reach For now she is ready, yes, ready to teach. SOME REGULAR JOKES Mr. Reid llooking on a paper for namelz "Well, what does this mean A. Smart Senior AT, Miss G-n- 1Englishl: "What appealed to your sense of hearing in the description?" Miss S-T: 'gThe man woke, hearing the cock- ing of the crow." Miss Cushman: "What style of nightgown do you prefer?" Miss H.: "I don't know, I never wear one." Gasp of surprise and horror. Miss H. lreassuringlyj : "I-er-wear pajamas." Mr. Meier ichecking off special topicslz "All those who have "lice" raise their handsf, OH ME, OH MY! I Scene-Sloyd fcourtl room. Time-9:15. I Caste-Reguliar ,Iuniors in Handwork. ComplairLantw"Miss K-y, youive forgotten your work before. You may go. It's your second offensef, Self-Appointed Judge-"Six months." Real Judge-"You may go too." Hasty exit of culprit and self-appointed judge. Curtains! J TRY THESE OVER ON YOUR PIANO "Can't You Hear Me Calling, CaroIine?',-B. Marcionette. "Over Theref'--N. Gardner, A. Gregory, R. Vaughan. "All Bound Round With the Mason Dixon Line.,'!V. Parsons. "Just You Alone."-F. Coleworthy. "Just a Voice to Call Me Dear."-K. Duggan. "Man, Man, Manfi-Bethel Banks. "The Wild, Wild Women."-The Faculty. "When the Sun Shines Brighter."-Foreign Mail. Framingham State Normal School 133 "An Old Fashioned Wife."-Dot Bush? "Wait 'Til the Cows Come Home."-G. Culver. "Some Sunday Morning."-When Al goes in town. 'gIt's a Cute Little Way of My Own."-Kay Shurtleff. "lt Wasn't My Faultf'-Girls on shifts. "I Wonder Why."-O. Warren. 6'Long Boy."-Mr. Meier. "Pack Up Your Troubles."-Anne Corey. "They Run Wild, Simply Wild Over Me."- Water Bugs. Melody Land."-Hazel White. "Hello4My Dearie"-M. Breitzke. sa We're Going Over."-Ede and Blanche. "Keep the Home Fires Burningf'-A. Callahan. When the Clouds Roll Byf'-Peace. 'gltchy-Koo-Ties."-? ? ? L4 The Wanderer."-L. Nightingale. "Show of Wonders."-H. A. Millinery. "The Copperhead."-Russell, Barrett, Angus. l'The Follies of 1918."-H. A. Diet. "The Rainbow Girl."-D. Bush. 'LSO Long Lettyf'-Friday afternoon. HOW YOU'D KNOW THEM Madalene Hodges by her Temporial Curls. Frances Katzew by her Singing ful-Iigh Cost of Living"J. Claire Kennedy by her Hair. Rosemary Antin by her Medicines. Marie Lewis by her Vocabulary. Esther Hayden by her Crushes. Doris Harmon by her Absence. Helen Taber by her Modesty. PLAYS REMIND US ' "Odd and Ends."-Left-overs. "Under Cover."-The garage? "Miss Springtime."-B. Burr. Come Out of the Kitchenf'-Helen White. Upstairs and Down."-Edythe. "The Very Idea."-Miss Coss. "Very Good Eddie."-B. McGovern. "The Man Who Came Back."-The garbage man. "Nothing But the Truthf'-Harriet Lovering. it cc cc Cheating Cheaters."-The Pantry Key. "The Boomerang."-Del's medicine. '4Turn to the Right."-Pie Alley. '4Oh! Boy!"-What we all say. "The Tailor-Made Man."-Mr. Doner. Maltida Hayden by her Love for Communi- cation. Helen Moran by her 'LTremulo" Laugh. Mildred Failey by her' Step. Dorothy Cudmore by her Broken Toe. Bessie May by her Fiddling. Margaret Fealy by her Knitting. Ebba Fredrickson by her Rapidity. Ellen Magnusson by her Dimples. Jessie MacGregor by her Authority. Elizabeth Fahey by her Poor Circulation. Mollie Sanford by her Tongue'Accomplish- ments. Gladys Porter by her Telephone Calls. Agnes Gibbons by her Love of Home. Elsie ,links by her Marks. Agnes Smart by her "Globe Trotting." mt THE DIAL Gertrude Mansfield by her Accompaniments. Marjorie Dean by her Bangs. Erva Kennedy by her Infrequent Absence from the Laundry. THE COOKING HOUR Between our' lunch and the evening, When we all are beginning to yawn, Comes a class in our day's occupation When "The Regularsu their aprons don. I A whisper. and then a silence, "Good afternoon, ladies," is said. "You may be seated," and shortly The dear recipe is read. A sudden rush for this and that, The noise of dropping pans Bewilder the Cooking Teacher 'Til she doesn't know where she stands. The product tickles our palate And graces a napkin white, As we tremble to learn our mark of fate Which is check and dot, after a bite. Results are looked at with critical eye, Bessie held "her" in such awe, She felt prostrate before her And the fudge-went on the floor. And there she will keep you 'til four, Yes, forever and a day, 'Til the desks are in perfect order And the dish pan is put away. ENLISTMENT lf you have grit to fill a bushel measure And more, by far, than common weight of sandg If you can face all kinds of vicious weather, In stuffy rooms, and call it very grandg If you don't mind the task of hiking daily Through mud or drifts to hear a peevish classg If you can hear to eat a frozen luncheon Where just your breath makes frost upon the glass, lf you can smile when comes the weekly pittance Less than Maid Norah gets for making beds, lf you serene, can keep an even temper When things, not lessons, creep in childrenis headsg If you, unpraised, can honor trust and duty While thought of as a kind of human tool, If you're prepared to live and die a martyr Enlist as teacher in a country school. "ln reading a book I often run down page pa THE SHIFTLESS SHIFT Sing a song of the shiftless shift, Several silly shirkers, Solemnly shufiling so many tasks Off on the other workers. Wait 'til they want a job or two When it comes to June Shiftless they'll no longer be They'll sing another tune. But happy-go-lucky to go through life Shiftless, silly and gay. Look what Framingham did for them Can't you hear the people say. after geT'79 Suppressed giggles. Nervously: "Well, l mean with my eyesfl Miss R.: "We took that for grantedf' WHEN EIGHTEEN GOES AWAY O'er Normal Hill there hangs a cloud Of deep unlightened grief. The proud old trees have lowered their heads And every drooping leaf Speaks mutely of a sorrow great Which shrouds the Fatal Day When girls are clad in purest white And Eighteen Goes Away. Alas! that such a blow must fall On those who love us so, That the gay and care-free faculty Should all be plunged to woe! For on the Assembly platform Those dignities will stay But the morning using" wonit be the same When Eighteen Goes Away. Old Framingham has never known So sad a day as this. Where are the girls that can replace The ones she's sure to miss? Whoill keep the study hour 2 T. Cheer Juniors up, and play At teaching wise old classmates When Eighteen Goes Away? Foamingham State Normal School 135 'Tis said that no one is so great But that when she is gone Some other person can be found To push her work along. But where is there a Senior Immune to work like they Who'll work their last in old Chem Lab When Eighteen Goes Away? The standards that H. A.'s have set But few of us can reach Oh, what a hopeless task it is To try to fill the breach. For in the room of cookery In rows the seats will stay But white clad cooks will cook no more When Eighteen Goes Away. And Room 79 which long has heard The frantic Regulars cry, Now saddened and inured by time Looks on with kindly eye While quaking trembling Seniors Get on their knees, and pray That from the handful that is left Eighteen Will Get Away! A GRAMMATICAL ERROR On a moonlight Knight the head Gardner and Parsons were sitting on the Banks of the river pruning White rose Bush-es, pulling Burr-s off the Murphys and cutting the Hawley. "If I could hear Moore Nightengales in the Fi field, Ild be Fuller of happinessf, said the Gardner. Just then a rabbit appeared, "If I had my way about the rabbit Warren, I'd Barrett," he continued. Nearby in the morning when the leaves started to Russell the King was fishing as the Breit-zke showed over the Brecken-ridge. Turning a Page in the hook he had with him, he said to his brother John son, "My Shurt-leff at home and this Coles-worthy a coat, I'll have to see the Taylor." ,lust then he caught a fish. "Here, your than mine, pull it in," he Howlldb ett. Placing the fish in a Viall, he took it to his sweet heart saying, "Here is a Bod- fish I caught, if you love me Keep it." Armstrong-er "Oh, I'd Lov-er-ing," said she. So they were married and the Peoples rejoiced. THINGS THAT NEVER HAPPENED TO MIDDLERS 1. Dot W. flunked mid-years. 2. "Mil" failed to meet an emergency. 3. "Gab" got enough to eat. 4. Anna T. stayed at school one week-end. 5. Marion Forbes was expelled from school. 6. Dot M. was speechless. 7. 'LClelly" was on time for recitations. 8. K. Baker didn't get the least bit excited. 9. Hazel F. was as cross as two sticks. 10. Port looked a 'Lsightf' 11. There was no Chemistry to bother about last week-end. 12. Marian Mc. was in perfect health. 13. Ruth Coates was wasting time. 14. The class decided not to have a "man dance." 15. There was no study hour in May and June. GET BUSY UNDERGRADUATES! ! At a recent faculty meeting the faculty unani- mously decided in favor of a resolution to offer a stimulus of 355-to every student at the Normal School who maintains an average of 99.4-4-100 in the prescribed courses of study. This will not only assist many students finan- cially hut should have a wholesome effect upon the scholarship of the entire school. FAMILIAR PHRASES Oh, aren't you awful."-Miss Shepardson. "I don't think I'd like that."-Miss Coss. "The Ah Deahf'-Miss Ramsdell. at st Lost l ! ? ?"-Miss Greenough. "I suspectf'-Miss Rochefort. "That seems to be."-Miss Gerritson. 'fNorway."-Miss Sewall. "Elegant,"-Miss Stevens. "Which division is this."-Mrs. Ford. "Has anyone seen my-?"-Miss Cunningham. "You'd better look that up."-Miss Harris. 'fNo-o-o?"4Miss Kingman. Stultify.-Dr. Chalmers. "Queen Anne front, Mary Anne rear."-Mr. Howe. "You've got the notion-go right on."-Mr. Meier. 'gThe boy downt' the housef'-Mr. Workman. 136 T H E DIAL "Prerequisite."4Mr. Ried. "As it were."-Mr. Doner. "You girls up there in the back row."-Mr. Archibald. 6'Well-but! I"-'Miss Fernald. "Now be very particular, young ladies, this is very important."-Miss Nicholass. "Perfectly wonderful."-Miss Hunt. "Hyannis"-Miss Finley. H. A. Senior tshowing a corrected outlinel: "I can't make out the comment at the end." Miss N.: "That says, I cannot read your writ- ing." Instructor: 'SYour answer is as clear as mud." Stride: '4Well, that covers the ground. doesn't it?" Miss N.: Speaking of string beans, has any one seen Mr. Meier? Jolly Junior: "I had a funny dream last night. I thought I heard my stockings speak, and what do you suppose the right one said?" Sedate Senior: 'Tm sure I don't know." Jolly junior: f'I'll be darned." A CASE OF LOGIC Why is bread the mother of a steam engine? Bread is a necessity. Necessity is the mother of invention. The steam engine is an invention, therefore Bread is the mother of a steam engine. Why is a bee-hive like a bad potato? Because a bee-hive is a bee-holder A bee-holder is a spect-ator A spectator is a bad potato. ' Speaking of the Boston and Worcester Trolley Air Line. uDid you have any trouble catching the car?" "Oh, no: it stood still and let me walk right up to it? Pupil Teacher: E'Why can't you be good?" Imp.: "I'll be good for a nickel." Teacher: t'0h, you want to be bribed! You should copy after your teacher and be good for nothing." g'Hoover says to use molasses instead of sugar in coffeef' I just won't do it." iLWhy?79 64 It's not refined." "I'd have my 'man' to the Minstrel Show but the seats wouldn't be comfortable." "What makes you think so?" "The Government put tax on them." Taking a walk on an empty stomach is said to cure indigestion. but you should be very cares ful whose stomach you walk on. N. Dorm Girl ltaking watch from under the pillowl: "Quarter past seven and still no one has come to call me! If they donit come soon I shall surely be late for breakfast." HEARD IN CHEM RECITATION Mr. Howe tseeing no name above some written work on the boardr: "Somebody doesrft like their name, evidently." Miss S.: "No, I don't.,' Mr. H.: 'LWhat are you going to do about it?" Miss S.: 'gChange it as soon as I can." Mr. Howe: "I once knew a woman who never drank tea, coffee, cocoa or any beverage contain- ing any stimulant. She had a perfect complexion. and attributed it to this fact." Voice in rear of room: 'GA skin you love to touchli' Chemistry lives on forever But analine dyes. 'gl was in a doctor's office the other day and guess what I saw?"-Mrs. Rose Feeding the Family!" Mr. Howe: "Seven kisses furnish 100 cal- ories." Miss H-t: "No wonder people can live on lovef' Fframinglwifm State Normal School 137 In all Mr. Howe's lectures in diet in disease he didn't mention the latest known knockout in- vented by an H. A. Senior-a cup of prune juice before retiring. Jack of all trades. Vender of Liberty Bonds. Champion Rat Exterminator. Educator of Souls and Consciences. Member of 57 Varieties of Committees. A pinner down of Males in general. Non-bluffable dirt perceiver. Ollicial adviser in haffaires de coeurf' Three gucssesvwho is it? MONSTROSITIES OF THE H. A. CLASS Miss Some-One-Else. Miss Raise-Your-Hands. Did-You-Have-A-Question. Miss Miss Wait-A-Minute. RECEPTION OF THE APPERCEPTIVE MASS In Miss Greenough's class it brings applause. THE In Miss Rocheforfs class it brings disdain. In Miss Ramsdelfs class it is not allowed. THE TWO LANGUAGES Teacher: Your work is rapidly deteriorating of late and I shall be forced to decrease the arith- metical value of your attainments, thus eliminat- ing you from the ranks of the Senior Classg if you do not raise the standard of your work. Pupil: She said I was punk and if I didn't spruce up I would flunk. Teacher: "How can one tell what good litera- ture is?" Miss E-n: "Why you know good literature when you see it." Miss Rochefort: '6Thank you!" Miss M- lTeaching a lesson in Sciencet: g'Do you know anyone who owns a cow?,' Miss H-: "Mr, Meier owns a cow." Miss M-: "Where does he keep his cow?" Miss H-: "In the garage." IN SCIENCE Miss M-: "How many have a cow in the fam- ily?" Grand applause. There was a young maiden named Nyllis Who always is wondering where Bill is. He's now "over there," As a young engineer But uncertainty gives Nyl the willis. There was a young man from a college Where they learn theological knowledge On the car one bright day He bumped into Kay And the shock has kept his nerves on edge. There was a young hero named Dan Who aspired to be a great man. But when he met Dot His heart then got caught And for her he does all that he can. There is a big senior so airy Who thinks she is a young fairy. With a spring and a bound She covers the ground She'll land on you,-so be wary. Among those who kept well the diet Was Miss Edythe To avoid a row She had to ask "Howe" To still retain some of her humor yet. McKelligett, If you wish to acquire fine data Go to the Old Maid's Incubator. On Normal Hill Standing still Far beyond the equator. Politeness is the vital thing in social life, and it is always well adhered to at F. N. S. The following is an example of a dignified and polite senior asking a sub-ordinate senior to be more quiet, HShut up, or I'll give you a bifl in the kisser that will knock the crunchers out of your chew-box." CLASS ODE I. We are thinking of today of the past happy years Safe sheltered from storm and from strife. In the peace of the harbor, the days we have spent, In our glad joyous springtime of life. 138 T H E II. As we gladly take up the oars of our boat, With our faces turned to the light, Ever onward swiftly we'll row, not float, With truth as the sword of our might. III. Oh thou Alma Mater, the guide of our youth Be the light of our perilous ways, May our friendships be founded on kindness and truth, May success by the crown of our days. M. H. L. ALMA MATER Dear Alina Mater we come today To sing our thoughts to thee, our friend. Within our walls We find the light, The truth, to which we shall bend. Guide us each day o'er the roughened road, Let us smile at each approaching care. May we give to each the best we have, For courage bids us do and dare. Dear Alma Mater, fare thee welll We are going forth to teach the youth. Let us keep your phrases before our minds And most of all "Live to the Truth." DOROTHY SHEEHAN. PRACTICE SCHOOL FACULTY CHARACTERISTICS Miss Cushing .................. Loving Kindness Miss Emerson ..... ...... I ndividuality Miss .loyce .... ..... S uch Style! Miss Caunt .... ..... T hat Laugh Miss Dale ..... ............. S ilent Dignity Miss Armsby .... .... fn dependence Personified Miss Winslow. . . ................... Kissing Miss Ward .... ......... W inking Miss Malloy. . . . . .Piercing Looks Miss Grey ....................... Hair Dressing LAST WILL AND TESTAMENT OF THE REGULAR SENIOR CLASS The Regular Senior Class of 1918 of F. N. S. in the town of Framingham Center, in the county of Middlesex, and the state of Massachusetts, being of sound mind, memory, and understanding, do make their last will and testament, in manner and form followingcf We do give, devise, and bequeath to our un- DIAL sophisticated and doting successors to this height of ideal efficiency, educationally speaking, those gifts and honors, real, personal, and mixed, of what nature and kind soever and wheresoever, being intangible and therefore non-portable, otherwise we'd never be so generous, which we have inherited and otherwise accumulated during our short sojourn here. First. The affectionate tenderness with which we are regarded by the faculty. Second. That consummate dignity which has ever characterized our every move. Third. Our irreproachable attitude and pro- fessional manner. Fourth. Our modest and unassuming style of dress. Fifth. The chef and all that with him goes. Sixth. The practice school with all its Under Associations. Seventh. The 6:30 bell and "lights-out" at 10. Eighth. That delicious ice-cream on Wednes- day nights, but if afore-mentioned delicacy should be converted from aforesaid evening to Thursday evening, as was customary heretofore, or any other night when the chef might think it fitting and proper to serve aforementioned dessert. Ninth. Dorminic, with all his lovable man- nerisms. Tenth. Laws governing Miss Greenough's book-case, chained books, and slavery outline. Eleventh. That ever-present technical term, Happerceptive mass." Twelfth. All the stars and planets in the noc- turnal firmament under Miss Rocheforfs guid- ance, as said persons sees fit to impart such stu- pendous thoughts to immature minds of afore- mentioned recipients of this legacy. Thirteenth. Those Moody and Wooley Books which contain such ethical value in English Grammar. Fourteenth. In regard to that noiseless system of cookery, we do most cheerfully and willingly bequeath Miss Penniman's drawer formation. Note: Donit forget that the fork is next to the salt box, and the tasting spoon should be parallel to the handle of the cup. Fifteenth. Mr. Archibald's gentle and soothing remonstrances during general singing. Sixteenth. Those pleasant visits to the hen- house and to the garage to see Mr. Meier's cow, Martha. Ffrotmlnglwtm State Normal Scltool 1:39 Seventeenth. The skeleton, Matilda, in Miss Sewall's closet. Eighteenth. Mr. Doner's maxims. Nineteenth. That entrancing music of the Baby Grand Piano which gives us such inspira- tion when doing the Irish Jig under Miss Shep- ardson's tutelage. Twentieth. Miss Ramsdell's "1deahs.', Twenty-First. Tuesday and Thursday even- ings, when the opportunity is given to roll up and replace rugs of the living room. Twenty-Second. The memory of Mr. Ried's hearty good fellowship. Twenty-Third. The privilege of giving Dr. Chalmers lots of notices to read. Note: If notices are scarce, lose a "School Management" or a fountain pen. Twenty-Fourth. The New Dormitory, our home for one blessed year, with all its cor- ridors, closets, laundry, dining-room, living-room. alcoves, and boudoirs, and the tender associations connected therewith. Twenty-Fifth. PROMISES galore for a new dormitory. In witness whereof, we, the Regular Senior Class of 1918, the testator, have to this, our last will and testament, set our hand and our seal, this 17th day of April, A. D. 1918. Signed, sealed. published, and de- clared by the above Regular Senior Class of 1918, as and for their last will and testament, in the presence of us, who have hereunto subscribed our names at their request, as witnesses thereto, in presence of the said testator and of each other. THE REGULAR SENIOR CLASS, 1918. T'-Sev1f"f1tsvZ-' r w n ot , 0- 1 ,A-,X if WX A f :Q M ' ws I Elbvertieemente ADQERTISENENTS Charles Lawrence Company COMMISSION MERCHANTS 1MPoRTERs AND JoBBERs FRUITS and FANCY GROCERIES 111 Commercial St. BOSTON Telephone Richmond 438 vvl-- - x .. 'vvzlvvz . .,,,,,1arg lnsiant Powdered it A 6 C ' 99 Art is Long Because it is real and true. The trivial, super- ficial and cheap must in- evitably disappoint in photography as in every- thing. Look at some of your old photographs. Rare indeed is the home that has not some terrible examples of inartistic posing which are charit- ably put among the things to laugh at. They never were good art so never can be right. Sane, true, normal art never Write for Marion ,, . , Neil's new book pales. Sensible posing is half of the secret of s,,, ,V ge1atine-Des- Purdy photographs and Sens' Soups, ' their o ularit 1 s"' Salads, Sauces. 13 13 V' GELICIEISSEXCO. Our new and commodious 1"3!1"Si,':: Effie' I" Studios 2: . 54 .ggi 1 145 Tremont Street S Q 41 'e 1 2, .fe ff. 1 if S , ,.. ns.. , V' K ,.i.. - -iq P--uw fn, zum 'i ""' I lNSTANlT'Qg?6s HC i - LaasgtAT.XgfHED ' twafgTf.:fg'1-fflfiwffff1 1 Q ,,,.,,,,. f o fm, , gf' , ' ,, : , ..,,,l A i pk GET THE GHEGKEHBUAHD BOX 1+ .V my 1 M i ADVERTISENEN TS The Normal School Cobbler L. MUTC Compliments of M S 'MISS coLL1Ns LUNCH Compliments of OLD CENTER STORE Post Cfhce Block Framingham Center, Mass. A. E. SWENSON, Proprietor. TRAVIS - CUNNINGHAM The Rexall Store n ll all A MDR M M M Rumford Baking Powder insures whiter, sweeter, lighter cake and hot breads-it raises the baking just right, and re- stores the health-giving properties which line wheat flour loses in the process of milling. Try Rumford next baking day and you will know why prominent food experts commend it as a heathfal and economical leavener. Every housewife should have a copy of "The Rumford Way of Cookery and Household Economy" by Janet McKenzie Hill and Christine Frederick. We will send it FREE upon request. RUMFORD COMPANY, Providence, R. I. The Fisk Te achers' Agency EVERETT O. FISK SL CO., Proprietors ZA Park St., Boston 317 Masonic Temple, Denver 156 Fifth Ave New York 514 Journal Bldg., Portland 809 Title Bldg., Birmingham, Ala. 261 Shattuck Ave., Berkley 20 E. jackson Boulevard, Chicago 533 Cit. Bk. Bldg. Los Angeles Normal gradviitlirarie in constant ' 6 BEACON STREET, BOSTON Long Distance Telephone Ha market I2 3 ALVAIRZYF. PEASE, iflanager Send for Our Manuel 455 M 405 ADQERTISENENTS MG KENNE5, 5 Mgmmnmgrt 51 Hollis Street 1655 y H if FRAMINGHAM . MAss P? ........ r '- vQ?f?"" Ill HRM! 27119 CATERER Member of Florists Telegraph Delivery Flowers Telegraphed Anywhere at any Time S. J. GODDARD MAIN STR EET Framingham Centre 'fleuf'-Q5 X, l STATIONERS ' F For Good Eats Fine Stationery b Visit High Grade Engraving Printing Invitations and Announcements ' Coats of Arms, Crests Monogram and Address Dies ' Fraternity Stationery - Menus, Programs and Dance Orders Stationery, Supplies, Fountain Pens Leather Specialties and Brass Goo 57-61 Franklin Street BOSTON MQR 1 dam is it M M ii ii iii ii fi Fi Fi , li!-Q! ADVERTISEMENTS BOSTON STUDIOS 161 T qwrnaiirnuromml T I fgmglggg Sf- .K NEW YoRK sruoio C . CHC ' . 306 Fifth Ave. 164 Tremont St. J Tel. Beach 2687 EBOSTON Quality is not merely a matter of money and ma- terials: The best equipped photographer cannot at any price produce anything better than he or his employees are trained to do, or than his studio is equipped to produce- Class Photographer to Framingham Normal 1918 Best wishes of the MIDDLE JUNIOR CLASS Compliments of 7uN1oR CLASS dk 4 N dh film rbi for ADVERTISEMENTS BQ , Framinghanfs Finest Drug Store W1LsoNiA BLDG. E. J. ROBBINS, Reg. Pharmacist, Prop. Best place in town for Ice Cream Sodas and College lces HENRY L. SAWYER CQ. When in Need of HARDWARE, CUTLERY, GARDEN SEED AND FARMING TOOLS, LAWN SEED FERTILIZER OR READY MIXED PAINTS owe Us Q Call and Get our Price BHTES lH0ll1SWORlH C0. Ask Your Cm if 7 for FA Y S STATIUNERY isn't a good place to have Waterman's Fountain Pens your watch fixed CARDS and BOOKLETS ' 'rw of all kinds Slattery Sisters sCHooL SUPPLIES Ll- CGRSET and Bates 81 Holdsworth Co. Embroidery Shop Corsets 51.00 and Up Successors to J, F, EBER SL CQ, Fitted Free of Charge WN .. A m it ei mm mmm X, in-: iw QQQ Q AD ERTISENE15 TS !!'l!!J1!l I Ihr livih- raft BIIPEE Ernnklinr, iilluaa. Emignmi lgrinima ESTIMATES ON ALL WORK HOUSE ORGANS Commercial Letter Printing Color Work SHATTQQTQMS JONES FRESH FISH OF ALL KINDS 128 FANEUIL HALL MARKET - BOSTON FRAMINOHAM DRY GOODS CO. A complete line of Ladies' and Children'S OWearing Apparel 27 CONCORD ST. SO. EFRAMINOHAM, MASS 4 . 432 A F MXN ou- S S ADVERTISETTENTS S W. J. SANBORN St CO. DEPARTMENT STORES FRAMINGHAM Women's Tailored Suits and Coats Silk and Lingerie Waist, "Fownes" Kid and Fabric Gloves Phoenix and Gordon Dye Hosiery, Fine Dress Goods RELIABLE GOODS AT LOWEST PRICES THE COKELL Sruoto FRAMINGI-IAM "iBurt1faiture" Get some Joy i out of Life! Music will drive trouble away, clear your mind, brighten your spirits, and soothe you mentally. The SONORA is extraordinary for its wondrous beauty --- the tone of its velvety smoothness with a power and a wringing depth behind it that makes it almost human. RICE 599 SHANNON DRUGGISTS National Bank Bldg., Framingham Compliments of Canning Bros. FRAMINGHAM Compliments of A. T. WOOD FRAMINGI-IAM m mmmm X, AD ERTISETVTENTS ll llL!'!jL!!l ll THIS SIGN WILL GUIDE YOU The Original Squire PROVISIONS Z7-31 Fanueil Hall Market f BOSTON TELEPHONE, RICHMOND 204 BATCHELDER Sz SNYDER COMPANY , PACKERS AND POULTRY DRESSERS WHOLESALE ONLY Beef, Mutton, Lamb, Veal, Pork, Lard, Hams, Bacon, Sausages, Poultry, Game, Butter, Cheese, Eggs, Fresh, Salt and Smoked Fish. Oflices and Stores: 47, 49, 51, 53, 55, 57, 59, 61 and 63 Blackstone St. and 62, 64, 66, 68, 70, 72, 74 and 76 North St. BOSTON, MASS. LABORATORY EQUIPMENT CAMBOSCO Everything for Science Instruction Satisfaction Guaranteed Your Lists Solicited for our Current-Net-Itemized Prices, Catalogs Free. CAMBRIDGE BOTANICAL SUPPLY CO. ,E WAVERLEY MASS. .I .. .S .. .B ADQERTISENENTS C. F. Hovey Company Summer, Chauncey and Avon Streets BOSTON, MASS. Our Ready to Wear Departments Offer Complete Outfits for Young Ladies Reliable Qualities - - Moderate Prices I HOSIERY GLOVES NECKWEAR The Pickett Teachers, Agency Eight Beacon Street, Boston, Mass. EDWARD W. FICKETT, Proprietor Graduates of the Elementary and household arts courses have found our service thoroughly satisfactory. STEARNS R. ELLIS ROBERT W. BELKNAP Telephone Richmond 332 Geo. A. Fales Co. BUTTER, CHEESE, EGGS and POULTRY Z5 NORTH MARKET and 25 CLINTON STS. BOSTON ADVERTISEMEN TS K, Mfnmarh-magnum Glnmpang 1 Glnllvgv fingrauvra ? ,g nf E+? , Q22 Nun 'iinglanh 'AG i , worcester jllilassacbuaetts Tllinzxrelleh Engravings for Glass Books anti other Qllollzge Buhlicatinns ' .S ,,N WB 455 ZA Framingham Laundry, Inc. ELBIN F. LORD, Manager Careful Launderers of all Washable Materials 50 Howard StI'CCt Telephone 486 Compliments of CLASS QF 1919 ' QW? T ' lf i A X' C 1' f - f ie -L omp zments o 'i lzili nhitl Class of IQZO Queen Quality Shoes Harding's Shoe Store i 1Rv1No SQUARE Framingham, - Mass. , Wh Wh lik lik ADVERTISENEN TS THE STQBBS PRESS Serfuice Printers 9 WHSWWN. 2 Toms 3 N V K X Q " Q I S sg. W ,WX RESSNv WORCESTER,MASS. E ,K A is '- Q "The Sign of Service" Printers of Class Books for Colleges and Schools. Z5 Foster Street f Graphic Arts Building WQRCESTER, - f - MASSACHUSETTS ll V W. A l Jul. - vl- li ll? A is r YIICUIS me Page Dr. James A. Chalmers . fi Dedication ..-............,.......... . . 7 Memorial Rock and School Buildings .. .. S Foreword ................,......... . . 9 Pictures of School Grounds .. .. 10 Class Hymn ............... .. 11 The Editorial Staff . . . . . 12 The Faculty ..... .. 13 Class Baby ...... .. 17 Seniors of 1918 .......................... 15 Adventures in the Realm of Teal-herdom .. .. 68 The Course of a Household Artist ..... .. 73 Regular Outline ................... .. 77 H. A. Outline ... . . 551 New Dormitory . . . . H7 Crocker Hall . .. ... 90 Glee Club ....... ...... . . 91 The Orchestra. ............ .... S 12 The Experimental Kitchen .. .. 03 Lend-A-Hand ................ . . . 9-1 History of the Y .W. C. A. .... 95 Fine Arts .... .... . .. ... 97 A Kenipis ...... .. 99 Red Cross Work ................ . . .100 Summer School Canning Course. . . . . .102 Middle Junior Class ............ . . .106 Juniors ............. . . .108 Sports .............. . . .109 The Regular Course ...... ...11-1 Lost! Strayed! Stolen! . . . . .117 WVho's Who ............. 118 Middle Juniors Play . .. 119 Mr. Ried ........... 122 The Minstrel Show 123 Mr. Whittemore .... 124 The Lecture Course .... 126 Senior Man Dance ............... 127 Echoes from The New Dormitory 128 Echoes from Crocker Hall ...... 129 Vacation Days ..........,. 130 The Jokes ..... 131 Advertisements .. 141 v,Y'f 1 , , r ,M .ui .-- .s', u r , b '. 5 . Q '.'.'-,Lf '14 :L , .. lg. . 2 2 .,, ' .A,. Y' ., W , ' , 1, 1 'QM ' . ff x N M .F 'fn -' 'MA T' 'iq ., . 5.8. . - 1 K ' A-ga. .q-, . ' Q 5'1" ' , x A .UU-V .., , A, 5 ,, rf ' ' V f f '4 A I - . .5 " W . ' I , , . U' .5 --. '-Y n- X SX K , - ix . - 's vc' " z ,mr ,, J-.L Y X-V K, V, 1 ' 5, -,, , - V .r-.5 ' , "X 1 . x , ,. .11 'jf w ,. . - 5 ,pw '-N n.'1 W .!f'4',g ff- .11 .N J M 7' 'f :"1' , , Y 1" lf- " I , ,'1',fg4-A ' , M.. 21. X - 4 " X if. '. -- .' 5 ' 2 2- 5 - .gh Ny? . ,vrJ.q, , ,Vx - . gf A", N4 ' .:'5.' 7 X' K I , V , V1 1 4 wg! ,V ' M, . ' 1 .,h1'1f'.R '- - 1 .num , 'lr' Q' A .,i'fQsf'! xv- ' fe wr -I V, ,. N..L..,a W ,Wy A ,.,I U. :Iii-an r Q ' N ' . 1 ' K ,, 4 .1 v -:Je W . jgb., .- . . I 2, . . 1 'Aff -4 ' " 1 , ' x I A , . A J' 'Q v qi'-fb'-' ' f' 'nr' . . I .r ,ll 1, VU J' 'iw gg L " - qf.',i1,.i J 1 K. 1 ' i4QiLkL,.-'FRI 1 . lW.i3lIQGn'C3n 'Xu WYi"n. kk. x f dz, Q ,"1r' . . .Aly 1 x- . , ,.37Qi:"v.x iv ,...,1 -1, ..:v1..v , gl 1 II., H555 P ' ul I .'-him , f,-'fx '-L L., -aww -1' , ,JV -. -V -4, ' . .JV nw., . ggouu , .14 A, :, V, xg' 'th ,.L- .l A- , 5, v '51


Suggestions in the Framingham State University - Dial Yearbook (Framingham, MA) collection:

Framingham State University - Dial Yearbook (Framingham, MA) online yearbook collection, 1911 Edition, Page 1

1911

Framingham State University - Dial Yearbook (Framingham, MA) online yearbook collection, 1915 Edition, Page 1

1915

Framingham State University - Dial Yearbook (Framingham, MA) online yearbook collection, 1916 Edition, Page 1

1916

Framingham State University - Dial Yearbook (Framingham, MA) online yearbook collection, 1919 Edition, Page 1

1919

Framingham State University - Dial Yearbook (Framingham, MA) online yearbook collection, 1920 Edition, Page 1

1920

Framingham State University - Dial Yearbook (Framingham, MA) online yearbook collection, 1921 Edition, Page 1

1921

1985 Edition, online yearbooks, online annuals 1970 Edition, online yearbooks, online annuals 1972 Edition, online yearbooks, online annuals 1965 Edition, online yearbooks, online annuals 1983 Edition, online yearbooks, online annuals 1983 Edition, online yearbooks, online annuals
FIND FRIENDS AND CLASMATES GENEALOGY ARCHIVE REUNION PLANNING
Are you trying to find old school friends, old classmates, fellow servicemen or shipmates? Do you want to see past girlfriends or boyfriends? Relive homecoming, prom, graduation, and other moments on campus captured in yearbook pictures. Revisit your fraternity or sorority and see familiar places. See members of old school clubs and relive old times. Start your search today! Looking for old family members and relatives? Do you want to find pictures of parents or grandparents when they were in school? Want to find out what hairstyle was popular in the 1920s? E-Yearbook.com has a wealth of genealogy information spanning over a century for many schools with full text search. Use our online Genealogy Resource to uncover history quickly! Are you planning a reunion and need assistance? E-Yearbook.com can help you with scanning and providing access to yearbook images for promotional materials and activities. We can provide you with an electronic version of your yearbook that can assist you with reunion planning. E-Yearbook.com will also publish the yearbook images online for people to share and enjoy.