Fort Morgan High School - Pacemaker Yearbook (Fort Morgan, CO)

 - Class of 1980

Page 1 of 166

 

Fort Morgan High School - Pacemaker Yearbook (Fort Morgan, CO) online yearbook collection, 1980 Edition, Cover
Cover



Page 6, 1980 Edition, Fort Morgan High School - Pacemaker Yearbook (Fort Morgan, CO) online yearbook collectionPage 7, 1980 Edition, Fort Morgan High School - Pacemaker Yearbook (Fort Morgan, CO) online yearbook collection
Pages 6 - 7

Page 10, 1980 Edition, Fort Morgan High School - Pacemaker Yearbook (Fort Morgan, CO) online yearbook collectionPage 11, 1980 Edition, Fort Morgan High School - Pacemaker Yearbook (Fort Morgan, CO) online yearbook collection
Pages 10 - 11

Page 14, 1980 Edition, Fort Morgan High School - Pacemaker Yearbook (Fort Morgan, CO) online yearbook collectionPage 15, 1980 Edition, Fort Morgan High School - Pacemaker Yearbook (Fort Morgan, CO) online yearbook collection
Pages 14 - 15

Page 8, 1980 Edition, Fort Morgan High School - Pacemaker Yearbook (Fort Morgan, CO) online yearbook collectionPage 9, 1980 Edition, Fort Morgan High School - Pacemaker Yearbook (Fort Morgan, CO) online yearbook collection
Pages 8 - 9
Page 12, 1980 Edition, Fort Morgan High School - Pacemaker Yearbook (Fort Morgan, CO) online yearbook collectionPage 13, 1980 Edition, Fort Morgan High School - Pacemaker Yearbook (Fort Morgan, CO) online yearbook collection
Pages 12 - 13
Page 16, 1980 Edition, Fort Morgan High School - Pacemaker Yearbook (Fort Morgan, CO) online yearbook collectionPage 17, 1980 Edition, Fort Morgan High School - Pacemaker Yearbook (Fort Morgan, CO) online yearbook collection
Pages 16 - 17

Text from Pages 1 - 166 of the 1980 volume:

f fe N I I A., 6 Q., ll 1 'E 0 'lv .iw K J ' , ' J . , 'i lk Yr c, 1.1. , .A-,. , l '. .5 ,, A -. Y 3 s ' Lic "4" 5 . . ,,, . Q - t L ,F "' .f. 1, ,4,-'yi' ' gg 2+ " ,fir f VL, -. Q -. , . - t5f1"f? A .EM .v 4 ' . 4 'tg A 1, , Q9 s ' 4' l"f2Q'yq' . . Y 4111- 1 1 1, i v- ' - -Q '. " -- e -. -.fi w ' S jff: 1. ,uv 'Q . 5 It '..'2, I .y'r5'45F ' - Q. , ' vi , .x , 4. , V ,"g':', P-' J- 594 ' 'V 5' R fs ' 2 -n . . ., +2---nh R 11. -L. A ,1."n. 5- iw. 5-13 , .-Tia E ' AQ 3'- A: -Lg? - 4"""f51-H ' ' af. I 2 W jf p gT..f L. 'lj 1 n s 4 , 5 -X fzxf.a,gQ?c.,, ' . ' 1. " f 4-1'-,.,.1 r ' Aifgwxv-,W I 'i P sms! J 54 ' Whtig ' ,, 1 '.r '51- ,f N 1' - .QA ' - M .J A-'Y . x I I , .- 'A 'Q 2 - i . Q .f N -I t,-I.--,p 4--Q -u,..., . O A , . I 1 ' ' 1 ' ' - f ' f ' - . 7 a ' - X, .- 7.12, ' ". 41 ' '-,.,' . ,V I . .-. ,'. I , 1 .4 - " ff- 9 va KE .45 , .1-. it . ' F , f Q ' .MQ 1 A , f A N, , A , , iJ A' ' ,, Nfl U H H ,,.,y ffQ M up , W M7 1 A I ,, I W I in ,Y V: .A-M -1f""w'V?y,,Z'W , H ,i N VwW,,,,,. K WWlW,,k.,,WA MM H,,f1i,4iJh4M,,+vff VMWW,,,,..W,,, M f WMM' ,,,.fffM' ,M MW ,, ,, f W , ',,,,,,,gwf K I Lh,VAk.,gff-"'Ni'f?lH!,1,,,f41-' ff" ,fi IIIIV ,A,,,,Ww'W'MhW,,. ,,f' W My , ,, , , wji f ,MM ,M ' if M M gQj4 g,, yfNQ 1LZL,,w ' ' "f"xL W' - f V ,,-Aff H ,',"fjMy1ffff1g1mxfzzpwff f ,,.,, QW: ff"f k 1- M,,,,f " , W ,,.A ' f , f f f 1 1 ' E 391 Q39 , "f""""" 'Waxman qmmwnnfl gs, wi:-WI? ,EYJQEZI gv J "22f5m12fiGVJ9W'll7I rf WWF! "d'iwrt:a2.... .7na'e5C Q'. .4 " Gluiny- ,.. ...,,...,160 vfcadeiniu. Q Qryanig atienpl , Uldvcrti Aem en ta. . .4 Brice Cochran, Blair Lampe, and Gall l?uhl gel some munchles during a F.B. game. Dawn Baumgarlner and Kim Brown hem our al lhe F.B.L.A. - Trans Alaska Hsh sale. Jeff Schwindf demansfrares how lo make a fox lrap for his demonslralion speech. Colleen Troudf and Krisli Meece head lhe Spir- il Club rneeflng. Jana Lillljohann playing a fulure Alberl Elnslein during a chemistry lab, David Lauck and Brad Dilll march To the beaf of lhe new corp sfyle drum cadence. EN TEIPING THE 80 'S I L. ri 'The Roaring Twenties,' 'The Depression Era,' 'The Trou- bled 8c Triumphant Fourties,' 'The Fabulous Fifties! 'The Un- easy Sixties' are themes given to decades gone by, The 70's are still too close to peg with a theme but as we reach the threshold of a new decade, the 80's, one won- ders what the next ten years will unfold and what its dominent theme will be, The past decades brought forth new ideas and a few were short in their duration and others are still with us, Some of these trends resulted in prohibition, social welfare programs, rationing, nuclear energy, and going to the moon. lt is both challenging and exciting to think what new dscoveries or ideas are ahead of us. We have witnessed trends and fads such as bootleg- ging, flappers, bobby socks, letter jackets, drive-in movies, long hair, and dsco. We know that there are new trends waiting to be developed and new fads wanting to catch on. The doors for trendsetters, challenging even ts, and the uncertain future of the 80's are all opening UD, and we enter the new decade whether we want to or not. Let's face the challenge and heb make it the best decade ye tl te-+-ww "P-s .Q ii . ' ' - ., . f ,J fe -.xi i EN TEIPING THE 80 'S V 1 Clogs are a popular shoe and an irnparlanl pail of many girls' ward- robe, Sherri Madsen sfrilces a pose in her dress and spike-heeled shoes. Manuel Sanchez and Marvin Bauer are "living" examples of lhe varlefy of hairslyles worn by The fel- lows, Some sludenls lhlnk il is class lo walk around wilh unfied lennles, Diane Atwood, Val Widener and Susan While are rafher lypical high school sludenrs. Mosl aren'l ferrioly concerned abou? fheir fulure. Blalre Lampe and Mike Ballew pose nexl fo a sparsely used bicy- cle rack, One wonders if lhis Trend will change in our fufure, Andrea Mandes looks sharp ln her high heeled shoes and sfraighl legged jeans, M' 'lv I ,f""' TIPENDSE TTERS I XXX Trendseflers have marked each decade The flffles were marked wlfh rock-n-roll. lylrnl slcrrls were a maln foplc of lhe slxfles. A trend of fhe seyenlles was longer halr for The fellows Beglnnlng rn rhe elghlles, shoes were becom- rng a more lmporlanl parf of ones oulfrr. The clog shoe became a common srghf among women. ll was popular for sfudenls lo no longer bofher fylng fherr fennies. Girls were wearing flghl slralghl legged jeans wllh high heeled shoes. The fype of maslc changed from rhe hard rock of The sevenlles, fo a "dlsco" bear, Grrls wore more dresses fhan ln previous years. The hair- sfyles changed, boys were cuffrng their halr shorfer and ln nearer sfyles. The glrls were lean- ing foward ourller and more carefree slyle of halr-do's. As the doors open fo a new decade, The 8O's, one wonders whaf fhe domlnanf frends of lhrs coming decade wlll be. 355. ,Q 16. 4 sg, .-52 ' K A xiii P-M-I f .1,"4 1 535 L2 7 iw? , Vi- f MY.-. . , I W L 5 .5 sf. ' Q sq. -. I ?. 3 . ga 3 iff' 3 QR 5? 1 5 I ' if-,w,. T ww M 1lf"'gQ' I. QI TX In T Y . E yi 'V ,1 if TIPENDSE TTERS 1 ,Xi N,,,,, ... . gi. ' b if s ""' ' so p " M' sgqggsi ffaf 5 ..: zlfi , Q uri- I A A M Y 3' I 5 W.. K ,. S p Q g Q -1 if? .9 ,"', ' f CHALLENGING EVENTS Colleen Troudt, Linda Dodge, and Eileen Men- ken demonstrate the technique showing how the "Blonde Bombers" got to be number l. Pfeifer's Fighters practice their "on the line" stance for their game with Stadler's Stealers, in which they beat the Stealers 42-8. Some of the pom pon girls and cheerleaders doing the 'Adam 's Family' routine during a pep rally. The girls cross country team gets off to a run- ning start during the Ft. Morgan C. C, invitational in which they placed 2nd, The band Color Guard show the sober faces that accompany the new corp style marching, Coach Jensen challenges John Krosicob to a par game. M, K A 1!rn,,ix,,, fi I s as . ...W it W -QR um, ' .. ,rs 'W 'W fs , 2 ,.,, ks, J, Ns., ii N- 4 .. 1 H V., if ' Nb. . 1 ,,,,,,,.,....--ef 5 O .-x 2 . ,... in F .fsji i f 3s'0'F1g', .xwwsfam W muff Q' 'Www ,Y .,.J K, sip Q his ss is of T "A' J T W , W 5 1 fiiff v 4 w --n-I af! -n-ly ,,-,-ns- W as siii Y .my - f 'vet .. gg QL AM. .2 3, ,- , - ,, Events are becoming more challenging in school as well as in the world. One example this year was the Mustang Marching Band, which took a challenge and changed their marching style to a smoother flo wing, corp band style, lt was a challenge well received by judges as well as their loyal admirers, Although girls' sports have been authorized for several years now, they have been playing to rather sparse crowds, However, that was changed this year when a group of students calling themselves 'The Slug Club' accepted their own challenge of cheering the girls to victo- ry, For the Urst time in the schools history, a bus load of loyal fans accompanied the volleyball team to an out of town game and cheered their team to victory. Some challenging events were created by breaking traditions, Sev- eral Homecoming traditions were dropped this year and new ones added to generate more spirit, The new changes were met with over' whelming success and few regrets. These were a few of the challenging events that opened up and were met successfully this year, Many more will arise and need be met in the new decade. CHALLENGING EVENTS ag s 1 ' ,K fkvj 'fs- is nf' A M71 ......, ...... ....... ...... .......g ..... ........ ....... ....... ! ........sf ......... ........ X ,-.. fx l' Theresa Cavaleri reveals her charm for cusforners al Dairy Queen. Fon' Morgan finally gal a McDon- alds and Doris Busch acauired one of lhe many jobs lhaf became available, A borrowed aufo dealers sign in fhe senior lounge says if all. Mr. Welle and Terry Tracy fry fheir luck af The carnival marriage booth. Who knows whaf these sfudenfs will be doing in fhe future, Lance l-lochanadel and Martha Hosler show the Senior's winning form in Pom Pons scavanger hunf. Linda Dodge lefs everyone know what she does lo support lhe Mus- fangs, UNCEIPTAIN FUTURE 4 1 f W . we I if Slfifi-nfwxli g mvvcfufif , JQVUJVQEQQQWQI i 5 A3535 I , 5 k..,, g X 5 lagm il K 3 O if EI Q 5 E1 EJ STUDENT LIFE SECTION I Q Nr, ga 4 if Q3 'HM51' -if 1 ' f s +C. 1 K? H? bf.- fr J f if 'ji if E1 sd: ggi fr 1' ri 4 fs., we fi .pkg -Q W' K M -. rgyiflu F A 5 Y, V maawf- ' ' ,A 1 . Mf- Q., s -fgwgw,vi5-"fm wh, gffvz-M W W W 'L - M 'Hwy ' f .T UH- ' Z""" fi . ii 1 ,, , 4 . wr. 'nhkv 0 J. in' ' . ki -1 ,P 1' A ,Aw A' f 9 , W, ,, -W .wwv "Q, an W Ngnik , - 'I e is g"j2v"'H "w"k f" e , , uf QV. 1 ' J Sh V P" C-gawk The Brealf ln Traoirian is A Success Homecoming acfivilies were changed This year in hopes fhal all The acfivifies would have more parficipalion than pasl years. ln- sfead of a parade, bonHre, and snake dance, fhere was a pep rally, mini bonHre, hol dog supper, and a decorafed car caravan fo fhe foolball game. Also "spirif week" was held off un lil Wednesday. Confesfs befween The lhree classes were held in decoraling halls, idenfifying baby afhlele picfures, guessing The faculfy's "horse", which proved fo be Mrs. Keenan and Mr. Pfeifer, and seeing who could wear fhe mosf buffons and bows. Thursday, sfudenrs fol- lo wed The lheme by dressing as children. Thar nighl FBLA held fheir annual carnival. A pep rally followed wilh a mini bonfire in a hibachi. Fdday was 'dress-your-besf' day, seniors were announced as The hall decoralion winners, and a pep assembly was held. Af The assembly, fhe lhree classes, facully, and cheerleaders presenfed skils and a class scavenger hunf was won by The seniors. The junior class lalTed The most poinfs during The week 's acfivilies and fhere- by earned lhe privilege of ringing The new spirif bell. p17ff,',""""'f ' X g, g -.. gg! Two faculfy members horsing around-promofing spirif! Theresa Vaughan, Linda Dodge, and Mike Herr add fheir Touch fo The huge mural covering the easf wall of the commons while under The supervision of Barb Burkeff. Nancy Weber and Tad Green are all buffoned up and bow-u-fifull Look whaf the faculfy is doing fo our song! HOMECOMING A C Tl Vi TIES Iv u ' I .I in Qg?l5'i J .C A L IMI fi ,- "'-ffm . x '57 J Rf .Y K I gi? 1 K YA 'gh , 5 -IV: V, it I ,..a' x 'wi 5 1 ., c I x l s'2V" V , 44, A K 5 f in I :,,, E V , E I, Y..,, I Vigil :V VW aff- 1 'ffm ' 1 'L , . I, va: . 'Q 7 ' , I , ,S f M A Z1 I ,, , 1 s we + 1, Q 4 sf K' ' . , 1 ? I 1's Q, 'I-5.1 A' " 'Q Q I .n .Q fx ' S? 53 'v W 7 h A .. Q -al 1 f 1 f I 'ul E up 252, n"'.m1gs .W .Mu ,- r Rf? .M Gemme Grooms and Theresa Vaughan fry our fheir new bel-ly dance wifh fhe new Spirif Club bell. Kiffi Parker is seen curbing her dog of fhe hof dog supper. Cindy Schmid! and Nancy Weber hem Lynda Iungerich guard her enfry in fhe individual car decorafing confesf which won Hrsf place. Tammy Alles infroduces her dolly fo Gail l?uhI while Sherri Luhrs and "friend" look on. HOMECOMING ACTIVITIES ,E W ,2 "We 're Fon' Morgan and couidn'f be ,orouder!" Mr, Keifh Jensen seronading wifh his performance of "Precious and Few", Wendy Kembei snows her surprise when if was announced fhai she was indeed fhe Homecoming queen, Wendy is escorted by Jeff Kroskob, Mr. Andrus and Mr. Holder enjoy a cold smack in fhe face for a good cause, HOME C OMING A C Ti Vl TIES W' .mwiww """-QM.. 'S..,,u.,,4 'N'--seg. X I 1' .M ,1f, 2 T 3 .., ,Ez Mais EMM The nighTs of The carnival and pep rally, foofball game, and dance all proved, many ThoughT, To clearly convey The Theme of 'precious and few". The 17rsT precious nighT was Thursday, The nighf of The FBLA carnival and pep rally. The nexT was Friday, The nighT of The foo Tball game which broughT special happi- ness To Wendy Kembel and Lance Hochanadei who were announced To be The Homecoming queen and king aT The halfTime fesTiviTies. This was The Nrsf year for ForT Morgan To elecf a king, and To everyones dismay, a fooTball injury pre ven Ted Lance from parTicipaTing in The fesTiviTies. Even Though The MusTang gridders losT The game, 44-6, spiriTs remained high in anTlcipaTion for The cHmax of Homecoming which Took place on SaTurday. The dance was planned by SpiriT Club and decorafed To reveal The 'precious and few" momenfs in our lives Through miniafure aisplays ranging from The days of our l childhood To The days of old age. Music was suppHed by The band, "FoxTroT". Special momenfs of The evening were The coronaTion of The king and queen, and recog- niTion of The oTher candidafes, The performance of The Theme song 'precious and few" by Mr. KeiTh Jensen, and The performance by The Morgan High Singers To The royal courT. LasT year's Homecoming queen, Chrisfie Pullrn, crowns The new queen, Wendy Kembel as The king, Lance Hochanadei looks on. "FoxTroT"-supplying The music ThaT makes The dancers go 'round Dance, dance, dance The nighT away. HOMECOMING A C Tl VlTlES aww' eyed! Qw- Man y sfuden is and sfaff believed fhai lhis school year was a good one. The spirii, pride, and overall affifude of fhe sfudenfs was fhe greafesf facior in defermining fhis, S-P-l-l?-l- T was a word rarely misspelled and wide- ly used fo describe lhe enfhusiasm fhe sfudenis generafed during pep assemblies, school aciiviiies, and sporfing evenls. A good example of lhis was fhe formaiion of lhe Slug Club who 's main objeciive was fo make everyone rowdy ai sporfing evenls. They were someiimes foo rowdy, as some referees can affesf fo! Pride and The posiiive affifude of fhe sfudenis was seen fhrough the cleanliness of fhe school and The low rafe of vandalism. "The kids were doggone good abouf faking care of ihings" was Mr. Lucas 's commeni abouf fhis. Affer reviewing fhis school year, one can safely say fhaf when spiril, pride, and good affifudes are added fogefher, if almosf always equals a greaf school year! Graduafing isn'f as easy as one Thinks, Wendy Kembel siill has M00 words she needs fo know, Eric Jensen and Adrianne Vwrfh heb Mr. Schenk face his problem, Blair Lampe lakes advanfage of a blue lighf special and comes up with Eileen Menken. Casanova Carl Underwood pufs The munch on Jamie Walbye. INSIDE ACTIVITIES N. 3 ff ' 43 W ,11 1 'N-,, 41 1193- M wwl T l , if M, W 52. WK Kaye Yearous hebs John Morris with the Hrs! assignmenf of fhe year - gef- fing fhe book covers on! Tad Green increases his four ieffer word vocabulary by locking his keys in his car. Lee Jensen and Jana Liiffjohann are proof that sunshine makes a person do fhe weirdesf Things! Two onery Slug Club sfars are Doug Posener and John Rudmann INSIDE A C TIVITKES Weofifvyv gms ff A long cold winter promoted Spirit Club and Student Council to sponsor the Hrst annual Winter Spirit Week during the Hrst week of the second semester. Contests between the classes were held throughout the week and ciimaxed on Friday with the seniors winning most of the activities. One of FMHS's most hilarious assemblies was held that day when live real "beauts" vied for the 4980 "Ms. Mus- tang" lille. After Hrst parading in evening gowns they gave sensational talent performances. "Carla" Underwood read a poem. "Phyllis" Dalke gave an outstanding ballet perfor- mance which was so strenuous that at one point she lost her hair. "Millie" Rogers performed a tap dance and "Dana" Lehman did a well rehersed batton twilring act. But "Jonna" Bloedorn 's "l am Woman" had the overwhelming vote which made her the new "Ms. Mustang". She was crowned by the reigning "Lana" Hochanadel. A semi-formal "Snow-bail" dance Saturday, with the band Power Kut, was the icing for the VWnter Spirit Weeks' success. . . .al I V "M " K . fm.. , Qvfk ,. A-'- - WINTER SPIRIT WEEK 1 fn 1 fs 5 A 5 9 Fi 2 A . 4 , I I The beat goes on as FMHS students dance to Power Kut. Gail l?uhl shown with her escort Pick Price, receives roses from Donna Duvall during her reign as Snow Ball Queen. Mrs. Ostwald's dressed as her favorite athlete. ldtfi Parker is off the range on cowboy and lndan day. "PhylUs" Dalke shows the poise and charm which won the coveted talent prize. "Dana" Lehman giving her congrats to the new Ms. Mus- tang, "Jonna" Bloedorn. .J WWW "The Pain in Spain sfays Mainly in fhe Plain." Thaf was abouf fhe exfenf of whaf l knew abouf Spain before l wenf fo live fhere for a summer. Whaf i found was more fhan bullfghfing or flamenco dancers - l found warm and friendly people, eager fo share fheir life wifh me and foler- anf of my sfruggles fo say somefhing coheranf in Spanish. Alfhough fhey can 'f drive unfil fhey're 18, Spanish feen- agers offen meef fogefher in faverns fo eaf, falk, and drink because fhere is no drinking age limif. Girls and guys fend fo go ouf in groups, insfead of dafing, and, in place of "drag- grng Main", fhey walk fhe 'Loose-o" rpicfured herej - which saves a lof of gas. l spenf parf of my fime wifh a "fund", o group of guys who roam fhe sfreefs lafe af nighf in medieval clofhes, playing guifars and serenading fheir girlfriends. Thaf was greaf, especially when fhe girls invifed us in for food and wine. Living in anofher counfry can really give you a differenf perspecfive on life in The Unifed Sfafes. Somefimes we fhink, "Why doesn'f everyone wanf fo be like us, fo have fhe fhings we have?"Now l know fhey have a preffy good life of fheir own. - John Bloedorn LUKKIINILJX' Q A0 Y ,s,. k 773, U Aeggfg-'eg 1, ,fa .W . Hn' "" 4' E,!,fi.p3g52zOI1C!p Y i T g ,V 5-'sy-T 1ffffQa"i?f4'f'fi iii' 'hc f - -1 f is ' ' . . ,. . VA 'v'VfMCVVf'XlvY 5 A'?ELUTxi1.if M t W 18.3, 2 +4 I R 5 ww T Pfgslszss . I ,,vQ'gflv1y l'Tf'KUG7ff? 4451! iw wPlw.x:1dLz A, fi QKYRNQ. RkUS URUGUAYH Xiggm... W X 'fg' 'Vx nits' '.,' wx 1,386 YM' iil+44fi2.fx9'ff'f1 W ' A .fiatsfisf T ' 'I -.. rp spy' 1 "' A . , f . m This high school is quife a change for us. The lirsf days in school were very hard for us, buf lofs of people hekned us gef along. lf was very confusing fhaf we mef newpeople in each class. ln our German schools, one group of sfudenfs sfays fogefher in one room, buf fhe feachers and subjecfs change. This way, we pracfically grow up wifh fhaf one group and become very close friends. Anofher difference is fhaf all subjecfs are required. For example, we had fo fake English from Hffh fo af leasf fenfh grade. Dafing is also differenf. lf is nof unusual if a group of four girls and fwo guys go ouf fogefherf buf if you have a dafe, the girl usually pays for herself People here seem fo like sporfs a lof. They Uke fo wafch and give fheir favorife feam much supporf. The sfudenfs in school fake sporfs very seriously and spend a lof of fime pracficing. When we play a game, if is for fun, nof for so much compefifion. lf you wanf fo improve yourself you have fo join a club. We can'f fell whefher life in fhe Unifed Sfafes is beffer fhan Germany or nof, buf we sure enjoy if here. - Gerfje Kunsf and Kirsfen Meyer One imagines fhaf fhe world is like his own counfry. buf if's nof. Uruguay and fhe Unifed Sfafes have very differenf culfures. For example, in Uruguay, my mofher has fhree maids, buf no machine helpers. We can 'f go fo fhe grocery sfore and buy prepared foods,' we make everyfhing ourselves. ln Uruguay, everyone drives however fhe y wanf fo. We don'f have rules of fransif fo obey, as in fhe Unifed Sfafes. ln my counfry, if was summer when lleff - we had 4000 fo M0 Ofemperafures. When l arrived in Denver, if was 00. When lrefurn fo Uruguay dur- ing your summer, if will be winfer in Uruguay, so l will have a whole year of winfer. - Juan Pablo Fernandez . sf HUHJSXE 'XY 2 . V- I sfjxinzfk gs - K ig Tiff :??PlQ8LfCS xixx.j1if'f: pfZ.59,1.,j,,,f'fy x.1,UMs!v1wfjWfm'l:: or ' M . J fsfwl :MXL , N . T iiumz lyke!-Vx'5Q4.H kpfw 8 fv2f3icgfx.aklev11 yi-,x,,p,l,.,,, ighfsiwl' 5,5 .s Q iR,xxm1f1c rx' .4 A yrlux rwhzulcn , ,QGERMHNY 3 11M-,Egg-,x, ' 1' '?N1lll!lZ?5, ' ,gmstzut . . .. 'Y A "A-frgi r"'fWnrr11sQ9'x 'Q 'bi' T' " ngfelvzlscrs Q 1AxN,N VNllTl?WLU'i - . tk' . C s - - . 'F Gray-WF? -'v li ls 4. s I ul . --- 3 X X :fm-5.4.5216 srui1cGJHCUhfUfm liimexw .A Sepfggzhczryg H A Q V X T , ETL I IC15XRl A v . P Baden- gn - Q4 ,iii A A .i , " ' -agbgurg Augsbuzi: i i .. .,- x. Ig .KVV Q v ,Q QW' A ' . '-L . . lm gf.!?. is T 'l "ii 1 V X ' tkl' Q 55. K' ffguggn g ROSEUTTGTI 5 Q .ggfxx ,f'l?l-xpien ,. I D V. dxf G Qjank Q gllerf Qlkulsb, EXCHANGE STUDENTS fi ofvwwgy The summer monfhs were very busy for many slu- denfs and for a few fhey were filled wlih exfra-ordi- nary achievemenfs. l?on Werner, Alan Tadolini, Susan and Scoh' Kelrnes, and Barb lre y qualiHed for fhe sfafe rodeo Hnals which were held in Durango, Colorado. LeJean Carwln, Grefchen Hume, and Donna Duvall swam fhelr way lo become cerfilied Wafer Safely lnsfrucfors and lhis allowed fhem fo leach swimming lessons. Lance Hochanadel and Brian Lampe quamied and parficlpafed in fhe Uniled Sfafes Wresfing Federafion Nafionals which were held in lowa Cify, lowa. The following plcfures on these fwo pages show and explain even more achievemenls earned by our slu- denfs fhrough fhe year. OUTSIDE ACTIVITIES .xv ' a f ' .g s A T s S fxgy up L L. Qi Si , aww: A ' k"- ,f L fs' ' " f M- A i kkhh ' - r i ww A ' k i Lppps 11K ,r W my cfs Teresa Confreras fraveled fo Laramie, Wyoming where she won the honor of becoming the Nalional Lafin American Federaflon Queen. Theresa McCarfne y is fhe reigning Brush Rodeo Queen wifh Carrie Weimer as her affendenl. Diana Confreras, Sf. Mary's Fiesla Queen, is escorfed by David Guerrero. Mr. Benham awards a froph y ro Gail l?uhl, fhe 4979-80 Snow Queen. l?on Werner sho ws his bull-riding skill which aualizied him for fhe slafe rodeo Hnals. Kaye Yearous models fhe oufm' she enfered in fhe Make if Yourself wifh Wool confesf. The ouhil won her Hrsf place af disfric T, fhe Wool Princess A ward, and fourfh place af sfafe. A genuine Hawaiian Teaches Nancy Benham, Tammy Rehkop, and Sue Mason how fo hula while on their l. C. E. sponsored Hawaiian vacafion. Lynda lungerich and John l?udmann's goals are sky high. Lynda will affain her pilor's license sometime fhis summer and John is already a cerfifed pilol. OUTSIDE A C Tl Vl TIES a THE CAST KlNG ARTHUR Mike Hen' LANCELOT Tao' Green MORDRED Juslin Sfone PELLINORE Phil Dalke SIR DINADAN Lance Hochanadel SlR LIONEL Greg Holguin SlR SA GRAMORE K arl Kronkow SQUlRE DAP Jeff Smilh MERL YN John Bloedorn TOM OE WARWICK Ellen Kishimoio TWO PAGES Sue Mason, Sherri Luhrs CLOGRE VANCE John Schoeneck BLlANT Greg Presfon CASTOR Ricky Knapp CLARlUS Kelly Sfone GUENEVERE Donna Wickham MORGAN LEFE Y Tammy Zambo NlMUE Ellen Kishimofo LADY ANNE Dana Hoff LADY CA THERlNE LaJean Carwin LADY SYBILL Cindy Schmidl FOUR HERALDS Becky Ruppel, Vicki Owl, Lori Prinlz, Connie Gill CHORUS MEMBERS Cryslal Z welzig, Kelly Sfone, Tammy Winkler, Sherry Basseff, Teresa Happel, John Schoeneck, Greg Preslon, Rulh Henson, Rona Waldow, Andria Goodman DANCE COORDINA TORS Gemme Grooms, Sherri Luhrs STA GE MANAGER Kelly Stone PROPS John Schoeneck MAKEUP Jennifer Vwnfer COSTUME Sherri Bollacker STAGE CREW Greg Presfon, Ruth Henson, Lorna Chrislensen, Lori Pelerson, John Spolls, Tammy Helzer, Ho ward Crandall, Sandra Chapman -5 ,4 Mike Henk Phil Dalke, and Donna Wickham seem fo have their minds on things other fhan practice, John Bloedorn and Donna Vwckham show the sympfoms of the foo- much-,oracfice disease. Morgan LeFey's C Tamm y Zomboj heloers, Gemme Grooms and Becky Ruppel build on invisible wad around fhe sleeping ldng Arthur flwke Herfj. The chorus cheers on Camelofs knighls of the jousf. Guenevefe ls disfressed wlfh her realizallon fha? she is falkng in love wlfh lhe suave Lancelot Krng Arthur Clwke Herfj dubs Lancelof Had Greenj an honorable knrghf whrle fn lhe presence of other characfers, Phil Dalke, Donna Vwckham, and Lance Hochanadel MUSICAL K Drama Hlled This school year for. in addiTion To The musical, There were The performance of Two one acTs and The addiTion of a winTer play. The Two one acT plays. "The PerspecTive" and "SchuberT's LasT Serenade" were performed in De- cember aT ForT Morgan 's Hrsf drama mee T. "The Per- specTive" was direcfed by Lynn Gerfge and involved a group of people who were porfrayed To be sane aT The beginning, buT as The play confinued The audience became aware of Their insaniTy. "SchuberT 's LasT Sere- nade", dlrecfed by John Bloedorn, involved an off beaf young couple aT an eleganf French resTaraunT whose love-spell ouflives all The sfrange goings on aT The resfaraun T. ln January These plays were performed for The public buT wlTh The addiTion of unexpecfed sound effecfs. The wind ThaT nighT blew exfremely hard and kepT The skylighT over The sTage banging, forcing The performers To speak louder. ForTunaTely, The HghTs sTayed on unTil The plays were over and ,almosT everyone had gone home. A casT of approximafely Hffeen sfuden Ts performed an addifional play during The winTer enTiTled. "She Sfoops To Conquer". This charming play enTerTained audiences for more Than Two hundred years. Condi- Tions of sociefy on which The comedy was based have long ceased To exisT, buT The merrimenf of The ploT and double meaning dialogue were sTill amusing To boTh The audience and The casT. The casT consisfed of Jusfin Sfone, Gre Tchen Hume, Nm Bowles, Tammy Zambo, Donna Vwckham, John Schoeneck, Sue Mason, John Bloedorn, Greg Holguin, Donna Duvall, MarTha Hosier, Jeff A yres, Gary Cani7eld, ScoTT Binder, and Juan Fernandez. Mr. Powell in his 20Th Cenfury boofs, gives suggestions To JusTin Sfone and Grefchen Hume on how To porfray Their 18Th Cenfury charac- Ters. Juan Fernandez makes up a few of his own lines To amuse John Bloedorn even Though They're in Spanish. DRA MA The casT of "The PerspecTive"-L ynn Gerfge, woman and cfrec- Tor: Donna VWckham, girl' Ricky Knapp, Henry: Sherry BarTz. moTh- er.' Sue Mason, Mary: Paf McMorrow. nurse: MaTT Deal, mon. The casT of "SchuberT 's LasT Serenade "-John Bloedorn, direcfory LaJean Carwin, Maifre D'.' Donna Duvall. flower child: Dan Over- Ton, Franz Schubert' Lance Hochanadel. Alfred: Tammy Zambo, Bebey Mike Herf waiTer,' Alan Henson, cook. ki -11 as .ffivm Q r Q A5 X M. L Y S W isa g'f..'l 5 k s . . I . kk , ...ar .. .55 ff T , is i ,wylyfbfzvvfss This year's lyceum was dlffereni from lhe pasf lyceums. lnsfead of fhe presenfafions being based on differenf philosophies and problems of sociefy, lhey were career orienfed. Also, lhe ly- ceum was only fwo sessions in one affernoon insfead of several sessions in a lwo day period. The presenlafions were given by business peo- ple from Fon' Morgan area because mosf of fhe leffers senf lo our of fown businesses were re- pied wifh a negafive or no response al all. Ca- reers ranged from accounfing and journalsm fo fhaf of a morlician. Ofher presenfalions were by an arfisf, a phofographer, a veferinarian, a law- yer, and a beaufician, just fo name a few. The people responsible for organizing fhis ly- ceum were sfudenf council members Wendy Kembel, Donna Duvall, and Gre fchen Hume. The fask involved work from Seplember up unlil lhe lyceum ifselli which was held in February. Some commenls expressed about fhe lyceum were.' "l really enjoyed lhis lyceum - l learned more Than l expecfed" .... "foo shorl" "very inferesfing" . . . Mr. Larry Mercer explains a career as an arfisf and also shows his ariisfic abiify. The lyceum organizers - Donna Duvall, Gre lchen Hume, and Wendy Kembel. Mr. Bill Spencer gives some sfudenfs msignr info the Held of journaism. L YCEUM 2 fl, ,,,,w'f'WA MU A X-x.. ff ff f X fx ff ,fx X . . V If , ,f 'F' if "2 .-. i I A l 1 I - K g "' x + ' v GD 1 GD i 4 , L 'f f if i f Cm 14311 X Q3 'I QB PIWW fx? QUIQQHWG I F?X"1u -Q 1... 1f pi ll .-Q ...L .Q .... ,-. ,.J..,.-X .-.--....-i -.- 1 is X, .xxxsi Xxx xxmx xnxx. .muh 1... --i sw Eff Z, .Z Mit... .-vs fm:1:r1.::f-swf .,g,,-ge-lglszzzzgff x f 2' ,Q dv -if f .. ., x iii?-1 5. PENN R 5 Administration Shows us The Way Congrarulaiions and besf wishes io fhe Class of 4980. Your public school experience is now hisfory, and if is my sincere hope fhai hisrory, in ihis case, will bear our fhe facf Thai we were successful in heloing you move io- ward a meaningful and rewarding adulf life. ln re furn for fhe efforf fhaf was pui forfh by your parenfs, our parrons, sfaff and employees. l would like fo ask for a small favor. Please confinue io be in volved in rhe pubic schools. Lei us know how we can improve lhe syslem. There are many more fhal will folio w, and your impressions are mosf imporianf. Good luck in fhe fufure. win Dr. James Paine, Superinfendeni of Schools, in his ofhce DP. l?AlNE 2,2 s L12 W ,, A V E Pa 4 , T . iii NO 'fir Q by In L 2 . 5, lv 8 'J yu . QQ J 6 U3 School Board members are: Fronf ro w, Gaylon Ma- - son. Vice Presideni,Marvin Kembel, Presidenf, Gary E Loseke, Treasurer. Back row, Poberf Haffke, Audrey Brunkhardi, Avis Jackson, and Dr. Jarrold Schaefer. NG The School Board al work. Q S SPECIAL SEl?VlCES.' Froni row, Richard l-lamilion. .Q Transporfafion Supervisor. Berry Nida Wulf Nile Pro- Q grams. Joe Bealiy, Special Educaiion. Back row, Q3 Duane Dion, Adminislrafive Assisrani, Mike Jones, Health Direcfor and Curriculum Coordinafor, Jim Q Hauersperger, Mainfance and Operations. U3 ADMINIS TPA TION Preparing For The 80 s Although there was a decline in student enrollment which was causing administration problems the staff did a great job in preparing an outstanding school year. Mr. Lucas felt the staff was able to work more on Our PrincipaL Mr, ucas, talking on his Mickey Mouse hotline. seup,zeJoe5' SECIQETAIPIES: Front ro w, Carmel Seidenberg, Main Office, Ann Han- son, Bookkeeper. Back row, Dottie Lorensen, Guidance, Cody Brinckmeyer, Library Claudine Taylor, Main Oftice. The door to the Counseling Ofhce was always open for students to talk to Mr. Benham, Vocational Counselor, and Mr. Lee, Counselor, They hekned students with problems and assisted them with college plans. the students level and their attitudes to ward students was better. Our administration has seen many changes in cur- riculum faculty and students through the years. But the one thing that has remained unchanged is the goal that the administrators stress for every student: To use his scholastic andleadershrp achievements to the fullest potential in attaining life s goals. . Porter, Vice-Principal ADMINIS TPA TION O UF? 93 1 x ,f Q, ' rx f Y , i 3 X 'K 5 N WW 4: S - - up-an W. WWA. 1 it T Q me Q N x fs., Z I N - N Q I BOE GETS INTO BUSINESS BOE doubled ils size fhis year jumping from five fo eleven sfudenfs. These sfuden is obiained fheir secre- larial skills in school and pracliced fhese skills by hold- ing jobs in such places as Penney's, Counfy Clerk's Ofzice, lhe MGOVCGT Group, and fhe Banks. ln ihese jobs sfudenfs do a variely of fhings such as Type. Hle, and even answer fhe phone. "The class is really heloful because you gel lo work al your own pace and whafever you need fo work on." said Gail l?uhl. The Clerical Block Class, a new class lhis year, was designed for Seniors who wanfed fo hold secrefarial jobs buf didn 'f fake BOE l. Sfuden ls in lhis class work on secrefarial skills af fheir own pace. li is hoped fhaf wilh knowledge and experience gained from fhese classes, siudenls may Hnd more rewarding jobs in years fo come. Morgan Veferinary Cinic. Carolyn Wood has an inferesfing job af the For, Mrs. Shirley Corfez: BOE l, ll,' Typing l. Shorlhandl Office Procedure. f-'WY Dana Bernhardf concenfrafes hard on her fyp- Mr. Phil Sfcdleff Accounfingl ll.' General Business. - ing skills in BOE. DECA, Typing ll. Mr. Richard Harden: Typingl ll.' General Business, Assisfanf Wresfhng Coach. BOE xiii V snor and voc. ac.5 Buimunc Fon me so s The vocaTional classes did noT feel The crunch of The decreasing enrollmenT as The academic areas did. For The HrsT Time, aualiHed sTudenTs were Turned away from The Building Trades class because 25 sTudenTs was The limiT one insTrucTor could Teach. PhoTograph y was a popular course added To The curriculum This year. sn -It s,,-,,.,,, M.. , ,, ,M ff 4 v J The Vo. Ag. classes had a new insTrucTor, Mr. Sfeve Holder from WichiTa, Texas. Mr. Holder felT Ag. classes should be more Than jusT a 'shop class' and he planned To develop a well rounded agriculTural program for FMHS including ac Ti viTies wiTh The Young Farmers Orga- nizaTion and The communiTy. Mike Pesall sizes up all angles in Mechanical Drawing. Dan Hoffman uses exTreme cauTion aT The bandsaw. Mr. Virgil Graffr Welding, Mechanical Drawing i, ll,' Woodworking ll. Mr. l?oberT Loose: Building Trades lll, IV. Mr. Kari Andrus: Mechanical Drawing, Phofography. Wood- working l. Mr. Sfeve Holder: Vo. Ag. l. ll. lil, lV. SHOP CLASSES Educational Opportunities Are Found At MCC Many students at FMHS enjoyed a different kind of learning experience at MCC. There were four differ- ent vocational areas for students to explore. in Auto Body, students learned about welding, ba- sic body repair for those little "fender benders", and Hnished paint jobs on some cars. Auto Mechanics instructed prospective "mechan- ics" on the maintenance and service of things like brakes, tires, lubrication, and engine tune-ups. The Electronics courses "tuned" students in to the basic skills for building and testing circuits for elec- tronic systems. Allied Health was a new class offered this year. The students met at the new college building which pro- vided a clinical setting with beds, hospital equip- ment, and settings for other health Welds. The class, taught by Mrs. Gertge and Mrs. Bernahl, met Hve days a week for two hours each morning. During the Hrst semester, students studied the varieties of health careers, and learned about the systems of the body along with the nursing skills that accompany each. Shari Davis commented, "lt's exciting and real to work with people and problems instead of just read- ing about them in books." During the second semes- ter, they had on the job training at Valley View Villa and the Hospital. They also took Held trips to places like Fitzsimmons and the National Je wish Hospital in Denver. Most of the students taking the classes at MCC agreed that these experiences opened their minds and lives to a whole new world. , .- AVVJ QW ,W ,fl LP! its N X Mcc vocA rioivs X Shari Davis takes care of a resident of Valley Wew as a part of the Allied Health class. Mr. Sam Haug - Electronics Mr, Kelly Mason - Electronics Tim Wunsch is shocked to see a photographer in Auto Mechanics. Howard Underwood's idea of "fun in the sand." X 'HQ emi? fl C7 :T iv i 1 K 5 f vsp 'iff 1 A Q Q Q .5 "' ' ' ' 4 1- M 7'n 'v ,f Keifh l-liefbrink repairs a disc brake hub and o porfion of a fron? wheel suspension in Aufo Mech. Mrs, Phyllis Gerfge - Allied Healfh Mrs, Sharoll Bernahl - Allied Health Don Waferman pufs fhe finishing fouches wifh body puffy on fhe rear deck of a car in Auto Body class. Eleclronics srudenfs, Chris Sfroyek and Dan Cus- fer learn how fo frace circuils under the guid- ance of Mr. Mason Mr. Gene Ziegler - Aufo Mechanics Mr. Richard Reiber - Aufo Mechanics Mr. Bill Waller - Aufo Body Kim Brown and Thersa Cavalari demonslrofe the proper way fo fake blood pressure in Allied Heallh. MCC VOCA TIONS E, --iw- A- . Eh2liSh HBIPS Tp Conqugzj Danelme Partlclples English was a signilicani parf of every sfudenfs' curriculum. Nobody could escape if, since eighf credifs were necessary for graduafion, There were abouf fwenfy differenf courses offered, many of which were required, depending upon fhe sfudenf's abilify. Some classes were college orienfed, while ofhers were career orienfed. Sfudenfs in Pracfical English had fo overcome fheir shyness by invifing people from fhe business world fo be fheir guesf speakers, and infroduce Them fo fhe class, Liferafure classes offered sfuden fs fhe opporfunify fo read liferary works fhaf fhey normally wouldn'f read on fheir own. lf could be said fhaf mosf sfudenfs acfually enjoyed fhe experience when if was all over. Mrs. Keenan commenfed, "We live in such a vasf world, if is vifally imporfanf fhaf we read lifera- fure from ofher counfries, as well as our own." Through reading liferafure we learned more abouf ourselves, and ofher people. Ofher fhan fhe usual grammar and liferafure , herew ' eoffe . refurned affer several years absence, and Myfho- logy, Novel and Speed Reading were among fhe ofher courses offered. .3 Mrs, Beverly Haley - English and Journalism Mrs. Jo Ann Osfwald - English and Pacemaker Mrs. Sandy Sumner - Speech, Engish Mrs. Shirley Travis - Teachers Aid, Reading, English Mrs. Margaret McGraw - Engish, A.P. English Mrs. Barbara Keenan - English and AP. Hisfory Andrea Mandes and Jennifer Winier display examples of sfages fhey made in Drama class. Don Kembel and Bill Fries admire Don 's mobile of reflecfions of his "younger days" which he made for exfra points in American Lif. ENGLISH THERES Mona T0 FOREIGN LANGUAGES THAN LEARNING Due lo Mr. Hochanadel's serious illness, lhe German classes were laughl by Mrs. Milzie Jackson lhe Hrsl four mon lhs unlil he relurned in mid December. 40 sludenls were enrolled in Ger- man which was offered lhrough lhe Hflh year. ln addilion lo lhe lexlbooks and language lapes, lhe classes periodically enjoyed learning .aboul German cusloms which required a parly. Everyone assumes lhal a language class requires a lol of lislening in order lo masler il, bul Mr. Hollz also used a lol of audio- visual aids in order lo give his Spanish sludenls a beller underslanding. Spanish sludenls were enlhusiaslic lhis year and revived lhe Spanish club which had been inaclive for lwo years. They mel lwice a monlh, held dinners periodically, and inviled guesl speakers. Favoriles were Miss Mary Ann Lind who spenl parl of her summer in a mission in Soulh America and John Bloedorn who spenl lwo monlhs on an exchange pro- gram in Spain. So allhough language classes had a lol of speaking lo do, lhey had a lol of fun wilh olher aclivilies. f N l .5 U H W I Mr. Hollz gives special allenlion lo Debbie Boroughs and Pal McMorrow during Spanish. Blair Lampe, Kim Mese, and Da wn Baumgarlner pay allen- lion lo German while Tammy Comer pays allenlion lo Blair. Mr. Powell-English, Drama Mr. Hollz- Spanish Mr. Hochanadel- German, English Mrs. Jackson- German Subslilule LANGUAGE Social Studies Does It Aeain More Than jusT TexTbooks were used in Social STudies courses This pasT year. Colorado l-lisTory had Trunks from The STaTe Hisforical Soci- eTy along wiTh irnplemenTs used by beefdiggers. ln some U.S. Hisfory classes sTudenTs parTiclpaTed in a "sTrike". As a resulT The workers were Hred and sTrike breakers were broughf in. lsms class had guesT speakers from The Marines. BoTh of These men had been sTaTioned in foreign em- bassies. Besides speakers and oTher varied aides, The video Tape ma- chine, which was boughT by sTudenT council, was used more Than lasT year. "lT makes classes more alive. " Mrs. Oberlander commenTed. When oTher deparTmenTs were drapwwg creases enrollmenf, The Social STudies offered a new class, Geography. John Carr-HisToryfAcTiviTy Direc- Tor Donald Clmaglla-H1sToryfSocia- lology Mary Ann Lind-PhilosophyfHis- Tory Geography Harold Pfeifer-l-llsToryfMinoriTies Barbara Oberlander-Psycholo gyfHis Tory Paul Lorensen Tells Psychology sTudenTs whaT iT is like To be blind. nf 3 , SOCIAL STUDIES - f f i gas, vw lX,2- Thev Arent Just A Bunch Of Cookies f'i"i' 'W ik , if Touzh www, Wifh The views of sociefy changing, lhe fradifional role of Home Economics changed foo. Sfudenfs learned io cook wifh microwave ovens, and down vesfs, coafs and backpacks were as popular for fhe novice sewers as skirfs and dresses used fo be. Marriage and Adulf Living and Home Decorafing were also offered by The Home Ec. Depf. xx 'Mx S Baby Eggberfa is a producf of Child Developmental class. Mildred Mason-Home Economics Von Esfher Squires-Marriage and Adull Living Keri Wendell fakes a chance' al iasiing baby food while Angie Meininger and Nancy Benham look on, Mrs, Mason dernonsfrafes fhe arf of grinding baby food. HOME EC ONOMICS TEE MATH DEPT. MAKES CHANGES FOR THE 80's There was a large increase in The number of sTudenTs Taking maTh courses mainly due To The newly required mafh crediT for graduaTion. No longer were juniors re- quired To Take The dreaded maTh TesT if They Took maTh The previous year and passed. STaTe laws made iT illegal To give a single TesT afTer The ninTh grade and refuse graduafion on The basis of a single TesT. STudenTs who didn 'T Take maTh sTill Took The maTh TesT, and as a resulT of TesT scores were placed in eifher Pracfical or Consumer MaTh. lT was a change for The maTh deparTmenT and The possibiliTy exisTed ThaT more changes mighf be made in The following years. The maTh deparTmenT offered Two classes which were career orienTed. The Surveying class consisTed of four- Teen lucky sTudenTs who were ouTside jusT abouT every- day of The year working wiTh various insTrumenTs such as The sexTanT, alidade, plane Table, and many oThers. The few days They sTayed inside were spenT on Hnishing maps, calculaTions, or Taking TesTs. Compufer Programming gave sTudenTs a chance To learn The language of The compufer while using iT. During The course of sTudy some of The sTudenTs Hgured ouT how some creafed novel games for The compufer To play wiTh Them. a , 1 MA TH 4 4 s Mr. Hansen- MaTh Mr. Jensen- Mafh Mr. Hayes- Mafh This may look like a TypewriTer buf Alan Henson is learning To use The compufer. The snow didn T sTop Brad Pe Ter son and Rod Probasco from scoping ouT The area ln survey- ing. Mr. Welle- Science Mrs. Brunelli- Science, P.E. Miss Sandau- Healfh EducaTion Mr, Chandler- Science Professor Eliseo Faz mixes one of his greaf poTions for ChemlsTry. As usual, Glen Dahl does all The work while Ron Chandler super- vises, SCIENCE CLASSES BLAST INTO ANOTHER YEAR year immensely. " screamed, Hurrah!" The science deparfmenl offered eighl courses ranging from Science Experimenfall fo Advanced Physics. Each class had a dislincf funclion and goal ln an infervlew wifh a Pacemaker sfaff member Mr. Chandler admifled candidly lhaf he fell fhis year's sludenfs were probably fhe besf bunch of kids" he 'd had. He also said We mo ved fasfer and l fhink sfudenls were more concerned abouf fhe fufure. " To sum if up he added l ve enjoyed fhis Healfhy Living was a required course for fhose sfudenfs who wished lo graduafe affer 4980 The class covered such lopics as diseases foods and nufrilion, The dlgeslive sysfem drugs and under slanding of growfh and development During fhe semesfer course fhe sfudenfs look several frips. They wenf fo Valley Wew Villa and visifed wlfh fhe pafienfs They wenl fo Safeway in order fo price and compare foods and during fhe unil on dealh, ihe sludenfs wenf fo ihe morfuary Each sfudenf had a dlfferenf opinion of fhe sci ence course Thai he or she look Dm Bowles fhoughf Chemisiry was an okay class l wenl lo if every day," he admifled When if ended i Vocal Brines Music To Our Ears The Vocal Department had the most performing groups of the Music Department. Mixed Choir was a Hve hour class open to "anyone who likes to sing", according to Mr. Ken Schenk, vocal director. This group performed at concerts only, working mainly with ligh ter maferlal. The largest group was Concert Choir. ln this class, students learned the fundamentals of singing. They met live hours a week, practicing for concerts and contests. Their music was basically folk oriented but they also sang some religious songs, and some were sung in German. This year they traveled to Fort Collins for the Northern League contest. Students taking the class had to have the instructors permission. Wearing maroon and black, the Morgan High Sing- ers were the most active vocal group. Their style of mixing choreography and singing popular music made their performances very entertaining. They were often invited to sing for the various service organizations of the community. Their repertoire consisted of pop mu- sic and vocal jazz. They met three and sometimes five times a week during zero hour. The group this year learned new dance moves at a choreography work- shop offered by CSU and tried out for CMEA. These students were also required to take Concert Choir. The Girls Ensemble was active too. They were a community service group, and pleased many audi- ences with their angelic voices. As always, the Vocal Department hekned to develop many students' sing- ing talents. Accompanists Vicki Owl, Drums, Kaye Yearous, Pi- ano, and Alan Henson on Bass produce ood vibra- Q tions with the Morgan i-Hgh Singers. VOCAL -E E as C oncerr Singers rehearse choreography in class. Concert Choir: Stacy Boos, Lisa Goodman, Jody Gorreil, Teresa Happel, Vicki Owl, Susan Sand, Sherry Scott, l?ona Waldo, Carolyn Wood Deb Boroughs, Tammy Hamil- ton, Donna Duvall, Debbie Harris. Kristi Peter, Teri Price, Emllee Sagel, Jennifer Winter, Gemme Grooms, Sherry Bartz, Monica Bass, Kris Hoffman, Donna IMckham, Theresa McCartney, Heidi Watson, Cindy Farris, Kitti Parker, Connie Gill, Dana Hoff Jana Welle, Adrianne Wirth, Annabelle Faz, Lori Printz, Becky Ruppel, Sherry Bills, Nancy Weber, Matt Deal, Jon Karas, Justin Eisenach, Jeff Erickson, Greg Preston, Tad Green, Don McCartney, John Schoeneck, Kelly Stone, Mike McBride, Justin Stone, Jeff Smith, Eric Jensen. ingers .5 l Morgan Hlgh Singer: Donna Duvall, Matt Deal, Stacy Boos, Don McCartney, Sherry Bartz, Jon K aras, Carolyn Wood, Tad Green, Mr, Schenk, Emilee Sagel, Jus tin Eisenach, Donna Wickham, Greg Preston, Theresa McCartney, Eric Jensen, Adrianne Wirth, and Justin Stone. l FT7 S9 En T , .S ,.", V,-lx' Girls' Ensemble: Front Row - Annette Hobbs, Nancy Weber, Rhonda Spurgeon, Rhonda Wahlert, Lynda Price, Diane Schocke, Back Row - Jennifer lfwnter, Cynthia Wood, Teresa Happel LaJean Carwin, Susan Sand, and Jody Gorrell. Members of Girls' Ensemble singing sweetly at the Music Boosters pan- cake supper. Mixed Choir sings of the joy of Christmas at a concert. Mr. Ken Schenk - Vocal Director VOCAL The Band Marches to a New Beat The marching band, a liTTle over one hundred sTrong, wenT To corps sTyle marching This year. ln corps sTyle, The show is arranged around The music. The end resulT is o general effecT which is easier for The band, buT puTs more pressure on The color guard. The new sTyle was more enTer- Taining and fun for The audiences as well as for The perform- ers. Mr. Ware said "lT is more like The 'Las Vegas' showsTyle, which is more colorful The band sho wed more energy ana morale This year, which aTTribuTed To Their winning The divi- sion TiTle aT The NorTheasT Colorado BandmasTers Associ- aTion Marching Band conTesT held here for The sixTh year. The sounds of jazz could be heard drifTing from The band room during The Show Bands' pracfice sessions, and ofTen shared wiTh neighboring classes, whe Ther They liked iT or noT. The group worked hard for Their success. They performed in concerTs for schools and civic clubs during The year. o Ri Drum majors Miles Rogers and Ernie RodarTe hold Trophy. Band members who hekoed promoTe spirif wiTh sTyle Throughouf The year were: FLUTES, Sherry Bills, Sherri Bollacker, Donna Brown, Jill Brunkhardf, Kelly HerbsT, Karen Keller, Lisa Lind, Rose McFar- land, Denise OsTwald, Lori Pefersen, Becky Ruppel, Emilee Sagel, Barb Sanchez, Rochelle Schreiner, Adrianne WirTh, CrysTal ZweT- zig. CLARlNETS, Mary Anderson, Audrey Bleich, Lisa Buell, Sandy Chapman, Sylvia Dennis, Lynda Emick, NaTalie Fehringer, Carla Fischer, Raina Gomez, Michelle Finch, Rona Waldo, Toni Sprawka, Joyce Nukaya, Terri NuTT, Donna Hendrickson, GerUe Kunsf, Ka- ren VieTh, Kris Hoffman, Tammy Hoy, Robin Kalous, Sherry Luhrs, Krisfi Meece, Michelle Shivers, Cheryl Lebsock. ALTO CLARINETS, Linda Dodge, Tammy Alles. BASS CLARINET, Tammy HamilTon. ALTO SAX, Amy Johnson, Toni Nunez, Judy Nukaya, Dana Hoff Lori Wilson, Amy Helmberger, Shelley Woodward, Gina Uhrig, Carol Confreras. TENOR SAX, Bill Collins, Irene Franco. BAND BARITONE SAX, Ernie Rodarfe, Miles Rogers, STeve Robison, Curf Gibson. TRUMPETS and CORNETS, Eliseo Faz, Um Bowles. Barry Geisf, David Lauck, Brad Dilli, Nancy Meyer, Tony Gomez, Rod Probasco, Curl Drew, Greg Carwin, Mark Bryanf, CaThy Van Wyhe, Jeff Blecha, Don Keene. BASSOON, Kaye Yearous. OBOE, Ellen lGshimoTo. BARITONES, Nancy Weber, Gary Covelli, Bruce Vaughan. TROMBONES, Sherry Barfz, Brad Schaefer, Tammy Winkler, Jon Karas. John Bloedorn, David Esenach, Lori Gerfge, Lori PrinTz. TUBAS, Greg Holquin, Darwin Sagel. PERCUSSION, Frank Jlminez. Janna Welle, ArT l-loy, Vickie Owl, John Confreras, John MarTin, Jeff Schneider, Mike Schmidf, Gemme Grooms, Lisa Tee- Ters. BAND OFFICERS, presidenT, Ernie Rodarfe, vice presidenT, Miles Rogers, sec.-Treas., Frank Jlminez. BAND COUNCTL, Linda Dodge, Colleen TroudT, Tammy Alles. Eliseo Faz, Lisa TeeTers, Gemme Grooms, Dana Hoff David Lauck, Lori Gerfge. Q . sir ,ix .4 3- ' . 591. .. N. A 'izgif x L,k : LT his I h Q .. - - X: ' as T J , Q F9 'W V8 xy.. W , s - ' ' e - f , A ' , . . - - X .Q . .2-,v , i Q , -, .. 1 A. S '. .r ,' ' - as ,, ' . I ' .N 1 ' l , 1 .31 ' 'U 'K . " A 4 . X '- N 'z ' . - Q, 3 - .- A. J J vw. X 1 55 3 f . Q ggi.: L r,-LL . 9 wifi. RL- ' F i . T Q -X - - -2-is s . I iw-f f, grew 1 i-'kggiwfz - -- - . ,- - 1 Fas .,,- S - ' r ' . ' , 5, kv-. i,,a,,.f. i Purim it K ' v ' A faking .K 1 -' .M .-' W in lu . .1 -- , f 2 ,?':11Q,s5:vW-Bur, A ,' ?1f3'?w.M't1- - 't,w-"5-fthe. Q 3 ' . -, ,. . 5 NI E 1 CD - G 33 o 5 3 3 Q ff-.M , J N -1 1.-, - M ,. H I A 5. 'i Hg 1 W. wax mix g ' I xxfigi T , M is if is 5 . ml, 5, . E J 95, I D A is S35 - 'i g gf xx A .KP i' X ii I ' ' W X 'M ' I 4. 'sm sk , , er ' 2 , . .,,, sf T' 4 iff , K airy .3 ,li u ri. SIL Ar. , ,, M Y I I , is T as sw-7 . 1 1 , W ,. .H ,il V J I i , . 1 .i . , n' . 2 4 gs ' A s fs P A , 1 , , i l, ' 1 ' ,V rf. uv .ML Q ' a A' 'K Q B A I fmim hwy, ' A , A 'Zi W , A ' 'tl' 1 ' ' 1 - 4 'Q was vu" rl ' 'L'L' - X ' A Q 9 " an 1 ' 5+ V V .L K V! :I , , wijtiilxa-i ga, Wi. X ' I , V1 I .V it at V dvfiigffsz .KA ,g 'V ,V , g 0 4 'V-my' -' '. f Qj sg , V 1 A ,qw 1 ,'vf":'Y 4:3 1 rfsalf-,L PF' A gf, ' 1 f' " .'4S" , ' 1' if Wi 'l- ,, 22, 4 1" 12 . ,5,, . if ,',f,f,, M , , ,-..,f'., W - nfl.,-1 Lt "- of" H -f if 44 1 Mr. Ware- Director of Band and Show Band The l?ifle Squad added color and excitement to the half-time show. They were: Gina Uhrig, lrene Franco, Michelle Shlvers, Cry- stal Zwetzig, Tammy Hamilton, and Carol Contreras. Sparkling entertainment was provided b y the twirlers. They were: Audrey Bleich, Carla Fischer, Kristi Meece, Karen Keller, Lisa Tee- ters and Jill Brunkhardt. The Flag Line was excellent in precision and skill this year, They were: Flrsf Row, Sherri Bollacker, Tammy Alles, Linda Dodge, Adrianne Wirth, Sherry Bills. Second Row, Cheryllebsock, Colleen Troudt, Gemme Grooms, Natalie Fehringer, and Kaye Yearous. The Show Band pro vided the musical style of jazz and rock flavor. These musicians were: Flrst Row, Bill Collins, Amy Johnson, Toni Nunez, lrene Franco, Second Row: Sherry Bartz, Jon Karas, Cry- stal Zwetzig, Third Row: John Contreras, Eliseo Faz, Justin Stone, Jamie Walbye, Jeane Schoemaker, David Lauck, Fourth Row: John Martin, Frank Jimenez, Billy Albert, Mike McBride, Not Pic- tured: Tammy Winkler, Nancy Meyer, Ernie l?odarte, Brad Schafer, BA ND l 5 QP, Mork Reports On The Orch. "Mork calling Orson! Your immenseness, l wish to report on the land of "Orch" which l discovered here at FMHS. There were 69 young people in this group. They called themselves an Orch-estra because they all got together and played an assortment of stringed, wind and percus- sion instruments. Their leader, Mr. Larry Overton, said their C school orchestra was one of the largest in the state. 8 These talented students enjoyed orchestra because it kj was challenging and rewarding. They played traditional Bach and Beethoven as well as pop music. They per- Q formed at Hve concerts throughout the year, and audi- 17, tioned for the C.M.E.A. Cb There was also another body of students called the -S Chamber Orchestra. This was a group of 28 student musi- a cians that met every Monday night, even though no Q school credit was given. Twenty students tried out for All State Orchestra this year. Alan Henson and Justin Stone, two highly intelligent Bass players, travelled each Satur- day to practice with the Den ver Symphony Young Artists Orchestra. So, sir, as you can see, orchestra was a great experience for dedicated students to express their musi- cianship. This is Mork, signing off from FMHS un til next year. Nano Nano!" E 3 Q Orchestra members were: 1st Violins- Donna Duvall, Sandy Canheld, Brice Cochran, Julie Mellott, Lori Westover, Vicki Jimenez, Shelly Baumgartner, Patricia Keithline, Joan Mayiield, Cheryl Kitterman. 2nd Violins- Dan Overton, Cindy Mai, Christi Peter, Carrie Weimer, Kelly Stone, Jonna Snider, Archie Steger, Chris Har- mon, Bob Buchanan. Vlolas- Becky Pagers, Leslie Adair, Erin Mercer, LaJean Carwin, Theresa Bauer. Jeff Smith, Shall Jacob, TammyAtwood. Cellos- Tia Price, Jamie Walbye, Tammy Zambo, Gail l?uhl, Mary Stone, Terry Scott, Kim Homer. Basses- Alan Henson, Justin Stone, Sue Hobbs, Mark Young, Terry Heaton, Kevin Young. Harp- Donna Duvall. Flutes- Adrianne Wirth, Sherry Boliacker, Kelly Herbst, Crystal Zwetzig, Emilee Sagel. Clarlnets- Natalie Fehringer, Cheryl Lebsock, Tammy Hoy, Lori Wilson. Trumpets- Elesio Faz, Colleen Troudt, David Lauck. Trombones- John Bloedorn, Tammy Winkler, Brad Schaefer. French Horns- Sherry Bartz, Mark Bryant, Cathy Van Whye, Brad Dilii, Jerry Ekberg. Oboe- Ellen Kishi- moto. Bassoon- Kaye Yearous. Bass- Greg Holguin. Percussion- Jana Welle, Lisa Teeters, Gemme Grooms, Mike Schmidt. OPC HES TPA r Q 5 s Mr. Larry Overton- Orchestra Director Alan Henson and Justin Stone were members of the Denver Symphony Young Artist's Orchestra. Orchestra Council Members: Gail l?uhl-Senior Pep., Donna Duvall-Secretary, Becky Rogers-President. Back Po w, Dan Overton-Vice President, Justin Stone- Junior Pep., Susan Hobbs- Sophomore Pep. Chamber Orchestra Members: Sandra Canheid Julie Meliott, Donna Duvall, Shelly Baumgartner, Patricia Keithline, Bob Buchanan, Dan Overton, Gary Young, Cindy Mai, Erin Mercer, Jus tin S tone, Kristi Pe ter, Tammy Atwood, LaJean Carwin, Alan Henson, Becky Pagers, Jeff Smith, Shaji Jacob, Leslie Adair, Mary Stone, There- sa Bauer, Mr. Overton, Gail l?uhl, Tammy Zambo, Na Price. Not Pictured: Lori Westover, Vicki Jimenez, Carrie Weimer, Cheryl Kitterman, Joan Mayfield. ff' 4 1 3 . Q. K M W A .3 '??'Q 2.,f.w Q15 'qi I Y 1 ri sf .w'5v14 MF'i Vw if zu ' 412 'if I M -4 af m y Q A . 1 A:',A',4g, ff 44 44 M' 1715! s , 1 W ff Q , ,ff if 3' 'afpe nm , . ..., A, , ,J wg , V. l- .L M.: .1 M--, ii A W- . i Art inspires Creativity ln fhe Arf Deparfmenf, sfudenfs had fhe chance fo express fhemselves as individuals, even when fhe expres- sion became messy as if offen did when working wiih clay, painf, and ofher arf maferials. Mrs. Grefchen Lindell came back from her brief reflre- menf fo leach some of fhe various arf classes fhis year. Even Though fhere were fwo feachers working in fhe deparfmeni, fe wer classes were offered. Je weiry had io be dropped, since fhere was a lack of inferesf in fhis area. Among fhe courses offered by ihe deparimenl were Ari Design l and ll which were fhe basic arf classes ihaf explored fhe eniire specfrum of arf. Crafls faughf sfudenfs an array of mediums including macrame and rug making. The Poifery classes gave siudenfs fhe chance fo express fhemselves by making everyfhing from small pois and sculoiures, fo s ymme irical po fs done on ihe poffer's wheel. 15.-fa Chris Shull concenfrafes on O'Olr7Q a masterpiece in an Arf Design class, Mr. Gerry Thiel- Arf Mrs. Grefchen Lindell- Ari Darrin Eurich expresses his arfislic abilify by doing sculofure work. Drema Dibbins gels behind fhe poifers wheel and creafesl ART Pacemaker Changes Their lmaee The sTaff worked diligenTiy The i7rsT six monThs of The school year producing a new image for The Pace- maker. During The summer many sTaff members aT- Tended workshops held aT CSU and Colo. MounTain College aT Glen wood Springs. As a resulT some dras- Tic changes were made in The book. The sTaff felT a good book needed a sTudenT index and ThaT The academic secTion needed more pages, so The dedi- caTion pages were dropped and senior picTures were made smaller. T Also The sTaff felT since The yearbook is a cusTom made hisTory book more sTories abouT whaT wenT on should appear in The book. Many Times The sTories were refurned To Their aufhors wiTh more red ink Than The original. This proved To be possibly The biggesT challenge for The sTaff IT was difHculT To wriTe in pasT Tense for The reader abouT evenTs ThaT hadn 'T even happened yeT. One aspecT ThaT didn'T change was The pressure each sTaff member felT as The deadlines drew near. When room 204 was busTling wiTh a acTiv- iTy aT 5:30 every evening for a week, The whole school knew The Pacemaker sTaff was making an- oTher deadline. ln spiTe of The headaches and pressures The sTaff had fun and when The 4980 yearbooks arrived we had our reward. 4979-80 Pacemaker STaff Assignmenis Co Edifors ........... , ..... Nafaiie Fehringer, Debbie- Beaupre' . ...................... Jefilfef VVGU9 Business Manager . . Ad Design EdiTor ........ .... T heresa Vaugha . . . . . . Darren Euric , , . .... Crysfal Zwefzi . ..... Gloria Nune ArT and Design EdiTor . . . Academic Edifor . . . Assisianf Edifor , . Class Edifor ....... AssisTanT Edifor . . Organizafions Edifor Sporis Edifor . . , . . . . . Assisfanf EdiTor . . S Tudenl Life Ediior . Phofographers .... , fChiefj Ann Wacker, Kelly Sfone, Cuff . , ...,,,, Kim Bleic . . . ........ Jane Fehringe . . .... Dawn Baumgarfne LindaDodg Rod Donna Foonsor ....... ..... , .................... , ...... M rs. ,uoig Jesfoweaod eul Mrs. OsTwald passes judgemenT on Theresa Vaughan's design while Jenifer Warren looks on. fi? Q35 gas S132 Q95 CDHU sag 9212: ew Sbfc c23 fDqQfQ Q30 -QQ:-, 993 555 325 ogfb' QCDH 1055, 355- NQQQ E69 'Sie GSW N Q36 6 QQCU new ZTS CQU DCD-x rn cn NSN ' Darren Eurich creafes anoiher division page for The Pa maker. Rod Sassaman, Donna Duvall, Jane Fehringer, idm Bleich, Mrs. OsTwald. PA CEMAKEI? f...-1 - U gyr- Hoof Beat Rounds-UP Another Year The Hoof Beal slaff grew from eighl srudenrs lasl year lo 23 fhis year. Bur if was basically a greenhorn sfaff wilh only one sfuden l, Scoli Binder in Journalism ll and everyone else in Journalism l. New feafures were introduced lo fhe paper. Gary Fisher wrofe a humor- ous sporis column called 'The Jock Slrip' which poked fun af fhe idioiic lhings fhai can happen in afhlefics. Anofher new feaiure was 'Mick 's Pick. ' Several oul- sfanding FMHS afhlefes, coaches or sporfs enlhusiasls were highlighred in each issue and lheir picrures ap- peared in Mick 's Sporls adverlisemenl. A review of popular books filled, 'iPod Sassaman 's Criiic 's Choice' appeared in many issues. Although fhe bylihe ap- peared as Dr. l?od Sassaman, PUD., l?od allowed lhaf he was noi ils aulhor. Mrs. Haley commenled, "We had a lol of good feedback from ihe sfudenf body and fhey claimed they liked fhe newspaper belfer lhis year." Alfhough fhe sfaff was predominaiely inexperienced, Hoof Beat was popular and well accep fed by fhe sfudenl body. .X jjVlS l V587 JOOH Hi-ll 'fl?ONT POW: Terri Null, Debbie Cyprian. "hris Shull. SECOND ROW: Mrs. Haley. ince Alberfa, Scofl Binder. John Bioe- orn. Debbie Keene. Tl-lll?D POW: Larry McFarland. LaJean Carwin, Sue Hobbs. Colleen Troudf, Sheri Balken, Pai McMor- row, Kim Bleich, Lori Vanmefer. BACK RO W: Sherri Luhrs. Gary Fisher. Doug l?o- sener. Cindy Blachly, Bryan Weimer. Jamie Walbye, Darwin Sagel. NOT PiCTUl?ED: Wayne Scheidi. LaJean Carwin wrote lhe 'Musiang Monifor.' a weekle y column in the Fort Morgan Times. Meefing deadlines were fough, buf for Chris Shull dis friburing the Hoofboal fo Mr. Lewis is a reward. HOOF BEA T Keeping Body And Driver In Shape No changes were made in The Physical Educaiion DeparTmenT This year, buf This deparTmenT improves wiTh age. There were courses like Sophomore P. .E. To keep lower classmen in shape, and a dance class for Those wanTing To geT rid of Their Two lefi feeT l?ecreaTional SporTs had everyThing from Tennis To Archery. There were also classes such as Weighi liffing and Handball offered. The goals of The de- parTmenT were To keep Those involved physically HT, and To creaTe and build inTeresT in sporTs. Those who didn 'T bene1iT from This experience were The excepTion, noT The rule. Where else could you drive improperly wiThouT geTTing a TickeT? A T FMHS iT happened freauenTly To sTudenTs using driver ,simulaTors in The Drivers Edu- cafion class. STuden Ts were familiaried wiTh The rules and procedures of driving an aufomobile. Through The use of simulaTors, TexTbooks, films and acTual sTreeT driving experience, prospecTive drivers were TaughT The Things They needed To know To properly mainTain a vehicle and drive in almosT every siTua- Tion. Mr. Darrell Blachly said, "l pray a loT when l'm ouT in Trafiic wiTh The sTuden Ts". Upon comple Tion of The course, sTudenTs were eligible for sizeable dis- counTs on Their insurance premiums, if They kepT an A-B average during high school. Carolyn Wood, Debbie Pankow and Barb Kula enjoy volleyball in P.E. A "crash helmeT" is recommended as siandard eaurpmeni for Drivers Educaiion Teacher, Mr. Blachly. Mr. Darrell Blachly - Drivers EducaTion, Baske Tball and cross-coun- Try coach. Mr. Clarence Siern - P.E., foofball and Track coach Miss Becky Maxson - Girls P.E. and volleyball coach Mr. Sfan Lampe - P.E., AThleTic Direcior and wresiling coach P.E. AND DRIVERS ED. UST O Special Staff Serves Students There were some very special people on The sTaff ThaT we someTimes Took for granTed. and They should have special recognifion for doing Their jobs well. Mrs. PaT LaTTa has made our school library one of The l7nesT in The sTaTe. She also TaughT The Library Science class. The lighT, refreshing afmosphere made iT a pleasanf place To sTudy. Fewer sTudenTs meanT fe wer calls for The school nurse, buf Mrs. Phyllis Macneal kepT busy comforTing ailing sfudenfs wiTh TLC. Mrs. BeTTy Dahl was The new head cook This year. The cooks served a varieTy of differenT foods To saTisTy many differenT appeTiTes. The menu fea- Tured everyfhing from ordinary hamburgers To eTh- nic dishes. AfTer school. a "whiTe Tornado", our cusTodial sfaff. sTormed Through The halls keeping The school spic and span. Sally Securify, alias Lydia BosTron, braved all kinds of weafher in doing her job. She waTched over The parking loT, making sure no one lefT wiThouT permis- sion. New To The special sfaff were: Mrs. Polly Romano, who TaughT The educafionally handicapped To overcome Their learning problemsy Mr. Ho ward Le w- is, Teacher for The Career DevelopmenT class,' and Mrs. Joann Werner, who was The new STudy Hall supervisor. A L l ,J Mrs. PaT LaTTa - Librarian Mr. Howard Lewis - Career DevelopmenT Mrs. Joann Werner - STudy Hall Supervisor Mrs. Polly Romano - Educafionally Handicapped Pesource Teacher Custodial Staff: First row-Karhryn Marfinez, Mary Romero. Back row, Angie Ponce. Marcella Paulson, Elmer Schildmeier, Nafhan Hff, Harold Temple. Cooks: Mrs. BeTTy Dahl, Mrs. DoroThy Nabb, Mrs. Lydia Foos, Mrs. Carol Berry, Food Service Supervisor. Mrs. Joyce Temple. Mrs. Eileen Campbell. Mrs. Phyllis Macneal - School Nurse Lydia BosTron - Sally Securiiy SPECXAL STAFF , I ORGANIZATIONS TABLE OF CONTENTS lnfernclional Club ................ 54 Lalin Club ........ .... 5 5 Spirif Club ...... .... 5 6 Slug Club ..... .... 5 7 Spanish Club 58 Thespions ........ ....... 5 9 Sfudenf Council . . .... ' 60-67 FFA ............ ..... 6 2 VlCA .......... .... 6 3 Forensics .... 4... 6 4 Tri-M .... ..... .... 65 FBLA .................... .... 6 6 DECA ..................... .... 6 7 Jr. Academy Of Science .... ..,. 6 8 69 YAC .................,.... .... HOSA ............... . . . 69 lnduslriol Arls Club . . . . . M-Club ............ . . . 69 70 FHA 6 ............ ...M SECTION lnLrerneLil' na l lk32elaLi' rM Ceir cclw The lnfernafional Club grew lhis year, from a club fhaf almosi folded lasi year fo a club wifh en fhusiasiic, parficipafing members ihis year. The larger membership allowed fhe club io become more aclive. They had a cake walk in ihe FBLA carni- val, joined Laiin Club for a roller skafmg parfy, heloed hosi a welcome poi luck supper for fhe exchange sfudenfs in fhe fall, and in vifed ihe exchange sfudenls in Colorado for a weekend in Fon' Morgan. The members were inferesfed in learning abouf people and cusfoms of other lands, while fhey were also learning much aboui each ofher. X ---q.4 'S n B fm Q lUu S .Q A Q FRONT ROW: Dawn Baumgarfner fpresj, John Bloedorn Cvlce pres. J, S Lynn Gerfge fseoj, Colleen Troudf, Kim Bleich, and Grefchen Hume. GJ SECOND l?O W' Donna Brown, Holly Pickner. Krisfen Polanchek. Debbie M Boroughs, Tammy Comer. Mary Cusier, and Tammy Zambo. THll?D Q l?OW.' Mrs. Osfwald fco-sponsorj, Donna Duvall, Shelly Baumgarfner, Sheri Bollacker, and Donna Wickham. FOURTH l?O Wx Greg Holquin, Tad Green, Lana Wesfover, Kirsten Meyer, Karen Viefh, Judy Nukaya, and Crysfal Zwefzig. fNol Picfuredj LaJean Carwin, Pal McMarrow, Blair Lampe, Rick Knopp. Toni Nunez, Lori Wesfover, f?Obli'7 Carier, Eileen McMarrow, John Contreras, Curl Drew, Shaji Jacob, and Mr. Carr Ico- sponsorj. 1 INTERNA TIONAL CLUB i K ss"--NMR wk John Bloedorn is frying fo convince fhe lnfernafional Club commiliee To fake a irijo fo Mexico. Tad Green displays one of the cakes given away af ihe Homecoming Carnival cake walk. Kirsfen Meyer, an exchange sfudeni from Germany, poinfs out Hamburg fo club members, Lynn Gerige, Blair Lampe, Eileen McMarro w, and Greichen Hume. Vick Knopp drives Latin Club 's winning car in the Homecoming cara- fan. "ary Canheld is disgusted that John Contreras forgot his bib for the ge eating contest at the Homecoming carnival. .aJean Carwin is the 4979-80 state Latin Secretary, I lL Q b ite" How many students know what 'Nil Sine Labore' means? Latin Club members know and they want ev- eryone else to know tool This was the last year for Latin Club at FMHS. Feeling the squeeze of declining enrollment, Latin classes were dropped this year, but Latin Club continued to live with the helo of Mrs. Oberlander, the club 's spon- sor. The club stayed alive to support a member, La- Jean Carwin, who was elected state secretary for the year at last year's state Latin Convention. All year Latin Club had many money making pro- jects, such as selling doughnuts, working concessions and having a Homecoming carnival booth, in order to raise money to aide club members in paying their way to the state con vention held in Estes Parkin the spring. Latin Club will be missed but always remembered. 'Nil Sine Labore'-nothing without labor. 2 f ..1sis. 5 FRONT l?O W: Dawn Baumgartner fpresj, Pick Knopp T vice presj. and Susan Smith Ctreasj. SECOND IPO W: Debbie Liittjohann. Gretchen Hume, and Matt Deal. THll?D l?O W: Gary Canfield and Jeff A yers, fNot Picturedj LaJean Carwin Csecj, Danny Custer, Amy Johnson, Cricket Redd, and Mrs. Barb Oberlander Tsponsorj, LA TIN CLUB rx Q If 3. 9 O' I fpiiriik maikerf ukcflo the pam Coaches, feachers and sfuden is all agreed, fhis year's spirif was fhe besf ihai anyone could ever remember. Spirif Hlled fhe halls due fo fhe leadership of Spirif Club and a new unorganized group, fhe Slugs. Spirif Club began promo ring en fhusiasm fhe Hrsf pan' of school by having if's members buy T shiris which read, "We Raise Yell." The club fried oiher new ideas such as leffing guys join. As a resull Mark Madsen became an acfive member. Anofher idea was fo have secrei supporters. Each member was given an arhlere lo secrefly supporf ihroughouf fheir season. Some of The ways in which peo- ple supporfed fheir afhlefe was fo send fhem a sock wifh candy in if which read, "Sock if fo fhem!" Oihers senf Howers or a good luck card. This always kepi fhe afhle res in high spirifs, whefher fhe y won or losf. Spirii Club 's major evenf was Homecoming. The club chose fhe fheme 'Precious and Few' and devised con- fesfs puffing fhe fhree classes againsi each ofher fo gel fhe whole sfudenf body involved in ihe fun. The juniors were declared fhe overall confesf winners and won ihe righf fo ring fhe Spirif Club 's new bell ai ihe Homecoming game. Anofher new idea fried fhis year was a king as well as queen for Homecoming ro yaliy. Special commendaiions were given fo Mrs. Ober- lander and Mrs. Brunelli on fheir ours landing work as spon- sors for fhe Spirif Club. Joining fhe spirif makers was a new unorganized group, fhe Slugs. The Slugs were made up of guys who wanfed fo hep cheer fhe girls' afhlefic reams on fo vicfories. They were very successful in geffing good afiendance for fhe girls' afhlefic evenfs and more fhan one opposing coach was known fo be concerned abouf their noise making abilify. These are fhe spirif makers, fhe y all helped make fhis a very enfhusiasiic year. SPIRIT CLUB M r ' ' ' ' f.m:..ff , 'L if SM G24 . . swrrs rfss . 2 ,bi M.. s ,siis H . i.s, s J J . 'r W M1164 Mg A group of Slugs display their enthusiasm at a Volleyball game, The ofhcers are Robin Miller rpresj, John Ruddmann r vice presj, and Carl Underwood frefreshment chairmanj. Spirit Club members moved to a new meeting room this year. The last few years they've always met in the auditorium, for a new view they moved to room 145, Cheryl Lebsock and Theresa Bauer wait in anticipation for customers to purchase their Homecoming Dance tickets, Ann Wacker shows her spirit by wearing a "few" buttons on buttons and bows day during spirit week, Colleen Troudt agrees that passing out Homecoming Mums is one of the "advantages" of being Spirit Club president. FRONT TO BA CK: Lisa Teeters C vice pres. Q, Kristi Meece rtreasj, Shari Davis, Lori Wilson, Sheri Balken, Michelle Shivers, Jane Fehringer, Deb Williams, Susan Smith, Kelly Herbst, Annette Hobbs, Cheryl Lebsock, Susan Doolin, Kaye Yearous, Deb Ziegler, Nancy Benham, Gemme Grooms, Rachael Vasquez, Tammy Zambo, Gloria Nunez, Donna Wickham, Judy Nukaya, Diane Mallory, and Monica Bass. Natalie Fehringer, Crystal Zwetzig, Kirsten Meyer, Nancy Weber, Kim Bleich, Mark Madsen, Gretchen Hume, Eileen Menken, Teresa Vaughn, Lin- da Dodge, Dawn Baumgartner, Tammy Alles, Barb Burkett, Adrianne Wirth, Rona Waldo w, Deb Beauprez, Donna Duvall, Dana Bernhardt, Jeane Schoemaker, Pat McMorrow, and Teresa Kalous. Barb lrey, Kristi Peter, Terry Tracy, Trisha Keithline, Erin Mercer, Cheryl McCracken, Ellen ldshimo to, Carla Fischer, Shelly Baumgartner, Robin Carter, Julie Mellott, Eileen McMorro w, Deb Boroughs, Audrey Bleich, Sherri Madsen, Jill Brunkhardt, Joan Hass, Tracy Foster, Crystal Har- man, Janet Lane, Cindy Blachly, Amy Helmberger, Diane Schocke, Sylvia Dennis, and Tammy Comer. Colleen Troudt rpresy and La- Jean Carwin Csecj. CNot Picturedj Pat Bailey, Kim Brown, Lynda Emick, Kolleen Henderson, Martha Hosier, Lynda lungerich, Deb Keene, Wendy Kembel, Gertj Kunst, Sue Mason, Malinda Osburn, Gail Ruhl, Tammy Rehkop, Becky Rogers, Ann Wacker, Jamie Wal- bye, and Brenda Wheldon. John Bragg, Deb Harris, Amy Johnson, Angie Melninger, Kelley Porter, Rod Sassaman, Rhonda Wahlert, and Jennifer Win ter. Erika Boatrigh t, Donna Bro wn, Teri Deifries, Chris Shull, Donna Hendrickson, Cindy Mai, Holly Pickner, and Vicki Owl. SPil?l T CLUB LQ C KD Us at 31 Nr 9 U 3 Q E Q O L2 menf wifh fhe addifion of Spanish club. T9 Qre 5 Fr m fpa in " Spanish Club is alive in FMHS. Affer many years of frying To organize, fhey have Hnally suc- ceeded in becoming a realify. To welcome members info lhe new club fhey r held a pol luck supper. in which lhe y served a vari- efy of Mexican dishes. Following ihe supper, Ms. Mary Ann Lind gave a slide presenraiion of her lrip To Soulh America. ln March fhe club had a "nighf auf" al fhe La Paloma. Don'r fhink Thai all Spanish club did was ear. The members also had a keen desire fo make improve- menfs in ihe foreign language deparimenf. They worked on money raising projecfs fo repair head phones in fhe language lab, and fo improve on fhe maferiai being used. Foreign languages are on fhelr way fo advance- FRONT POW: Diana Contreras ffreasj, Teresa Confreras rvice pres. Q, Pal McMorrow rpresj, Toni Nunez racfivifies chairmanj, and Pose Ann Morales rsecj. SECOND POW' Lydia Confreras. Cindy Dominguez, Susan Clurfer, Eileen McMorrow, and Krisfin Polanchek. Tl-ill?D PO W' Mr. Darrell l-lolfz fsponsorj, lrene Franco, ldrsfen Me yer, Sean Colgan. Troy Schwindf. Vernon Mauzy, and ldfrl Parker. CNOT PICTUIPEDQ Chris Fonseca, Lance Hochanadel, Dan Nab, Gerfje Kunsf, and Deborah Boroughs. SPANISH CLUB r ir .g n Q L ' x asifl 1 is 3 y X , sl 1 f X , f s 1 5 i s 1 Lf-U' I'Uf' Miss Mary Ann Lind shows Spanish Club members slides of her summer experience in Soufh America. lrene Franco and Lydia Confreras Hll up on rhe exofic Mexican cishes af fhe Spanish club 's pol luck supper. The mlghfy ruler of Spanish Club, Par McMorro w. Oh! The excitement of being on stage! Sherri Bollacker, Rick Knopp, Mr. Powell, John Bloedorn, and Lynn Gertge strike a pose in front of the Thespian logo while staying in Colorado Springs. Lynn Gertge Hnds that disgusting "ring around the collar" on Phil Dalke's armor. Picking Their Meg ink me fp kiigi Ltr "Okay, tonight, rehearsal will be short!" cries Mr. Powell, even though it's already 9:30 p.m. But late rehearsals were what hekned make each of the drama performances a success. This was a year of new ideas. Thespians were adventurous and tried out a few. ln November Hve members along with Mr. Po well attended a two day workshop held in Colorado Springs. While there, they attended various sessions on dance routines, makeup design, special effects, etc. A costume dance, in which everyone who attended dressed up strangely, was a major event during their stay. ln December the club hosted their Hrst drama meet. They invited several drama clubs, but Matchbuff was the only club that was able to attend. Fort Morgan presented two one acts and "Perspec- tive," directed by Lynn Gertge. placed as best overall performance. The club hoped to continue having drama meets in the future. ln addition to the one acts presented again in January the group presented a winter play, "She Stoops to Conquer. " The eagerness to perform and the number of talented performers added a new dimension to Thespians this year. FRONT PO W: Sherry Bartz, Donna Wickham, and Gretchen Hume. SEC- OND i?OW: Lynn Gertge fvice presj, John Bloedorn fpresj, LaJean Carwin, Matt Deal, and Mr. Steve Powell fsponsorj. CNOT PICTUPEDQ Kelly Stone, Lance Hochanadel, Gaill?uhl, John Schoeneck, l?ick Knapp, Justin Stone Csec. ftreas. 1, Tad Green, Tammy Zambo Cdctivities point chairman Q, and Greg Preston. THESPIANS fupcsr flake filw wf Thei'r fliuff "De ' plane, Boss! De ' plane! " "No, no Taffoo fJohn Braggj, if's Super Slafel" Super Slafe led by Grefchen Hume won fhe hearfs of Flvll-iS wifh fheir Fan fas y island campaign skif. Follow- ing fheir elecfion fhey sfarfed fo work immediafely. Some members affended a leadership conference held in lafe summer af CSU in Ff. Collins. Sfudenf Council's Hrsf feaf of fhe school year was a 'pop parfy" fo welcome fhe sophomores. They also held an inifiafion dance fhe following week. Everyone fhoughf fhe band, 'Power Kuf', was ferriHcl Many new ideas were fried fhis year. The mosf dras- fic ideas were fried ouf af Homecoming. Since fhe parade was eliminafed, Sfudenf Council sponsored a hof dog supper folio wed by a decorafed caravan fo fhe foofball Held. Because of fhe 50 Americans fhere were held cap- five in iran, Sfudenf Council promofed fhe Chrisfmas Spirif by holding a con fesf among classes as fo which could wrife fhe mosf Chrisfmas cards fo fhe hosfages. Seniors won by wrifing 90, Juniors came in second wifh 83, and Sophomores had 50. wifh a grand fofal of 223. lMfh Super Slafe af ifs helm, S fudenf Council's fanfa- sies became reaffies. lff... S TUDEN 7 COUNCIL When sfocking fhe PX, Almond Joys make l?odne y lWller feel like a nul - Mounds don 'l. Sfudenr Council members Wendy Kembel, Grefchen Hume, Scell Binder, and Donna Duvall present a S25 check fo Mrs. Margref McGraw for lhe Hospifal Building fund. Natalie Fehringer brings sluden is up fo dale on lhe happenings in Sludenf Council. Grelchen Hume and Donna Duvall mall the 223 Chrisfmas cards wriflen by FMHS sludenls lo fhe hoslages being held capfive in Tehran. Mr. KarlAndrus fakes advantage of the Sludenf Council Hof Dog supper during Homecoming. Super Slale ofwcers are Wendy Kembel fseoj. Gretchen Hume rpresj, Bryan Weimer rsporlsmanship chairmanj, Scoff Binder Cfreasj and Donna Duvall f vice presj. .. A Fronl l?ow.' Wendy Kembel, Grelchen Hume, Bryan Weimer, Scofl Binder, and Donna Duvall. Second Ro wx Tina Pankow, Diane Schocke, Ellen Kishl- molo, and Mark Bryanl. Third l?ow.' Gail l?uhl, John Spells, Lisa Teelers, Teri Price, Kelley Porler, Helen Samuels, and Juslin EISGDGCD. Fourlh Row: Mr. Jack Benham fsponsorj, Ted Ware, Marlha Hosler, Lance Hochanadel Tammy Alles, Jamie Walbye, Blair Lampe. Eileen Menken, and Nalalie Fehringer. fNof Picluredj Debbie Ziegler and David Eisenach. S TUDEN T C OUNCIL L3 3 D Nr Q D Q FFR? Rl wr E si Rr mifilhg Future The Future Farmers of America TFFAQ entered into the new school year with a new sponsor from Vwchita Falls, Texas, Mr. Steven Holder. With interest in agricul- ture increasing in America, this club pro vided a chance for students to learn more about a worth while profession. Besides working concessions, the club participated in Spirit Week with two booths in the FBLA carnival. They also cleaned the school farm and had a "Green- hand" initiation party for the new members. A special highlight of the year was attending the National West- ern Stock show in Denver. lt was a great day to get t out of school and see some of the outstanding live- , stock and a rodeo. 1 During November, Marty Wilson and Harry Knaub attended the National Convention in Kansas City, Mis- souri, where they were treated as internationl guests at the American Royal Livestock Show. Some club members participated in judging contests at the lead- ership contests in Gunnison. These contests included parlmentary procedure, public speaking and judging of ivestock. The guys C there were no girls in the club this yearj, were ecological minded. They kept the school grounds clean by collecting the aluminum cans and taking them to be recycled. interest in agriculture is on the move and these guys were proof. FRONT RO W: Rodney Hergenreter fsecj, Justin Eisenach 5 vice presj, Ran- dy McFarland Cpresj, Harry Knaub C vice presj, Brian Kembel ftreasj, and Mike McFarland rreporterj. SECOND ROW: Gene Mcllvanie, Victor Ar- guello, Wayne Wacker, Kyle Kline, Curtis Warffeli, Jay Pitman, Mike Barber, Jim Firing, and Roger Miller. THIRD RO W: Loren Walker, Wendal Wacker, Don Longacre, Darrin Howell, Ken Roth, Calvin Haws, and Duane Bristol. FOUR TH RO W: Mr. Ste ve Holder fsponsorj, Bob ire y, Dallas Mavis fparlimen- tarianj, Glen Pitman rhistorianj, Gene Baltazar, Alan Walker, and Pat Earl. fNot Picturedj Dan Abbott, Irvin Bowen, Curt Christenson fchaplinj, Bob Eiring, Jim Noble, Alan Tadollni, Ron Werner, Marty Wilson, Joe Contreras, Glenn Doty, Mitch Heisel, Ryan Henderson, Ron Skinner, Craig Windsheimer, Jerry Yearous fsenteniab, Chris Cavaleri, Robbie Chilson. Mike Donahue, Pat Glenn, Martin Heisel, Wayne Henson, Dave Hoffman, David Lenox, Justin Page, and Chris Rodarte. FFA Justin Eisenach was elected as district sentinel. Randy McFarland heads the FFA meeting with strict parlimer tary procedure. Dave McCracken was elected as district sentinal. Not pictured, Randy LeFever was elected as district representative. WCCT27 Gew ce lhleectl New VICA 1 Vocational industrial Clubs of Americaj, is a club made up of high school students who are taking a course at the community college either in auto body, auto mechanics or electronics. These three classes make up the three different types of VICA. Auto body and auto mechanics participated in Spirit Week with a car bash. They also held an Auto Show in the spring and Hxed up an old pickup as a project, then sold it. The Electronics club held a raffle in October in which they gave away two Bronco tickets. Each year the VlCA clubs participate in various con- tests such as identifying parts of the. car, drive train and brake algnment. They received prizes and rec- ognition in the areas they en tered. Some members go to the con tests as voting delegates to represent FMHS and another area is job interview or parlimentary pro- cedure. These guys learned their occupational skills by being in VICA. Whether it was in auto body, auto mechanics or electronics, they received the experience needed for a great start in their future. FRONT RO W: Matt Thompson fhistorianj, Vincent Deroche -report- erj, Randy Lelfever fdistrict rep.j, Mike Sewald C vice presj, Tom Reagan fpresj, Tammy Helzer Csecjtreasj and Allan Rader fpresj. SECOND RO W: Joe Keefe, Mr. Richard Reiber fsponsorj, Dave lun- gerich Cpresj, Raymond Murray, Mark Yearous, David Lefever. Lar- inda Myers, Joe Jimenez, and Maynard Forbes. THIRD RO W: Chris Stroyek, Bryan Wulf Mark Marick. Monte White, Billy Kreymeyer. Scott Hendershot, Monte Bellis, Reuben Rios, Matthew Hoffman. Steve Krien Cvice presj and Clint Geist fparlimentarianj. fNot Pic- turedj Layton Clark, Richard Ferguson, Lee Jensen Ctreasj, Don Kembel freporterj, Randy Morgan, Lori Peterson fseoj, Glenn Skin- ner, Jeff Smith, David Temple, Bob Thompson, Bryan Traxler I vice pres. Q. and Russell Vondy. Mike Bailey Ctreasj, Keith Heitbrink, Bob Hutcheson, Dan Lebsock Csecj. Dean Reed fhistorianj. Mark Rusch. Wayne Ticnor fparlimentj, Glen Westhoff fvice presj and Nm Wunsch. Tyler Schell Cpresj, John Wiley. David McCracken fsec- jtreasj, Rick Krengel, Craig Cook, Marvin Hiesel, Don Waterman, John Kroskob, Gary Horst and Les Linker. Dan Custer ftreasj, Howard Crandall, Amy Harris fseoj. Sponsors are Mr. Gene Ziegler, Mr, Bill Walters and Mr. Kelley Mason. VICA F rrcmnficfp, Eine llllll iQ0lIllfFQ . When asked whai Forensics was, sfuden fs gave a variely of responses. One such response was, "a sludy of dead bodies." Forensics is noi a sfudy of dead bodies, buf if is a compefiiive speech class in which members go fo differenf schools on Safur- days, leaving as early as 5:00 in lhe morning, fo compefe in various speaking areas. This year lhere were lhree refurning Nafional Fo- rensic Leaguers CNFLQ, Da wn Baumgarlner, John Bioe- dorn and LaJean Carwin. Three new members were Lynn Gerfge, Holly Pickner and Tammy Zambo. QA, Q37 'S C x .L f UO i QPF The rules of fhe class were changed somewhai lhis year. ln order for fhe sludeni fo gel an "A lhe y were fo affend as many meels as possible and compeie in ai leasl one exfemporaneous speaking conlesl, which almosf everyone dreaded. The dis- lricf speech meer was held in February in Forf Col- llT7S, and sfaie was held in Colorado Springs. Forensics wanfed To lei FMHS know lhaf fhey were an aclive club. To do lhis ihe y had a foriune felling boolh af The Homecoming carnival and worked concessions. They also had T-shiris which fold the area fhey compefed in on fhe back and sfamped on fronf was NFL. 5' I THE "DEBA TABLE" SEVEN: Holly Pickner, Lynn Gerfge, LaJean Carwin Mrs. Sandra Sumner fcoachj, John Bloedorn, Dawn d Tammy Zambo. Crowds lined up oufside Forensics' forfune feling boofh affer barker John Bloedorn, convinced lhem Thai The y couldn'f live wifhouf having gypsies, Lynn and Holly, fell fheir futures. Mrs, Sumner unloads John Bloedorn offer along day af a meef in Forf Collins. FOIPENSIC S 5 J X 91' Mrs. McGraw lends an ear as Lynn GerTge rehearses her speech for NaTional Honor SocieTy 's inducfion ceremony. FRONT RO W: Donna Duvall, Becky Rogers. SECOND ROW' Coleen Troudf, Sherry Barfz. THIRD ROW: Adrianne WirTh FOURTH ROW: Tia Price, CrysTal Z wefzig W n rf Tai e E Leadership, CharacTer, Service, and Scholarship were four elemenfs necessary for NaTional Honor Soci- eTy. An accumulaTive grade poinT average of Three poinT or beTTer was also a requirement VoTing and selecTion Took place in The spring. The members were selecTed by a voTe of Those sTudenTs eligible for The honor and faculTy members. ApproximaTely HfTeen percenT of The senior class and Nve percenT of The junior class was selecTed for This socieTy. STudenTs and Their parenTs were recogniZed aT an inducTion ceremony and Tea held in The spring. Mrs. McGraw was auoTed as saying, "This is an hon- orary socieTy, noT a service group." FRONT ROW: Lynn Gerfge, Becky Rogers, Mrs. McGraw, Sponsor, Natalie Fehringer, and Colleen TroudT, BACK ROW: Brian Lampe, Lance Hochanadel Darren Eurich, Grefchen Hume, and Eileen Menken. NOT PlC TURED: Bryan Weimer. Modern Music MasTers Uri-MQ, is an honorary music sociefy for Those ThaT are serious abouT music and would like To excell furTher. lT involves approximaTely Ten percenT of The junior class and Hffeen percenf of The senior class. To be a member of Tri-M, sTudenTs musT have an "A " average in all areas of music, and a "B" average in oTher scholasTic areas. They earn The righT To wear The ofHcial emblem of The socie Ty, which signifed accomplishmenT and gro wTh of musicianship. lniTiaTion for Tri-M consisTed of sTudenTs performing solos in fronT of The faculTy members and Their parenfs. CrysTal ZweTzig said, "lT's deHniTely an honor To be- long To Tri-M." HONOR SOCiETYfTi?l-M LBufiln err ftuc-Tonk! repare T r T m rr w FBLA CFuTure Business Leaders of Americaj and DECA fDisTribuTive EducaTion Clubs of Americaj may seem To be The same buT They are differenT. FBLA consisTs of any sTudenT who has Taken a business class and is designed To geT sTudenTs ready for business careers ofTer high school. FBLA sTarTed The year by leTTing people know They were one of The mosT acTlve clubs in FMl-IS! They sold candles and l7sh The HrsT Two monThs of school and recruiTed close To 50 members by geTTing The business sTudenTs involved in selling. They aTTended The disTricT conTesTs held in STerling in January, and had some members parTlcipaTe aT The sTaTe conTesTs in Colo. Springs, where They sTayed in The Broadmoor HoTel. AT The end of The year FBLA along wiTh DECA hosTed an annual Employer-Employee BdnaueT in honor of em- ployers around ForT Morgan who have DECA or FBLA members working for Them. AT This Time boTh clubs had The insTallaTion of new ofHcers. DECA presidenT Jeff Ayres, replied ThaT DECA 'pro- vides worThwhile acTiviTies To assisT sTudenTs in career developmenT as They prepare To be markefing and dlsTribuTion leaders of Tomorrow." To be in DFCA one musT be in The disTribuTive educaTion class. DECA had fewer members This year, buT They had "lO0Z porTicipaTionl" They Too sTarTed off The year wiTh a money making projecT. They sold candy bars To heb pay The membership dues, which were 545, and also raised money To pay Their way To a sTaTe confer- ence. These clubs are similar, buT remember ThaT They are differenT and are boTh very acTive clubs. FBLA XDECA Kim Brown and Dawn Baumgarfner fill orders ai fhe FBLA Trans-Alaska fish sales, Shaving balloons isn'i as easy as one mighf Think, buf Roberl Henderson, Kolleen Henderson 's lillle brolher makes if look as easy as l-2-3! Helen Samuels and Linda Young were jusl lwo of lhe DECA members hekoing ouf wilh fhe Hospilal Radiofhon, Miles Rogers and Susan Keirnes unpack the moulh walering candy bars which DECA sold af lhe beginning of ine school year, Bryan Weimer sends a soggie sponge fo fhe unsuspecling Pal McMorrow al the FBLA Homecoming carnival. FRONT ROW: Mary Pal Honaker fpresj, Sherry Bills fsecj, Nancy Orin Cfreasj and Dawn Baumgarfner freborferj. SECOND RO W: John Ransdell, Andrea Mandes, Sherry Bassel, Sheryl Ruppel, Mary Whitney, Angie Mein- inger, and Elva Acosla, THlRD RO W: Kolleen Henderson, Brenda Whelden, Deb Ziegler, and LaJean Carwin. fNol Picluredj Mrs. Shirly Coriez fsponsorj, Carolyn Wood C vice presj, Dana Bernhardl, Eileen Menken, Brian Dowing, Sfephen Brocyko, Sheri Balken, Monica Bass, Kim Brown, Teresa Contreras, Sharon McFarland, Lori Nelson, Miles Rogers, Susan While, Sherry Bariz, Tammy Tehkop, Debbie Keene, Sheri Bollacker, Kifiy Parker, Tad Green, Lori Weslover, Keiih Kline, Tammy Loose, Cynfhia Wood, Kim Bleich, Deb Lilfjohann, Karen Keller, Michelle Shivers, Jamie Messenger, Rachel Vas- auez, Tammy Krueger, Marlha l-losier, Lisa Buell, Diane Conireras, S levie Mese, Kim Weimer, and Toni Nunez. R X Qs QR ,, ss FRONT ROW: Carrie Weimer, Cheryl Walters fseoj, Joy Solis C vice presj, Jeff Ayers Cpresj, Gary Canneld ffreasj, Sandy Re yez fpubliciiy direcforj, Susan Keirnes and Linda Young, SECOND ROW: Rhonda Wahlerf, Reina Gomez, Lori Lililejohn, Deb Williams, Miles Rogers, Mike Schmidl, Helen Samuels, Kay Rofh, and Sieve Walker. fNol Picfuredj Mr, Phil S iadler fsponf sorj and Judy Kinnison, FaLAfDEcA nw Q Il: Ill li feii'erfvvce if rgpehllzed llfnewiiedge Efperlweer Junior Academy of Science issued marriage licenses during The Fall SpiriT Week carnival as one of Their money making projecTs. Along wiTh The license, They Took a phoTo of The beauTiful couple in Their wedding wrap. The booTh was very successful as abouT 50 cou- ples "Tled The knoT". "The marriages were preTTy well dispersed over all Three classes," expressed Mr. Welle, "One broad goT hifched To Three differenT guys!" GreTchen Hume and Sharon Kinfner consTrucTed The false back- ground wlTh The heb of The resT of The mem- bers. Two members, Gary Fisher and Shaji Jacob did science projecfs for The Bi-Coun Ty Science Fair. The big projecT This year was The consTruc- Tion of a lazer which was given To The Physics DeparTmenT. The Academy also wenT on a few Held Trips in The spring. Mr. Welle, The sponsor of The Jr. Academy of Science was pleased wiTh his group and praised Their ambiTions. Nl Ili Gary Fisher records The resulfs of research he dd on an enzyme sTimulanT in Penfose Phosphafe Pafhway rPPPj. Jr. Acedemy of science sfudenfs work on lazer projecf under The BA CK RO W: Brad Schaefer, Mr. Welle, Sharon ldnfner, Amy John- son, Gre Tchen Hume, Cheryl Lebsock, Make y Gdffe Th, Bryan Mor- row, Susan Doolin, Alan Henson. FRONT ROW' Shajl Jacob I V. Pres.Q, Lisa TeeTers fSec., Treasj, Gary Fisher fPres.j. JR, ACADEMY OF SCIENCE wafchful eye of Sponsor, Mr. Welle. Tia Price and Karl Kronkow are "wed" in Homecoming carnival ceremony. .5-Qs: A 5 FRONT RO W: Teresa Cavaleri fPubliciTyj, Lynn Gerfge fPar- limenrariany, and Susan Tempe Tpresj SECOND RO W: L yn- da lungerich, Kim Brown fhisforianj, Kim Marick, and Doris Busch. NOT PICTURED: Susan Polacek Csecj Shari Davis, Mrs. GerTge and Mrs. Bernahl fco-sponsorsj. l L .. ' ' ' 's',, FRONT ROW: Mah' Hoffman fsec.j, T. J. Clark ffreas. 1, and Tom Chrisfensen Cpresj. SECOND RO W: David Jorgensen, Tom Fallos, John Morris, and Doug Fillingham. THIRD RO W: Jeff Morris, David Eisneach, Brad Reed, and Shawn McConke y. CNOT Pic Turedj Chirs Harford 1 vice presj, Bryan Weimer, Jon l-lun Ter, Jeff Kroskob, Russ Mylander, Les Car- son, Richard Pickens, Gary Fisher, Fred Deffenbaugh, Tim Crandell, Ron Tift Marvin Heisei, Brad ReicherT, and Mr. Virgil Graff and Mr. Karl Andrus fco-sponsorsj. 21: 9. 9 fouisnpul -UV S Dew Club! me he Tlheilr Debus Enfering inTo The 80's seemed To bring a surge of new clubs in To FMHS. Spanish club re Turned along wiTh Three new organizaTions, YouTh Advisory Council T YA Cj, HealTh OccupaTion STudenTs of America THOSAQ and indusTrial ArTs club. YAC's main emphasis This year was To provide beT- Ter lunch programs. They worked wiTh Mrs. Carol Berry, dieTician for The ForT Morgan schools, and Mrs. BeTTy Dahl, head cook aT The high school, To add a salad bar and calorie counT of each menu. They also planned To have a varieTy of sandwiches insTead of jusT hambur- gers and hoped To sTarT a breakfasf program. HOSA was formed by The sTudenTs in The Allied HealTh class aT MCC. Their objecTive was To "educaTe The public on healTh relafed iTems." They had blood pressure clinics seT up aT K -MarT as one way To provide This service. Their HrsT vicTory came when Teresa Ca- valeri was selecTed as disTricT I V represen TaTive, which was one of The largesT disTricTs in The sTaTe. The group also made ChrisTmas bags of nuTriTional goodies for HeadsTarT kids and holiday buTTons for paTienTs aT Val- ley View. Making a floaT for The ChrisTmas parade seemed To be The mosT enjoyable projecT. indusTrial ArTs club was designed To give sTudenTs exTra Time To Hnish projecTs for class or jusT for fun. The prerequisife for This club was To have already Taken or be enrolled in indusTrial arTs classes such as Welding, Carpen Try, Woodworking l or ll, Mechanical Drawing l, ll or ill and Pho Tograph y. For fund raising acTiviTies They had a pop can and beer boTTle drive and also sold Hrewood. The money raised wenT To heb Them pay Their way To The sTaTe fair in ForT Collins and To improve The shop area and dark room. The addiTion of These Three clubs plus The old ones kepT sTudenTs involved Throughour The vear. FRONT RO W. Robbie Gill and Paul Ferguson. SEC- OND ROW: Diana Robinson, Miss Debbie Sandau, and Mfs' Heffv Dahl' Mrs. Berry and Mrs. Dahl are Two sfrong promofers for YAC. YA C XHOSA XINDUS Tl?lAL ARTS CLUB l . mustang iswslhiewer iBec me falefp CQDFJ WM lf Throughouf lhe year, M Club busied fhemselves wirh various projecls lo raise money which wenl fowards fhe purchase of a video rape machine lo be used in review- ing Musfang sporfing evenfs. A few of fhe projecfs were selling Muslang Boosler programs and Forf Morgan Mus- fang keychains af home foo lball games, selling chances on lheir giganfic roulelie wheel boofh af ihe FBLA Home- coming Carni'val, and selling lighl bulbs around lhe com- munily. Even ihough doughnuls weren'r served ai fhe meer- ings fhis year, lhere was good alfendence. When asked To commenl on fhe meefings, presidenl Darren Eurich answered, "They're abouf as orderly as energelic afh- leles could be, " Also he concluded "M Club had a good club fhis year wilh parficipaiion up from lasf year." L, 3 Q s -- ' as s f FIRST ROW: Barb Burkeff, Eileen Menken, Brian Lampe, Darren Eurich rpresj, Lance l-lochanadel 1 vice pres. Q, Becky Rogers rsecj, Kelley Porfer ffreasj, Rod Sassaman, Robin Miller, Rodney Miller, and sponsor Mr. Blachly. SECOND RO W: Nancy Meyer, Scoil Binder, Linda Dodge, Nancy Weber, Sieve Vasquez, Bryan Weimer, Phil Dalke, Jeff Scheidl, and Manuel Sanchez. THIRD ROW: Doug Rosener, Carl Underwood, Rodney England, J.B. Whafley, Don Kembel, and Emilee Sagel. FORTH ROW: Ann Wacker, Nancy Benham, Keri Wendell Angie Meininger, Sharon Kinfner, Gemme Grooms, Karl Kronkow, Deb Beauprez, John Bragg, Terri Price, Allan Rader, and Randy McFarland, FIFTH RO W: Krisli Meece, Deb Ziegler, Ernie Rodarfe, Sfewarf Norrish, and .lim Colgan. M CLUB A A 4 sgsssfkssrs 1. Qs Lil-vs 11' 1' ' I" L.i is s A Rod Sassaman is lhe big wheel af The roulelfe wheel boolh. Shawn McConkey is under fhe sweel persuasion of program salesmen Bill Balusong and Glen Dahl. Mr. Blachly is Turned on by fhe lighl bulb sales, Sfarfing fhe 80's off righf wiih a pockef full of Musfang keychains! Wil Sfafe vice presidenf Kiffi Parker inifiaies lhe Forf Morgan Chapler's new vice presidenf Lori Wilson, while presidenf Sherri Scofl observes, Tricia Keifhline and Erika Boafrighf are Two of fhe members enjoying fhe inifialion dinner, Don 'f acl surprised Lynn Gerfge, we know you 're buying a scrumpous carmel apple from Diane Ureslel sms colow0 M mm V .f-""""-f N s N GROWN I 1Y DELTA COUN TFHWQ llflelrrar llndil'xvil'dLlall De nyc-rl pmenk "Fufure Homemakers of America is a sfudenf orga- nizalion designed lo heb lhe individual develop in fheir personal family and communify living", ex- plained ldlli Parker who was fhe FHA slafe vice presi- denl lhis year. Af fhe beginning of fhe year, The new Fon' Morgan Chapfer ofhcers were inslalled af a molher-daugh- fer dinner, Those inslalled were Sherri Scoff, presi- denl,' Lori Wilson, vice president' Diane Uresle, secre- faryx Cindy Wood, freasurery and Erika Boafrighl, his- forian. Because of fhe small number of members, lhe or- gani2aTion 's acfivilies were limifed lhis year, Howe v- er, fhey sponsored a carmel apple and hal dog boolh af lhe FBLA Homecoming Carnival, promoled special acfivilies in conjunclion wifh Vocafional Edu- calion Week, and sem' a delegalion of members lo fhe sfale FHA Convention which was held in Colora- do Springs, The Fulure Homemakers of America did indeed heb fo broaden fhe meaning of modern day home- making, FRONTROW: Sherri Scoff rpresj, and Tricia PO W: Ann Wacker, Erika Boafrighf fhislj, Cindy Wood flreasj Lori Wilson C vice presj, and Kiffi Parker rsfafe vice presj. NOT PIC TUl?ED: Jody Gorrell, Susan Sand, and Diane Uresfe rsecj, FHA 0 Q 9 ii AD SECTION TABLE OF CONTENTS William 's Children Shop .... . . . Ag-Nufrienfs Acfion Yamaha ' William Penn Clay Baskef ....q . . . Miller's Floral Scheidl Electric Redysfick Mouse 's House Mick 's Sporfs ........ . . . Morgan Counfy Banks Marlon Buildings The Wilderness Slore Morgan Look Service Downtown Business Associafion . . . Dairy Queen .................... Johnson 's Super The Studio Gene 's ............ . . . All Around Sound Bill's '66 Wonder Bread Sfone-Rockwell .... . . . Casi-A ways Kraffy Nook l?eia's Shoe Bourque Ari Johnslon, inc. Eauilable Savings And Loan Johnson-Achziger ........... . . . Forf Morgan Times ' mlm' ' K ' f , ' k: fa' ,f iffifgg . mg, ,... ., , A ,gif 7 'W' 'W Wx rw 'T ...N . AD SEC TION V55 m m' L EZ! ch I AG NUTRIENTS, INC g , i- IMA j" f 4 J kg 4 XV W A, For the beslprofessional service and dependabil- N U WN ily in Morgan Counfy: Confacl Ag-Nufrienfs, lnc. i m g 4 4 . if if We carry a complele line of liquid ferlilizers, K N jg " lg chemicals, herbicides, insecticides, fungicldes, ' 4.4 4, , 1 0 ymnk an awn an gar en eriizersin a lion o ex- " 'Q ff X L dl d d f fl' ' ddr' f ,XF x perl cusfom applicafions. nu , X M, -. V : WMM xv N f'A lV t Call' Lenard Lapp A WWf"'fGl i'lilgW AG NUTRIENTS fwvfoe- ' gel ' ee ' . !' .figtagw 155.405, Brush, Colorado y 2 842-5044 D2 Q Forf Morgan- Wray- Yuma-Slerling Y Q C L J, K J, 040:40 0.44 Z-f.44,4.r4,4..'i.41f . Aclion in Sales and Service 649 Main sf. Forl Morgan, co 80704 13031 867-7742 Darwin Sfengaard Owner- Manager 01. Perm Tapes and Records 867-5257 ADS Greenware v Open workshop ' Classes W D , . hlqy lpusluel. CERAMICS Wesf Hwy 34 - Waywardwind Comp. S05 Ceramichrome Painf ' Cusiom Firing 0 Supplies "Qualify Firsf" CL YDE and EL VA MILLER Phone: 303-867-8583 F TD-06-3347 4 42 Ensign Sfreef TEL- 46-2762 Fon' Morgan, Colorado FL O-C424904 BOB SCHEIDT 867-5396 0 509 Ensign ' Forf Morgan 80704 TM 0 Pnoouc rs F 6 N I 8 s , FWS.. 1, , Forf Morgan, CO EIEIII' ' 303-867-3384 5-,theidt 2 .LL,L, .L,,. ' .- PLA TTE and KiO WA 867-2400 Ff. Morgan Co THE MO S HOUSE 303 5112 C2 S U S Pb S LIIN IIQLTGIIF S JL qigugqjgqg ADS l Rex and Keiih Miokie Q i 867-8557 322 Main Sireei Ff. Morgan, CO 80704 YOUR FULL SERVICE BANKS I FARMERS STATE BANK FIRST NATIONAL BANK BUILDINGS Fort Morgan, Colorado For! Morgan, Colorado Of-867-9454 FIRST STATE BANK Wlgglns, Colorado The FARMEI3rihS:TA.T.IE BANK FIRST BANK ,1 iw awww Siore THE ASSOCIATION OF ,R qw MORGAN COUNTY COMMERCIAL BANKS 0 2451 IB I2 CZVQ ISI XVIIQIB ' mmgoim VIQQIK ES VICE " Lock Ours " Home-Auio " Foreign Aufo x ' Combinaiion " Business " Safes Changes " Door Ciosers . ' Key Duplication " Pad Looks Q " Lock Repairs ,M f O Larry Melvin- Bondeo' Phone: Day-867-2838 ff' Locksmjfh Nighf-867-2677 0 ADS tt fr - - 7 M 7 , lx li! f 5 I 'N 'i , , ' 45 Congratulations 1980 Seniors , 1 X' '-v--4' l 5 Q w r S Y I . ADS brazie Q LET'S Al-L. GO TO DAHZY QUEEN' your T ' 1224 Norfh Main Sf. in F 3 f f Xua- Forf Morgan CO. 867-6438 shopping needs C9 U.S. Pat. Off., Am. D.O. Corp, Copyright 1979 Arn. D.O. Corp. lt is because of you that this ad is possible, and with that in mind we at The Studio in the Greeley Mall wish , 7 to convey our deepest thanks for .. ..., - making this our most successful U . --': year ever. In addition we would like to offer our one and only special to 1981 Seniors. If you are photo- - graphed before August 1st, you will A . receive a complete "Senior Portrait Sitting" at no cost to you. This includes: iiii' R -ii w 0 The Annual Glossy 6, 0 An Indoor and Outdoor Natural Color Sitting 0 A set of 12 free billfolds 0 17-20 previews to view 3525.00 Value x 1 H y 6 ,fl is "l he Studio 2007 Greeley Mall Greeley, CO 80631 3037353-2611 ohnaonh upeu 1 zgmiuiiiiiiif ff 708 Main Sf Fort Morgan, Co We fake pride in every plcfure we deliver. Cong flafu 'afivndl Q61 srumo " 5 ARCUHD SQUHD Q l I 0 o Q 1 f To The SENIOPS of 1980 S ' P' 2 -'n 1 5 EELS? 6 ff mx x R 5 f 'EX Z ' r L wwf' e A- E 'tp 2 . bg is W ll? I. - Q .. ' i 8 8 i .77 if lf v 2 8 88 J fmswwwwwwwwa me Niiiylii Shop 8888 Ri -sfmm4 8888 i J fi 888 l 8 25 ' , 9 C 1 O, ll2llX!F ADS iN'U'01K Jim: JYZU. P f ll S 400 Sf f Sf 867 24188 OUITABLE Aavingb 8 Ioan ociation 867-8258 N Q lv-v-v and Your High School Activities Throughout The Year Every Year in ACHZIGER 5531 Read About Yourself Your Friends 149 Featuring famous name brand appliances and televisions including Maytag Amana Kitchen Aid Magic Chef and Gibson - Also Zenith television and stereo - Sylvania Color Television. We service what we sell. Tm: Four M0RfAN Tuvnzs WE THINK WE HAVE SO MUCH MORE TO OFFER . . These are our reasons why . . . Three prize winning photographers who won honors with 40 out of 42 prints that hung at district convention of professional photographers. . Backyard built up just for outdoor senior portraits Big 5x7 proofs Cnot dinky 310 x5 as offered by most of our competitorsj Our own color darkroom. Proofs in three days - master service and more quality in iinished prints. Low low prices for seniors. We will meet or beat any prices offered by any competitor. Most important of all is our desire to give each of you something really different - something you will cherish forever. SCHURE5 5 TUDIO We want to be your Photographer. We will never quit trying. 1 9 D X f Q . . , Q I I I l I Q 1 n n u n I Q n n n X U -' Xc,XxJ 1 1 1 I ' Morgan Counlys Daily Newspaper 4 2 3 4 5 , 6 I ADS B 690.4 is J -. 'vw , fw3i If M x ' w' ,S Qfkfxxg ,X N X jw 0 w X ffl, .N EE' ffff QXX g13fg'QfAf sw 47'ln'rW'We Y f , . y w 0 1 Q, f 12f2QM2aIZa ff f 1 If If f 7,1 zz ZWW4 MW7 0045 - -"ua, X ., ,,,f. N -..A J-f ?,3:..+.-F,W::.,Q ,. 5 ...f 1x0 Q 'Q' . X , ww F 0 . , W ,.,.,.f. -vw, -.-Q-W -V1.4--f-. l 0.1 1 .1 ,I Wf...1g,.f,.m.Ia,11,, .14 gh-,I 94,5 42 ' "fill," :"L"j', .."1""'1"L'f' ff? 'I'-i,"y"" -: wad,-. Q,-.v,-If ' :wx wwf,'0:'-::-'-nw 'Q-f.'-:-wwam .Q y-.' .Ma in Q-,-4: '4 9 ,',,q,' ,A-,'.,f,'4 4, Qf, .,,- 9, Q qw eg 4 ,Q Q Qi-1.5 , . , Q 9, , .W-l rw f 90 -.f se. f'.w'-.- ' Qmyff-g 0-..,-. - W, M, ,ogg-fs' 'xv - QQ! I J. yi ..f,, ,-My o-.'.f f-.0 0,4-.-an ,., sv , 0 ng , M-ef 'wp-mf' WL',"":'v,'1 we-3' ,+- pq'-mb Za ei' vi-0 .,-,q'v-.,f, ax-. , at Q Q o ,Xu , u,-..,,f,4,-,fn ' ,, ws , '. ox .. .Q qv n www. - f, Q-W 'lo X .yo - -.1 -sy y 42: -. Q - 'wm 'q,'. f,- 1 s. .QNX s 3 , . bs , -.ff'.60Qw'.:-12 fs X-Q. 99 x 08 Nw".-5ie'sA..1 -f..f4g45,3 -,,'- Q., Q ' ny x .7 0 2,9 qv,-, eevqv- ' gW'h."g'.'3.?: fx ve, XZ-:ex 0' . NN fix R. an W .1 - wr in . QQ., xg.: ,.' -Q, ax v . ,V . Z iff! iw' 'ivtf 'wlwey T N' NGJQ io' N5 63s s Q 1-.gm '-, f ae.-ee. ., .- xg! X355 - + vs, ga X Q . my '-.5 lax ',:.'tq.'. -r '7.-Q4 Q X. ,3 3.1: SSXQ3 ,I - :iff-. 'M 'f 0 1-.' .-9. -ex f we - . Sssi :hm-.,-..g,'.1 3, 4.15:-q.f.:3.' .fl Nc'Q..wg.b1:Q sy ii h 1. '. ' ,- :Q u vac- ft' it wap, gg, , yfsyx f , .,uf0,'4I X Q, X , ' .2-1-. 0 N ' xi' if ' 'QQQO Nj . ,f.gQ,p,,' .get-f ,-. e,v.,fs we.-. max' ees v' - fygvlx t.'.17qxns,?i www ,N g'qi 1.14 224 v '-bww -- ' - ' :fb Q x'-' J' ' , S N 983s A .-:V 'P74-f:sL-'i-z- rg-4' yea:-.-:vw -.f 3 Q ' f xox: , x,4 X sxo 4- f ,asc sf Q, ., ., Q X . - as sxsgqaqg' 'Go ., f'ff7 ,f f fifffrf ff '4 .-an :.-.xv '-7 s' - . x XXX X xx x XXX x XS AS sx X' x S x X X N X x x x XX -X EX NX Q SVS C ,xv FA NX P xx X XX X X XX X A X xx NX N N ,mtvsy-1.N..:.Sixs1 ea? six il ".x "i,Fx.f0 X 'age' fa' - X 0 Vf I, ' 5' ' R s f X 2' lv 'C':f,'f?- S' f, ' . x g' ', 'vip 'D ll 'f':h X ' Nei 99,0 'fig 'Q-,QNSQ f X, fnn' .- I JN: -' '1 'Z' f' .'f'3"i'f N 3 X ' o if 4.!,'ff Q' Hb 5 4 2 . 'J w . 'fs x - f 3 l"1 5" 3 'iii' ' Q Q 0 Q IV' 5 n' 0 ' x X 'QWO' Q, ,061 , -7 or N XXX '4"'1'W0 ' iv iff? 0 3 Q X A XXX 1'a,.' 0,1 I 0 , 0195. lo 0 Q if 3 W: I' 4" ,990 fv 0 . Q 'W' ?' 0' "af o"'a'f fn' Q ' fir' ." , Q fafg 'vfww ix w' X ..: .. If ' 4 'V I 04 ,Q . ' l 01:6 1 ' gist 5 ,Q fe. ss Il ,Q 1, 'oqflfy ' ' 'Q' 0 gs - 'fff ' If' l'0':' ' 'gay' ' X cb I Q' 34, 55.3.13 , P 6 Q 'I 0,2'fc'0q:, 4 2 f,.' Q? wana ' .. A 'ff ,"Q!"fL3' 'fi 4' "ln H A -n X X X X X X X X X 33gM,,w,,,U,wwmmmggg3g?:i?5G3f5iSN1Wwfiililhw5pf5g,mv5:,22q,Mgmggpgqgggillszgfi1321lit:,DWggghgig, .1,f:i,gg,Ms.wWfgg:gggzzzwM,A.:3:sU.m.wM:sw.M-:g,x.vM.wM-www-4: , NNMDWN Q Nw , ' Q W - H ' Ni 'Z wgmsgflfwzezwzzzgzg mangas: mam ,Z mfmiizitgq. 2552122112231 Mazsizsaw Ziliwvtsl xfizszzszf Wa W zztfzim were 7 Mzsiiiziiwwmw E Q :W5554-5g,g,5.QgHg:zaiQ:Df a,Um,m be V amz? gm: Hlfzsiiwkfzfsiif 02 , si3Eg5qzfw"l:5Ww2f'?ih 6' waz-1 'L 'OF' www, ,wqfigiw U N., U-wmsqx w.w12j1g,Qahww55QA H11 wH'QZiZ,1wWmnw, .ww.AZF"' xy "g,w4SwwM0MZH'?'M?0 if 'l23MPiZ'ZivPie"lZ QQg3,,,ww.maWwwfgzws Jaya ,wgzgwv ,nf mmgggww 3M Qgggnwwa ,QAM .aan w:?:1.mwwzf:t..m4 M , xwemaxwwwwbfvhaiw ,Ewa w.MMwg4w"'?5w wggmsw's.:mW3:EgM. in my ..mg3g,w,W35U ,wlgWw.vh,,mwW ,,wiEWA,5,iW Q , ,Wg3Ug,g,mQ,.m, k F U,igmb.pwgggwwwwygwog,MJi,Q3P,-My.3WQWUgWw5m3UMQ,,5g,,UWWW.Q ggwmw1lAmW5g,,MwAmqb.g.w 1: 2 'Wig liszmmmgm .glamgulflimwggizwp gfgfwmwwgg mqbgfmmwffzggz. mf ALwgggzgm-1awzgizfgzs 1,1 MWWWB'WfyFWF313151631mwtszowgssmvfzi mmwgfgmmwggwpmigmwm ,Elm ,ww M 'vliigzsam-ff? uwwggtwemgl,zmwfwgsmq.witzaw M'NewwMitt:.12wme:1'5l '?ZZ2biSw'W'M5SZ5Q in wifWf'FMi-'?ZZ'i2Eiszi?SiQ.1mssowfbiswwziiwwWm wwvigwwwalixwmwggwwttzw .Uwe rw Q-,g,t,Ww fm wffbfwwwfggmwMiimmmsyggww ,4 :mmm.53ggQL,W4'W14wN M, sgwmwivgiim 'U fsMwma32565WwwwewaswsfiiiwwffsgmwfiiifNew . fgziiw. 921222 limggzzxf'ifwggzsziiwgzzizwgggzigiwz2155:21w5QEgggg3,511235556,122211M111222112231Q:z2Qb3a:mfggz:i3ia1wggii,,, MMUf'l3'SwWZfliXMhfjg .awggtztwww szzittz 2221252 WW? iilwtsziliwgfiitmmiikwim.mggiiklllwf'Nikismwv212291.af'zz5123Simg.1335322Zwgwzjzizisww ALg,,,Qfgf'1Z?'2'QgZZT?X'ZZ2ZZ-Qmifiswillf0253553525gSXvGP2S5'i5Wi'2S' sawn:-wiwmmygfgw.,,Qwwg,J.fwgZWmwgUggQ, wiffgiwm W .2sswMawggsnUg,w.ug,4 UwziilmbwvwetilwmmWQ,gmmwNz,,,MQgmyg3,4,ipawww M-gegqggw 'zpggzqw .wwaww QMtgggMm,,,qwgi5gW.wqz:sfqsxg:'fQqvwwgg ,ma.555550QE,wf0fM,,,msfeg,,,,mgg W, NNW mm, WWW Wmm,fQZ5wmwgww aiwwwwfweMmezgbzpwmwegzsawmwzswmm fm wlmxr WM MQ'W'QiFYEe'2.vWmawfgqswfgfwwSammffsagsm 5:gm:wwwma?aiuUgzfimmatafmiwEQ 9 sszirwww :Q mziazzswasiwwfgfgmiwgggzfz!efieszgwgggezmi Q MwigizizieggmwQmatgxbaadwlmiiDwwwg - ,Q M, ww, D ww ibwwyly gwM,wNaN ,,wwfgM,,, wwE.:wU.wve3i'3Z 1, m,'-1Q'wg1g,,mwUg,,MM fwWQ?2,,gQvwk.Qwsw'-aswwwmwwvewiifih ewwvgbgilwswiiim wwmiwwwliwvw :Q mg: . mae M dwg, qmggsm mizazmQwwfgwgzgszzzziiziiamwig,zzfzzswwzamfE?a:1wg,:gmMgsg WWHWP:12:MWw::- ws W N , mwizzvwmggzsaia M, lzzww M5515 fzmazzfgi 'fstfsiiswwfgziil wristSX1lmwylmwe652224mmzilimswwwziiizziiz awmmfwgzssii2211122fnzzzzzxwzssil1mf:2'Tlwgzz:gwwf, M 1Q.waeyww3.,:x.5Sw w sing ggwww ,- awww, W ,Ur fm,,Ug MQ 533553, Wwwggwe, .V5Mai,g.,,Mwwg'2311,WwwEZEUQYQQMQFZSJQQSUQ Qwiywawqm Li ,wwfgjmgwwwfggggqowwwvgggvwwziifgqiwWiltwaupvali ,, nz y.qP,W ,W-M ,kiamu www UWSWWU ww. Dfw Q,,-'ilswwwtww NGN.-my Ngswtmwp , ggggIsaWwf:Smww:'Q5,gW.Wzview QW 'wzitwgmqm bn,ogiggawwwgggggm,afwfgiwwfvggemwzgzgww Haggis Q Q 4 z,:,m,,0. lay ygwgfib fi ,2223qwgszigiwaiwiiakllinmiigggt'M WEZKT. zaiggfwfa wggwm54512341gwwstiizimwgb3131593,ff ,lmmwiwzm .Qi,Awwwillawafgzgg,ilNwgi2f,5S2Qw JNs,wi'wQSwWH ,,U,wWwM ZZMW, W' W :manpage akw,,4Ww5b5,,,Qwwfa-wp an-,f me wsmwge ,, wav,2qwgumw?,,1,y,-bawwblLam ww swwffb-'5 wwgwpwgfwmswlQAWW1-1i'f?'wQaMwwa NWN, www 1 1 n 1 ' 'E " U' 1 H ggzzzzas Q wezfzmwxgiw'Hgizw H ,maxim wggzzzgpm, Jag. vzzzzw 1, swmggg: ' U Q Q Q Q X zzssiwm ez' W pmwliwv- .wfolim wwww wwwfwf Mwmww wwwwfzm ,, NUsSwtQ4wwwzbzmwwsfaiww wwffrilh-ffffw H?5U5W"SsV Sf 4 Q' Q Q ea HQ www, 4, Wwww we - mm- . H'QfgM,U,NQy ,Www UM.MM,v5U .Q wwwa W.,pQqNg,mMwwww msgid ,Nw-ms,-,,W,-.rw Mwavw--4 aw -ff 4 www, Zigi? 24239 1 ffzzzzsaisfzwmsf' Eszzzss. maize: P if W 'ill I ' ' ff E, , ,X f 1. y JM ,f ' I Q ,' , . , ,--- ,Q ' ' V ' A I ' N 13 M' k,,A i I Je - f .,1 fv It V .-'I X W V A,V' , 5 ' jx la Q D 'W , V V12 3, V - W-Y 43 w 'M' Q K f-Q5 We Left The Se venries Behind During the Seventies, events both na- tionally and locally not only interested FMHS students, but also affected them in some way. LIFE magazine suggested the following as the nation's top news stories of the 70's: the Kent State siayings, improving relations with China, the murders of mem- bers ofthe lsraelis Olympic Team in 4972, Watergate and Nixon 's resignation, the ending of the Vietnam War, the election of a 'peanut farmer" to the presidency, peace between israel and Egypt, the Peoples Temple mass suicide, and Pope John Paul ll's visit to the U. S. in 1979. On the local level, important news sto- ries were: Colorado 's hundredth birthday, the Hlming of James Michener's Centen- nlal near Fort Morgan, off again, on again plans for Narrows Dam, and construction of a 500 mg. watt power plant. Popular theater movies during the Se v- enties included Rocky, Star Wars, and Jaws. Students of FMHS enjoyed such TV shows as M'A "S"H1 Happy Days, Char- lIe's Angels, and Roots. According to many historians, the Se v- enties were the "Me Decade. " Many Americans wasted energy and hurt each other to get what was desired. As we left the "Me Decade" behind, it was hoped the eighties would be the "Us Decade" Following the Watergate scandel, President Richard Mxon resigned from the executive seat of the U. S. government. He is shown here on August 4, 4 974, with wife Pat, daugh- ter Juhe, and son-in-law David during his fare- well speech. C-3PO and R2D2 were just two of the ele- ments that made Star Wars a no vel mo vie of the 4970's. Possibly the most hideous news story of the 70's was the shooting of Congressman Leo Ryan, three pressmen, and one defector in Guyana, followed by the mass suicides of 944 followers of the Reverend Jim Jones. The vic- tims are pictured here. Arthur Fonzerelt, or "The Fonz", is the 70's image of the "cool" type. Henry Vwnkler plays this character on the popular T. V. series Happy Days. SEVEN TIES HIGHLIGHTS S 1 1 .1 " ,I L ,gsw -- 'ww 1 Q , 1 . 552.gif V , VIN I V .,.- .I .. gt . A , s X W si . TE W' 'ks sf, A , v 1 'Ls .. aw Y. . nfif' . .r ' sv 1.--w-,A...,,.....,..,,...,..... V. -of I . " ' K , 1' . 4" 'A Mm. , .V-sf if y . , ,,. ,, : V, f B s...... .-,..m,..,.,b...,, . , . . . W.,s,-.....e ..., WW, -Y V, M. . V sq V A r -- ..., sw., .... ,.,..,.,,,..-,.w,.. .9 M f . .... . . ..,1'glIf'ffTl7H..1ff.ffffffw' ' , ..... V. 3 ,,,., W M A My M I ..... W ,.., ,,,.. .,.,, I 9 .. """'fr1'4M-uve.-ggp. 5 WW-,..s..s,.,..M.,,.,, Mmm 1. eeyy T , H NVVVV mx nrgx H- ,... ......, PM-f H-mm Ads-.,-,,...w....,. .- - -,..,....,.,,...,..,,... W , -m.-,.-.se,e.M...sM-Y-uw. .sA..,,,...,....,..t.,, .,. gsm 'DM' .Mme-,f mf g,,,,,,,i,.1, ,Ativan . f-Vw , . , -. , M "f" 5 I A ' 'Q' r"' V rl fi s 22' . , . .... M .f . ,s...,,--.W lwssshgsw, us .:.,,mw. , ...W .,. +L .W.,... M. The 74 piece Fort Morgan High School Symphony Orchestra, directed by Mr. Larry Overton was selected to perform for the Colorado Music Educators Convention. Dinner out usually meant eating at Mac 's Lounge and Diner. ,. iii? Miss Lind showing what she does best- Pawnee Power Plant continued to grow and brought new fam- making her history classes interesting. ilies to the Fort Morgan area. 7979-80 Pro ved E ventful The year 4979-80 proved to be very eventful, in school, and out. Selected by a vote of the faculty, the high school's nominee for Fort Mor- gan 's Teacher of the Year was social studies teacher, Miss Mary Ann Lind. The Fort Morgan High School Orches- tra competed with 106 musical groups and were one of the 24 selected to perform for the Colorado Music Educa- tors Convention in January. They were unable to attend because of bad snow conditions, but at a later date, they recorded a record of their Nnest music. During most of the year, FMHS teachers were involved in a self evalu- ation of FMHS 's education system, pre- paring for the March visit of North Cen- tral's evaluation team. For a short time Fort Morgan made the news by having the newest McDonald's in the whole world. The Grand Opening was celebrated in Oc- tober with a huge response. Student Council encouraged FMHS students to get involved in world poli- tics by sponsoring a contest to see which class could write the most Christ- mas messages to the Americans who were held hostage by Iranian Students at the American Embassy in Tehran. Khomeini, TIME magazine 's Man of the Year, is popular with lranians but unpopular with Americans. 4 97 9- 4 980 HlGHLlGH TS Z Q ai 5 Q g 5 222 52.2 5 mL 5a' .5 -a :5:j:Eg Egg i3? 32gg 22 ggi sig W 35g8i m QZEWEEEE? QQ T? 22 :., , gg 5322 ,E 29 6 2, my 3 sw g:':,:2g ---- W 5-5.4 Q. Q EZHEQQQE? Q W 2 E ...... H 3 EQ ,S 1 s i - S 2s zg.2.2 2 .. Ii we E af B. S 5 Sq w ,fn 2 Gaz 2252 ' W as mis ....,. 2 f Eisifssmm 5125, fs me w 32 N 2 WE . 0 mfiiiiiifg wgsggeiyggwi 25355253323 fkfgmzw - .. 4 .5 W' Qs :5: ..:2g sm sas 8 3 481 94 .5 E S , Zzi. ....... .:,., 2 . 2 5 , 2:2 ..,.. 2.-.22-2. :. 2. :-' l'- ':j 57.2 :I 1'1" E II.'II :I .1 ,, .- 2 91 23 'sp W 2 2. ,Wm ,P 2 gg 92553 ,, Z . ..,. W 5 ..a2. 3, P 2. :2 2-5: Mags. M ,2 Q 45295, WQQESH , 1 R f Ei w ig? ggwm if mi? SS. we 'H E 2524222255 mwfgss WSW: gssvsiwfz 252553255 3535522 is Jimi 225352532 1 vwaf 5 555553 5: a siifiuiiilliff .ifW'f2 2 'W 5:2295 -22 5 5 is 2 E5 M, Q22 2 if :ZH ... Q2 42 QQ wg . 5 z 22. , . :. SE' ga gig? nu 2 2 35553559211 "":7'2 12 753 .... E25 H 2 22381 mi ',2.2 1 , W ""' E, K 2552 a 2 22 2222 22 Eiga? Q ?E:5??i :55f552 ,, S225 ..,. Q2E f:. :2.-:E MVN' 5253 iiga 2:-gf.-2: ,2,, fwff 2222 J 2 2222 . A E E353 3 f222g22 21:2 2222.-ffif:s5s2-22. 2 mg , ii 52. EEE ? 5' ESM - g s WS 5. E 222 E fig? W ::'Es.E:E' 192:23-223 . -... XE Y 22-21 --'- YS Ei:-i:'-:5:::2e3f2f2-2 "" 2222:2 ,g,.g. E: ..... . Ei 1251323 I -52222 2225 4 ff ,S IEE 5 4' . ....... -2. 225--: :-'::2:Q:2:2: 1 .'::::.:: :..'2:-. lm! E325 2 gi 3 52 'f 222 2r2rfff'2:2 M gf? 552553 5 Si 52 S Pg? Egg s 2 H z,52:252z2-22 2 5 1 2 K5 ,.,.,. if 53-E5 Q :'f""E:5f?:E'E2?2EI!-:E-:Ei 23e2:E':'5'E!:5:I:-2:2 ::::2?::-- 2:2222-2-:ws2a2.a?a:2.:22hs-2 -.f-- :-:-:2a2cszg2:::ez:2.2-: :-:-1:'::g:2:2:2:,2:,2'-am as:-:-:-: :.:..:.:.2.sf:22-:2:2 2-,2:,2.2.,. .-.- 2 mm ---- 2 -2-22-222.2.2.2..,., -.-.- 2 -2-2-2 ----- 2 2. .,. 2.2.- -2 ---- ' Q 15 z ge 32 2555 2: 2' 2 "'IZEE5.:5f-2:-2:21 is ..,.,. ..-. r2r5?'52f2.ff2'E5 5552:::,i2'25-'52'5aEfE2j2,f2 -si ex ME . 2 wwf Aw-was Q .2 ff 'ff25252fi?2-2'EEfiEiEF- f2fi5f:S?f5Q2:, 2-2 5515 """' 5 :-:-::-::: ' -2 2a,-a2 - : sr Q 2 3g5'a 2..21:2:,-2 -.--: 2:2'::2::Q2gQeQf::::2.-2:,':E:- 1:22-2-1-5-aw:22s?:2s2'I--2 -a--2:-2: :2:'E: " :2:-.- ----- -::- za 22225212-':22.2-2-5 :2: 2- ---- 2 ::':' E Sw5?g5gS?3vgEgXS3sWa3?agW 25Q QS I2-22-2-22 2 -:z::':2.f22 -2- 13 S 5, .,.,. M ..., .2 .--- g 2E ?i ?Qgi a 2EE2Eii??E fi2Q2?'eE,22 i? 22 E gg .... 35324 M A Q -. H2 2 2 2-ggi . Elf! sa? H 'eff E"ff2f2lf2f s:2-:2. S122 -'22 2 '-'-r :2225-23222222g.:21a:f:ag2:2 -2--2-222-22 za: a I zgfgg: , ,.,. 252.5523 513538 .:. ,.,., Q :g,,2.2 .-...... . -'2.2g:.,- ---- 2 ---- - .:--H : ----. :2:-- 2.,.,:,: ::-- gg ' 5 5 53 53355 f y v Q ,ss mfs ""f 2515525 13 E 5? 523355252 2352552532 Q72 2 2 2. T' 2 1:1 sg ----- 22 2.-- 2 2-r2ff.5ff'255552ff 3221 : 2:2 '-51f452'E2f2:2-if-3 255 222 t I : 2 5 if i 2 I Q! 3 15 22252 .. in , 3,5 S ,E 5 f ga 1 .,........, ..... 3 2 ...., ,. ...,.. ...... V .... .,.....,-. 2 2 .... E355 5 .... gig A ""' , Us i Iasaszfeia 2 2 M " Q ,, A 2.2 2 X . 2' . .gag-ag'-: QW . .:.2.2..2s2:-:-:-::2---:.:,:E.2.2'.a:2:-5:-5.-2-.252-I -'--- w s -- 2:,2..2.2.2-.,.-.-EE2.,-: --.-- .33 152 sig g E335 gym? 2 Egg 22 2 .ui 22 ii Eisfsgv Wi? sf? fy li fwgf wf wwi Q 2 22 SES ,QM WE kwa 3 -S 232252 3 5 255252 is 1232522 Wg 2 5 2,g222iE2g25f 2 22 2, E1 ff' H 2 2, 2 2 4 3 Q, ----- ii ggi ff525352?W kS Sa ,im Q 522222 i gi we g g 2125 5 W5 Jig W V35giS'EiSa :fs Z 52 -:Has 1 fgfl g :Q5 2-2.-. -2 :g.:, ----- :.:2,-- H35 2.2.-.:2: EEE 5 2: BEE 2.22.2 g .... , 222,2,,E. -2..,.,..,...2. 2452- 2.2.,.,.a2.-:2::25Q,2.2., ...... f 2.-.2 Q, W 522. X : 2 """ I . -wg -.- 2- 22552: :2:2':2:.z2:'2:22:.- M N H -Ia -.2..a,:-: -2:,:,s22- -2-:-2-52. ---- 1 .-.- a ----- : - -:2:'2: ,.g., 2-2-2 ---- :-. ----: 2:--2::.-:: .2. 2.2.- :2'2:'2:,:2:2: -:-:w: :2 '235g:-f- ,is2-:2'2: 2:2:-.-e4es- E X Q 2 '-'- 2 2 1 ..... '-"-' " ,.,.. . ..,....... . W aa. ..,. A W 2 af MN? as 2 5? me ww imwmawwmwiiww K, ,..,.,. ... 2 .2 ..... ---- " M' w WWI.. H lv 4 4 3' .... 1 2 . gg J -.:. ':::..f. 2 2. 5E5'EE-E2ffE:5E:':5 ....... '222' :2 is 2. 22 ..,.,.,.,.,.,. ,.,. :2 2s2-52222222-222 12352 25:-' is i 41 x .gs ef, www J fy Ms 4 sf 1 fimwm si QL- ef 5145 1 Q5-:2:.:5i2g: E:,22a1s2.2.'2:-2:. 2. ,, .:.2:. 2 .. Aw WEN ...... 2. . W 52 22222 Q gf fs' at fl Q' -' ' 52 22 L sz w e 22 Qi W ------ ..f.., f'Eg Jiki 5:2 -2- .2 ,.,,.,. .2. .: - 2.22.2 225 iw wg S vw Q 54 5+ wi Gmwg W W1 WW? V , fb -'j' E5E:E.g.: g f? 2 wifwmffifgg M 2 Pggmmgg 2? , gg 53,2 E 3 JSE ,.. 5 .... . gs ,gzzwmigwsi g ""' -22'222: r25-522222-2g2f 2:,::f:2:f5g'2Q2E5.-52...-'5:-I -g.:g2:i:::5.i-'Eg -22 -5.:g.-g22E::5.:g.-g.::. "" ' ZX3Z?:E?9i3sR .,.... : .... .--2-2:2-:,-:2:2.-2:22,2.212.2 ....- -:2a':X2:-'2:!:2.- -:-2:2-2:-2:2:2.-,:- -2-2,2--2 ...:."':::::...: '-:-f- ,,2:2:2-2:2:2:2.,:: -.-.- 2 ---- -: ::.:s:2.'fff--2-2- 2:2:-52--12:-.212':.'2:2g--2-2 'M www 2 22 252 522252 1. :.5:E:5 ,. : .,.,. 2 wmmgwgw QQWFQSFQVSQSGW ':.g2w,2.,,,mNwM:g,,595i,Vif.mmm, ,,,m SX pw , ,.,.,. 2 uuuu z in w ,Weil 55E ' 5aggQ 3Wz5'1gjgvg,,j fs ggrw 9 3152252 4 .... 2 2. .... 2 X25 5,5553 5QMZ,,g6f , i2g2,g:2f?3f5??2gQ?E?f Q 955556.ggigggaiigiiiwggglggsavfies, gs,21Y:,,vg,, -2ga5::5'2 -:2 uf. L .,..... 1 , 2 .2 X 5 ,2:.:2:2..:22:::-2-2 fwg wgggm . Egs sgw .2 53 5 H ww Q4 Q 'Fm 12122.-22. 22., .... :2::1: :'522 - ' :M S5 2,22 M X ,N H ff ..... 2 . Q :sigma , , 2. .2. g T 2 2 219, 2 32228 W 5 Q25 ' Tix iz sf 3 L Q . QW M1 Q r. ' M 1, 'X Q K' ' wg www Q T , T 'E 1:- 41 .... 2 : 552:55 ?f s "1' '55-555552552-522 2. ,.,.,., 2:F5f:5a'5f5 5: 'Zi m-55: -2-'l ,....,.... : .., .2 Xgg mggg ,. . 5 .... :I:':I.':: If.'fI.5If.'EI if -.-. 'E:.IE. S52 s -" -'::::::as::.'. M -2 -:- :-.-1: 2:1 5. 92.21 :-::: :e:':: :.' -2- ' Y I4 J ........... .2 -: -:--:- . 2.2 - :. :: :2.'2sesm2" Q. w 4- s -if ff 25:'2g.,.:::'::.:::-Q , ,2g2g2g wi 1 as T-fha 5 A ........ ---- , .... 4 2: 2:2 " -:- - - :- 2-:2 - 2 ..,.,..,,.,.,. ff 2. ----- --vs:':a-a2 .::2:.2:-2. 2 -1: 2: Q,2 .... I . I . fi 2 in .... 3 as .sf 4 'fx-4 . ..... 9522 2 2552 jj! QM 3355 52252 5 gg :swf w gr z gig gigggiigg rfx E v'r'fV 4' 2 2 a iivmf gif 35215 5 Ei 12 J-3 .mfirfw ix 5 +14-UQ 152 we ww 2 fig! vm X M 2251 4 5 mf 5 ' f la SQ 52 w M 122552, wf.n ff, mm i 52525 25 2325 1 51 Ri agg 'X H 192 ,DZ 1 S X .7 22222 is W 5221222 if 2 2 M' W SE 3552 Q. .. 3152 ..... M v ' 53 Eg Q 5 ""' ' 2:25 ,,.. 222 -aes' 1535 f .H if-2 2, , .2.2..2.2 .-.. .......... , W, , .,..... 2 .g,2:2 . H -7' . E img, 2:2-:2:z2-:2:g2. w Q14 V, H T 2 ,F , J: hw 'G' 4 'N rl . 2 55 A i s 2 +1315 .,..., My am t,,:,:...:.:..A.. f fQg AQ? af 1593 is fr J 1 ,w 12 Qfyw w 'WI'-2 J A . M + ,... 2Z 2x2Eg jjgfhivr -:- -:::-2se::2'.2222 ,Mi A my H 4' 5-5 55 'gf ' -'-'-'-" ' ..... 2 ...... , ,.,.,.2 .... ......... 2 . -.-.-,- 2 ..:..,..,.,. , 'VS .-.- 2 y W w? 'Ki 'f M. ::.'i: 222 25: E:2?2Ef'22:iEg:EE E:2.'5:5225 2.2 E2:fE5'2j2 22 :2 :2.:5?2:2 mg - ...,.-:- 2-2-2.2.2 .,.,.,..- :-- 2 5- x-: -5--2.22 :,-.g ..2 .,.,,....: 2 ,.-,: p,:',:-we .,.- Q .-:- ----- 2 -2 ,.,g:,"'E,:,: 2...:,E .,.,... 4 2.2 -.---:1:a:::.'a::,.:-:-2 -2-,-a 2-2.:2:.:-:-21:-Y-:1:.g::gg.-:-:-2:-2a2'2f2:,:.. -2-22 ..,, 2 ...:., ---:::'2:. :..2.2 .- .. 2..2-L-' :: 1:-:za S 23 2 .2- 59 ........... EXW 2. f i?-5552 522 2+ fi mm 5 M Wm .2 55 pNi'f,,:15L'f D' if mv --- .", ':': ' ' 555 F 2,3 2:2-5:32225 .,., 2 ,.,.,., 5 5:3 5 -""' " 2:2E2f"E-E:,T.-5:rE2'5252- E' 'IES 'sE:E: 'EgEr2IrE-iff2552212155532 2 2 -- , .,.,... ...:: .-., ,:,:, .,.. : ..2:-2:322 2 .,.,.,., 6 ., .. , ......,....:-:- , 2-r '2:,:2:,:... :--: -2 --.----- gg? -:-ff:2:. .::.: 2 3 .,.. .---- g '2:-:,-' ,. ... .,. -2--2--:2:gf-2:2:,2:,:,-,2. ----: 5:g::2255Eg:2:3 -52223552 -2 -:- 32 :5-5: 1- 5g.2g:':s:a: fj5 fx: 12552-ff2s222.22-22:2:-::fz-.-2 22-2.-22 TY 1' 2::::.'fg252a-222 sagwgii giagg 222325121522 2fE2f22'.I55a5575:':5 ,222 .. . ,3. ...... 2553 .... igfggmgi mmf, N ,2 N WEB 2 5.51 ,gA,, Sa Q .2524 g g ti wif 24 221 2 f .,, w i gm jg fi, 22 ,MH 22 wie ? W sgigg fu. gg f . Q3 af QM 9 2 H ws WE? N .9 GMM ,S ws 215 M QV W Q ga' , g sm , nunl as 22, ,,,, "sj?g2Qkg .... 2 Q Qwg2E5,W ,.,.,. A .... 2 552222.-2-22: ,.,. .-.- !52'52--2:'5E'5E2Eg gEg::i.'s:QE- !2'222E -E ...Q Q -E31'fg.ig?' :' wa -. 22EE5E2.E:E'::. :s:2i-'EI ':E iw. 62 'Q ---- 2 ------ 2 2-2-2. ..... 2 2 ..,.. .-.- ---- 2 ----- 2 .-.- Q 2 ----- 2 my is ..-.-.-. - 12.2. F ""' I :2:f22 -s.2a.2:5:,s- 2-2 :g.:: ::::' ""' W -s.:r..r:r-22 -::: :::2:2'f2f2 -2:2-5.5:2-2: 2:5:i: F A W., ,,,,, Y ' 'fu mp.. J .,'Q4 J V ' W 3' - M . ,I af Q . if 95,4 af? ' , fm 1 , Q, , 1 Maw , Anim-nu: V Y 22 A ig ' ',.,, 1 Q 'W A U ' 'A1mmf212if2fef::2'21s3:zzy:113qn21w ' iggyow 1 M. M511 ga ,. Em Qi.: 'bwvlf V"- K" ' 7 7 'V '-"wWSw'HZw-Hin-w .4 ff ,M ,nw ,UM ,iw Av H' . .' .rv N 4 0 ,, X ' A I' vw,g's.f:wq:2mi'21w '.", x - , -- L - , I 1:33314 ka if f 'V I 3 ' ,, A 'L'. , 4 ' , ' ll ,my-. in qw' 7 Q.. M, ,ff 17 f't7If7"' ?' . L! 'fl K L ,, L ,.. X M 1 - f , L is K- . , - im, s x,., i . 2 , Q . fp' -, rf"' A K S5 , - A V Q ,ii i ?' 'M ' ' ' ' . M. X " .. Q 1 vw , A ,., N., Q I 'R A X M? U. F W. I :X V4 ax is . Q' 2 ' 'I-4 x sv M , .af - K V L ' ,V : Q I . .I X 'f A 'A X ' X. it .. 'W- , W ,fy , , "ll X j v f k 'T if A " . H . l N - KL I 37,1 ' Q Xxx gf "'gg V 25' f -' Y - .1 V V L L A - , P 4 L L A UHN, m we Q pi T' 2 w Q g :,,x. -I , W . Q f 1 J f 1 A N vi P ,Q 05,557 A Wiimiiz Qmggm S1 we S Q E 4 5 K Q11 Q if QE Ex! Af 5 2 52 ' :,.. - .. ,. . . , V WWW... ,I H iffmgigm ::fa 'f2-'f22:'E.2 1s-. Wwfgfwswigggw wif qv f W M -Q 12 ' '1 :5. fi'95Wg23?f' ' Wm gixmgzf 23255. wwiziffi W viggwwigigwi ifwgmzsyezzswwwzmwwzzwsmyMQ W ,. , mE2 1i , . 5 r Sw: ffiigigiiifsgimzxd 223212232 .asw2iw2gEzQ2g aw 6 3 W i i Www N 39.5532 W wfwlw as .izgmifwm Qg.gssw2Dffw:w,gm mygmmzazaasiigmigngfzzaa ffgfswwz'fzsmg..f1 a,.ggwm.e,..W .Emfhmm aim' f ai:--:::.--1:1 - -:z S QQLEQQEQSQSQQQZQ Qggiwsww mfiiiwsz :fa JWii7s3'ig3f'R'555W9GSQEQSWWF23S17'2PWEsBi3Q39G"'H.3gE5?'QiEp9953W?P5'V? wgygzmiwz ifQ?wa22wwfaaz.m2.3,,w Qswiirwawviwimziiigwf -wifawiismsgsww 5 2229 5 ' - --'-- . f w i? 2s.,.m.pEg4wmS Q 2...www?giw-1mia2ifmgggwHg.wg.v1SwggxxwsMgzggmmsvefzizmeHmm' wggzamwwsawfggi12.wgwgggfwmggimgpgggzgWw,,g,gzwfggaiwffZgzaQ.gm,ggg,sew ami Wzmag Q32 Wggg i.: -EggQawS ?Q53 -::-g,:g :. P New sgiggiwgv wgigggmil 1 1 iigegggiigiwgmgwiifigzggkigii'Spf:Q535Z?5weefW1535212ifQwfwgwgiiiiiwusfwgim-M2WSE?-Sifiwzfgii1-w9S2WZMS'Swz eQgswsg.,5'2'QJifgQgwss, ggwagfafwmfwfzg Qgwwgis 9 swggwygzfgiggwgggaigam given L 2 galim sgfgewzg G wzigiigg 2522335 ,, .,2asQQgM351weassgowgeazfiigwslswggiggmsaimgMz2g252fggg,g:ezs:f22figgwizimimwwffazsigwgdgzsziiiigisimm,.mgaffsm:M3152Age2,..a2i62iEgm2qgEsg22w,QE:a23Q35246wings?533135. Mmm SEMEQEW QXESQQEQEZEQZS, gg xg wEifQgz.wzQggE,z?5wKE. 21222559myAgzgfggqsigmawvigggaiiiiggggggsgwaggmg5,.QgQygggm,..:gg ggQgLiwfw,aswggggga2w gggggzgggzsgmgim ,532 Qgigyfigimsfx gmzaggivgeiagggga, 2 EMWS QQ. 'SWQMWQQ W Q Wmzwwwiw 153252 W2 msmiiwsawwwfzmswa 152225505 Hmmm wg1QMfzw2mwffgz., U5 azwigezaswsgwzzaywaagilmfszsgsmfgwvg gW.3.Qmfgf,,Wmggz.wQgHH5f1wQ2..mi gwmfgzm Awww ,Q ai wiiiwzggmswisg gi wgggwmgzzawiiisgs ewizszffaggnsgggmffsgaf www?Wfwim..eWwHwimwmxzziMy gffgifgfg.. ff L., - M- imma aasszmywggibigfvwiwiivwg 'fmwwmigwiggmw'wzafzwgm wigweim M29flegmmwwzgsszw. wwwwmszif wswww-feMiffgzziwiwzmw wg,Wwwwwivfwfwvsizgwma?wwmiwzmwffaswwg gas. fm mem www 2: My Q we ..zQ,wsMQwf5gdg32g.,wg-wgiwfg.. ew. gms. piiygmwggs iwiwgggnxwggmvg w.w..,.gz1g Qiiigwsww, My galwaawggg wfgfmswsgzzwpmiw vggmwwgmw wwwmw 34463. vfgbqfpgwwmgg wigs iwyiwisgfswm fvggfmfggf 51 H .M.RWQQQ.3Q,QQQQWg1.-.23,,W,825-WE5.iwwfggmggwsggggwsgpin,ggggm m,g,4sg,5z, Mwwggw2i3ggffg,Wmg,,siwggxgfwwgzmmgqggmzzlgwwzgikmwJ?ffgzmwfmwegzwwgmzwgwagiggisgszgwgagg lmgwggw G .sw , 5 ?m2,W...M.,..f2 mmwm.hsiyzawaizesimiyw-afsfwmiifa53222222ffimiiwziz2Wgagmzzifbmgazzfs2gyms?was.1z..,.5fgqg2sagzw:,zQzi:iz 221mgas.awe25wgssaiivfiiigvfzzizgggmgiggggWMSQQQWEEWQE 525553 2 . 3322? . .. M .,WN.Y.,M21,NQQmeQ21emi?sew?5532221isggixsgggwggggg?zzsilkmimi5meSiiag,WimsimE,ggg5geza..fagzgsggze,gfzy:wy , Nm M pw, ,J .ff W. zz fi wfzwzff' . WNW: ff ' time .xiii iii-ig? 4 W" A 53? Wigs ??ff5i2 ' W 4 3 'Wi X 53532321 1 x- 22952 msgs ,mm Sf' 3 gg sam 25 5 542223 , 535542 ima 3.329 ff was: f 25221 A fwfiy E55 A '1 by A .ggi as mag ww. sf aim: wwgg Tigv-wif .swim 2 sms? mg? 2. may 2222? W ww w W fliwo E sofas? ww fi 5? ww , f giigiifi :wal S ag ..wwW...g...., , Sm? ' , 5 -2 A Wgsexwgiggzmww Q.. wifi? 5. was E 3. ggiegmfgggvgawgggiwsgigagsidwbmgavww. WV M gpififf amy a-'ai'-f'F.f:gs,:2::E,'5'2.ffI2-11-figs5:,s'g:.:E::-::':.-s.:.--5,-:,:I-:g:':'' , Pb K 2.331 552, iid gxiiiw 'v3x0'2"Wf 532 'Q' 5' Wx' 1 M. .V 1 W? 5:03 .. 91 "" : ' .. W .g .'EI ' ,". R Wifw ,K Wi wf ' wi Q 3 is W3 W 2fS'f if F ish ,fl 'Ms F 4 Wa S' W Wg f Dfwffiw .www Pf"V3w?3'359iH.w'2swfgg,ggggwW , .,.,,. ,W 15252302 X ! 3 ,.,. S P Q ifgmgivsw -v sswww my msg 21 fy whiwwig Hiexwm Emmy. as W Swveysgsw wig aww mimi- ,Wir-fgmm wg., ,WW ...QS S 1 .... z - QEQSS,-gzgswgg s2iswwgg1ggWSg,ggi,,.Afsi,v.zf,.w.gxf,f,:,w isfgm Swag wwwiswigggg gwsi ,fswfigw iwwhfiggg dwvgrasmfwsasdgpwiwlzmwwwai mgfmw Uv.f , - fi? '::::..- sg SW sig R wiwzws 5 Jima WWSSEEWQQWZQQQQMSmaiimwsg' Qffwiwgifazimwiswziz wgfffv-isSiaiizimggiaiiiikifggkiiiiwigfgifsiiigsgbigZZSf13'lgM3.S?ZZ?e3?'ffwiZ1"55sgifviwliiliiffixiiiiawmimmv.,W .,... sw .-.- . ssgiiwgwfiagg 21 wmivgsgiwgzsggafexggy ,awwgsaqagggmgmggiiimia53232550 5.152swggmmzwawqgwewqwfgzegfgafwwfg.:smWgE,a,wgmwA522ggfzssgwggzzswwggzzsWmgmaigzwgmzWWm,,,,. 2 ' R - A - -:': Qjfza igsifiggigQ3gwiggsiesimigzigxmiiigizggiiihgg 2ggiwiwiiiwfgasewgiggzgisggamg E EanyffSisewwggzsseswyhgigvfgfegmxzaf ffaesggaislsiigieggsigiasgweExiiPS3z:Egif-im?2.25:1.212222iswifi2Sif1z2amgaewgggzezzasgzgwpgiwig Q M A' 2' E Sfigziisesaiiwiwiifziggwfsi Qsasgzggggifwzwaigg Wg? W asaf.ssQw.gzaQiE?Mi22?iimw2m0?ziW Q fgwgzssawam2aw252Efgiwiaa3:saw5iamw?2EEPa0eEmgwfgfgsssggfsarwiswffazsgaglwwxwimeQmymfgsgsfezffkfmzfxHfaeiiafimzsizsgiisg gi amy A Q. Q sm fe ' M W 'Z MMM?weiezaiwwasgzggiwa M Q5-Eiwgfgwxgwoiwawzf E3 vi Q, MM 0QfqggE:5gwg5 S af: M 5' xiii 2222: 31323 ev 5412252 322:22 2:2126 E ,GMES 1122? 332535 Q Egg Q a m.-may 15923 E 122322 ...W :Q lsgigeigfg 325-ii U .iwgggvi Slang gi 335831: wgw if 2515953 V iiiiifff QQ , 15- 1532? 2223? 'ra figs? gizgpsg giwiigq ww may we . , mwmw , 322222 .mf wwe, ww. A gig? kim 1 Sw' wi' 335225 122252 wi.. . 12355535 Qifigfg 1 52223 M X is if 2 mf azz. 5 Ev f V is ggi? is . . . -- E::: ::: vb w Q gw2riV' - W ww? I f ' W ' - 415259 7 :.:.:,:' f:":1:fSf:?:sf Q .xi A 12 w 1 E W N EE' 1, X' 223211 ,gf - M ., fs? zz. uw, ,.::, :L-.m 1.5 -. ,. ga 9 M f if Bmwkgxilg ,ftwgw 35355235 Www.. av w,,...., A. . Em: .if 54,2-2 .... E ..,. , sa g 5 igiiwwgg 'Ky 3. We if sv wa., Saw 'ff ispsmwwigivmwwaam ww, Q fam ., Z Egg .. , we 5 32 Q wgw,wsgw:-1, 5 we-Eg 524352235222 wfg:egWm...'4.QwiEE3a.m,.1zQwgwi W.. ' -. -ggi: -:gf . Qgqigw 5 in Sggzwsg 2,..,-.vmffga me fgmvm. fem ,..,gfisaw,,,Qmay41fW.ffiwiw.zS:.r4w' .,s:s:22w2z:1:2:22wwzSi51M:s.s:wwggazgiffzw fwzvwwz z,.f....,,wi::Xasww..Qw 5' W f '- hhww k ffmriii 2315552 ,, - JMESQWESQ ' W 2 Q WW W EWS 'SWMBESL 2595 W2i"wg fffLibiEw:L:r.121'2. Je ssfww gsiym gwwii 5'gggziiiiwmq,W2'ff"?fgggWi W? Swag kiwi? 1512252255 iigpzif-aww Q '1 in E Egg? Z NW. .M 'W es L W z ' is 522 ' 2 EWS' 222:21 Y si gi 235.3 img 5 Q? 5' wing QQ 32222 .1 Ks as 113111 gi .ggi 22553 if lik. ia 2 Lim Q-Q eh sf ww mm 7 iii Q If gi 52255 w H1 si. iaifkc gg gk. im? 1 gg I Q .... . . Q. Q ms? 2 if W2 552 155 553 W Q sw JE :.:5.':: 23 32 W ' 1 2 W EN S5331 :ami . . W " M' 2 ,I A -r 3 If 4 MN5 wgiksiaspwmggkgib was isa G .MQW ,WWW V 'WawwwwaM,. . fe H 'Saww gggiwwsgfgggwoww, W, M we WlfffiviwssxmmiswW M.. M Q Q Q2 H'05M'Ww:'WwwSW , P 'S .wh Swv www. eww Wm MQWSW35Zixiizl'yrQgyy2ZfMbzizfiifiiiwmw ...W ww 331311 'fgggksgmeggazsmws-WW.. , M 3.5 ,awww RVWV . , P gigsf2W"22z,zz6Mgw'WwW 1. Q M WE. awwggas A 5 E5 wimgggi W ag ,. V wi! W 2 3 N' 3 Qiiiimif' V3 S RESZEOZ 4 Q g ,-. .. W Q Q was 132 i?ggi Kyiv..in2sz?QW2zzggigiggiiggiiggggiwggzw W Eg an . ,Z Q QW uma New ,Vg M,gw,,g. ax E wg' We W MmMw35EM'35'3m2'fi+x22w2Es1figzgiSizm2m R wg.. Q Q W.. "ow M E WW55'J5uf"3i9?5z'3wQfi54 9.5330 fa 'ww www. , Q W N H , Qwmjsyg NEW M N Wm. ww. ws ,ggEmi5ai.ZEggg?Qggfgi2E2Z3Ei255E ufgm M 4, ...,?.fN., s rw sm ,V ,, .,.x. 2 , www gxywgggeieii 1 R wa. few, 9 Q . . . siz.z.w,..ggg,, M, , X A We ffghmg fgqgsigggbailngwvygiwiiag' Rwwwwgvgliwa , ,mwgg . 2 Q:SWPwlwwiwffiigsssgsawiwmawawzwQzygizsawgmags ,. me .swggmwgw D H U nw myww,..is:,.5gmmzsf.gQgg5g5 Q F. 12sLMf'K2M,,w,, ws ,A :1Q:S5E5EsswPQ53gigggggilggiggiggivfgyggifg T, 6 gf 'ggggggggwggggaigggigg www ,, , ,::g:: K 4 4 . E Q. M -fm gwwa V .NZ ,pig we 3.34251 5, 129,-fm 31 W, ,bg ,e 4 W W Je K+ Q Zigi? EEE: 5 M3135 iw.. W . 2:-'fra H- 1 M wx.-51 , A M H- uzuzw is ., -zusmmawwgfv 2 ww 1 Aww: ,,.,ss,.. :fz,fg.. me , . - mi... Wgggigmyg Q Q Q ,fm sid .zwsgmf Miiwggmzg., fgahgzmiggimigigsalfosmwgzsswsWgwWmQgisswwzsamww.:.,5.g,Q W. W, 1 W E W5 i MQ,lsmwzmszzgggszigaffwf 'www wigs, gimszwwm21,312newfm::zwzs.:szaw:sf2:zs..:4weme.merzrzsagwm:1z.zaQggmz2M,..M 'Er.':a::.a:.gf:-55:-5:-E- . E- P-aff r Q w 1 'ig 5. . my Mgw seisiiw f2:i522?3s3?Qf:EgiQz5iwE35 Npfwfzfiw QgKWmHH'2idgziiSf'?i9gH63522729-QwfgzmPi23.5w'mi2iQgxfmgii?gbsaaifaaggfbwiifiiww:::k2wy,wv,sm sw 5 .4 E E '-I IE-1 . az: 'fa wi Q www? Wfwww - .wwe Wgww Wag wb we2i2::?0s1g,5avaSsi:mw 1 mgsww M Wa yfgiswwazi sfawwamwfwgi, wmaizwfwgglggwksfwgigiwwis. NSTSAMSZ wikiiaaiigimmmsmwggmwgzQsswgg Maw gy Emi M 4 'wggii' ww W ii 4-W Q iw Wy-rwgffiwg 83,-mgfwiy agfiemiwmszagwfwmw gf SM NiwggswwifgiimgMawSwmsswmgzzmmwggfsmawmgfiywzaiiwifgiwgzgszzmmwwwiWvmflziiiimJwwz.i2S3w:f'2MfggsWSE QL 2 mms: .2 S 33.2 ' azsgxiivwaly is as wa2'.AEagi25wms?swQ Exzmmgieiiggggsggmgz wpsfpvsimwgszdisigggazzwsi, meismpfgdwzszzis Mwiomzzrsg Qgw:,.fzM0sQwmmsezxiwgwwmfngwQemzzwspiwzwew 5 bww-5,11 wiswiiwiiwiwwiwfgnwsfsfaz wg mrwgwes wg my HffAm'5Se1f1z1'2vgg,wwm4 2zwisbilzzwsWm!Qipeovvggiiwsivfdvgfeau igybsamiwwgwgz,gsmgmmw.wwgfkzgzwwfafwwaqimgigfz W H eww sw 3,99 E, mm M mia? wizxwfaifvswwizzaaa W is Aim QW W' Q. waz: filwfaitip My aww mf ,,mwwsfwew:zzm:w. Mmwgwwwvwffawwgwsiggf FQ. wg,-.il 2 im Q. Wa Mxivumgugifizmswmiifceavgfagsaw-MES' iQg,F2M2w5s9f'Hfli1'5E'sf2e5G9,iw0Ew1gH'2iEieee5Pi Qgizwswiiiw iwwwwiilwmm iwwlsiifZfiiimwgwiw :iq WY-25 Ewan X N NP' Mf,H?fgegm2ggggggg.,53g5K QgwgwvgggizfisgeMzsiixkgwzmigiPas:JL2iiiQ19sqgsismigwzzziimiiwmawgizwgglmesg .qpagfxgaxwwgggxiigggifsggiapsgggg W ' Sw ff Mwwwff Www iwagv- w3,wIzJS1M,wi:1Q'f 'iiiuiiwfyw ' M W if gzzwisw Wi? QM WW lain Q W K Em mp, i1.1.QzQ1gaQ1E.211Mgr?222523,,ggimi3zggigggig9535ggggiggiigzggggggggjgiiggiggfgggggggiggggiggw Q .2 Q mg.,-,i wimw 825.3533ifggzggggggigigig-QWfggE:,BafZeigigggsiggqgigfsi52552 W ,iw 'mgezwwssaswpsgggz '7Ek?,2f'3g Q . gwgmmgwgiwiiiiigiWwsgizzssw 'Ea::::g.5::-:.-1. ...- - 4. 325 W Us W, W, lg 4 'Q M 1 4? Q ww W-waiiwmwggi si W W mms? ga Q W , Af H 4 ' Y x W: T1 f2i550Mw,,,...f.,s ww, . , f Q Q W .Q , . sw M Q Peg ,.WmZ0w,.iE?.Eq. W w A 9 QW S' f .5 X, M ,wzmx 3.53 Q gvwwdw Nm ww W, 3 iw was Sw M PW... W W wi ,Q 9 Qugsmwy Q Q W W ww M Swwiezs fb .Q My em wugeggfe me ,H Us wig gwsglx wb S Q Q Ee QXQPWF eima 'W 6-ma H www as 9 shew fi - ,,,, i ,..:. 1, an 'Mas-sz Mmfg . W Q.. we Q Q wh gs V -,.,ww,..,.:wg, S ,M W 5 Q W vggpgssdxigg X 3253 1. is as -- Mggmafz-.iisge gg Eg Samsswap Q ff MM Q a is kiiiiw 5 aiigisw - va , Q 5 we gi Q as MW Q. ww MsQEiz'?Z?g?Z3gs Eggiwgwgggf 2Eggg,gi,m55. AMW 6, 5 P .,, M gi Q W M nfl W Maw ?i,z,iT.'A2e. mwgggg aww wgggwga Q3 Q, ,wk kt Q Rf Q 3 Qwagisgafswwgwssgzef fwgwma mmwlg wma, W 5. ' Wmwsfww mssywzzwfiwxiwwezigfsww igmw, M Q Q M Sf Qsgmmffghsnsigiieis ,. Q 9 Q N gg shawlviwemvxwwmiawdwesn wfwiw wzym ,, we ge W M was mfgwzwgwgwqzifsaWswzesziziwgswi 0 55... S fs M1 ,, . ia .wx ywswwfglwgfgxmggigiamggrggiikgafgwysgigimzsggw M.wgQmi49 magwagi Wig vm, wg, pa W 5 was 5 ,E 5 QQ :gi ,. 2 iw E Qi .2222 3.2 wg M iw Qgiggw if Q wgigilifi wi iii gb 59 92 E XM ? QQ :wg 2 E Qggggg 31: 52 sei my 2551135323352 W if .NE sgfiiggigib if Q3 -5::5- "Q,:r Qt, T Egiiiiggggigika it 'EQ EQ wi? pg Zgegvg. ,fgiw A625 g ww il g g EBSWSEH QEEF3 .mg ,WEEE gi Q ,W 5 343,53 Q 25159 R WSE? Mm ggi sg 2 WQXXWQS gggmggigm E252 Q ii w Q ig if 'ggi B55 gig? 215 315323512 haw as 3322, is S 1 mwgagywgjs bggsgfg 1. E352 img ggi 3 , K Q , ,...:.. ..:-.. , . -:- M 'Yi www H Q A wma sw Sigma: wa., ,swf . -ff Q We ' i'L?i1:'Hw2ai?msa222 . V. N ,Q wg.. ., 2 , Q WM... f W if 3Qwwwmiyzwzsffggswmifgmm?Pggggggiigggsggggiygaggz ,Qgggqgfgmmggwmmww ma M W Q WW Mi ,,,.,,Qm.w,,Q 9 wm,gs,.Qmx aw 1:MwsgzQ.m.,..,QwmaszmwWa y1w0!a,g'mgg- 5, ., ' ' M""A S' ' wi fsswi 1 QSMMW 3g3wW1Wf2few?SQ wwwl Ygwgewwwewgiqwwmwaw .wiiwgawwrww - Ewen , ww 1 . .ww , K W N aww swggw ww Wwwwl, wgwfwg? .mmgw P- W as fawza W-.wmwfwm 1y.wwwWwm ,g , 5315 Q 4 Q M E WMP -msg fgmmwssakgsgww. W S ?w3weswMa Swawvgwwwzww M Qww-msww M ..vs104wmw Y Mg Q 4, Q . - Q2 W wm..,eww3pfgg,5 ggiaqmwaggwww gWmgQ6g,a'imwm ww ,www wwggggwwwm Q 3, NM ., W 1 Q, ,Q .0 ,l,.4W0mgQsffgW3,g5we1g,,2.915234 iwiwwgsppggggiqwsegsy Wwggmgwzexswwfzwvfw,igwawfafiiiwnaygw gd Q M . , H G Pmvs Q Wm 0-fwiwwzxiws,WA' Mom W Www K wmwyy- ,wygm ..wazmRw ea - gf ,, Q , H X Wm K M 2 Wmiiwwfeis imwggzamwsgsszEMsagaam-ggggmewzf,gsiwwgsiiwWm W w MHzzzeegmfeswQQawvmwbwwazgzzziliaf Q, M. fy- 0 MZ'.1isQimiiiivgziiiaggggggiywggivi i 55 an .A gin.. W 5 A ' ' H -f f: 14 hw WM W,,f:.w21S ,,g?,,1:zz:w N135 qw , EE si Q M nw 5 Q WW fb W ww 'figmw H ww, QQ we Hw,,5'e,myggy mf. w is mm, wg' M el 4 ww mmiwq rzawgfgwgwsM5525.ZfQfewwgggimgasgfwgggygwpfgagxmm, by 1 ff W s' ' 'Z ' ' wgwwwwwgm:isswgwa:wwgszsmffmmwfHmmm, X Q M as Q 1 3 Wg Wm WWE? f5SESQEQQQZSEQZEZQZQS3253353225522322SiiilzzzzawmPass..S W., 3 we if wgflw vw Mwowgswmw Paq,w4w.wg3vg,,5g.wQ2gsfafg2,.f2mmf: mf? ,am 2 L, V ' H W fs QQQas1as.Wyinffl9Maw:smW1wgs1azmwgzmiszzigafzzgshmggbm Q Q Z 3, a Q 'f Q w Q wma .faggwziiw fb wsgwfgzyw efggzmwygfpwwg 2.2.5 5 S ,5 Q 5, ifgfgfew-.,vgg gbggifggggigfgggggig . . ,.,. ,A we . 9 ,.'::-isa:-55.2. w as 6. ef 59E'L ' i w g22Eg33?gfYl:f.52Ei332:3EE2i2if:mayif Eiwvgi? gsm 8 g 1 . M .mg . W . 1 D 5 if af WN M Wk W5 i'm'3'5 Qiiilgggsgmi H505 'QQRWK Q B W M W iemfisiiig S,g,.HgeigiQ?si2W552283212222Q5252231siggffgizwgzwgw.gg.. .M . ai 25 fs gy wwgmgf ?2m"2Swzfg?XwgifiwfissgkzgiguasgqgmmgM..-.W gg. .B , ,A :Awe fm Nigga WffgsbKzS5'YQAggwzxg,-QgwggwigmESaszizwggziiigigiigggigifigiWggggggggwaggggigagi ea 'ire was gi wwgigggmsmgaggiiiggggi w 4 :E: :Ef. 5if-Es,-s z' Q Q. H za M...22sz3afsiiai?:EEi125aEi2.gEQiigi 'fzezfsg mm . . 'M M MMNKQQQEQQL W W, P - ff ' H A ' ,S ,, Q wma 1.mfffs2w,.fz vgg-ggggygg ,gi Gigi Q Q Q3 in ww, . .9 y , A A -W H2425 .lil Sisziwfgwigi mf' 0503 w' 0 s Q. A M A Y. M,-.awzwn 50 EE f,gg,w,g3,g5g My Q M. Q M A anf.Qs.wQfsfziz.Pa2w2gE,gLWV' Q if A W , w M W.. mfs: .wwsiifi-fs? ?i3?,J3gZ.5-61':'g,',3'2'-.QSYJQ-110 . -.Q . Q, M ,M ...iw .qwwgvgg , 5 Wag x..,,4w,f W . uw 5, 2 ' 4 A X 'Q '58 ff IEW X an ,,- 'Ugg' . mf .IWW Nw Z 21522333313 3 ....,....W 32121 53 Wwmww P-QW-.w:,fI.I.f:, w,'gy..,zf F Wfylwz E-IzgwU2QIg:,,z.I.. 5 Q...ggf-,wQ,g2'fgfW22eZ1Zgzz1??2t il I .I..f:f.22m.I5ggE-Qgggg.ggi 5 ,, I1 WZIZ g,.,.53,2, N. .,..Im,.,wgg:35ZFiB:Ztigigggsyggmgzzfaaig .N I,31:2s.g,:sI:11 IIQ:s2iH15ZIw2.ZQSfmfIw:z. fir!! wggwsw gqjiiiixg , .IWf.I...If-:Mm H?-'wgm www WW gxI.ImmWaw 1.I.H'gmM:.I ff'..fI-'wIw,g.Im.Iffg,,...I.1g,.II.f-Q., I.IfIg,,,,,.,,..YIIID N. .WI mggnwgmgfgi ...,IIygg,..1 m,.w3g-WI.wIIi.I.s.g2myg,,,.n,v,,mU...MII gW,.II,3..w pybwgi ,wgwxfvh,.If5gw,.,Iqy, , ,. .I.W:zawgm3z5s:S1?35S.1ep 51:2 -...am zz: Ieigafmggg I .qw I, ...fig gg. . 1: 1221? ssziiimiiiszgf-S1622 Zz gifigziilizzaailigzz-.3525 mail-3,551 Y - 53345133-.I g--I: ,WIm.Iwf:QSwf1..e-IEE.-Iwvzw-SiifHfZiIWHZ.I-W T.w411,,wrH,:w1g.,4I ggg,yq,gw3III3i,M,..IIw,f,1IIffg5Wwi:gM gzmigf ,II H:,,Iw,f.f-mmgv..-..ggwg ,,,wWIw3g,wfgfg.Ifaff-'fygfww WII-zapxhwfsmisff-gMIwgZ.fv2'EI..ww-ffxwzii. g:IIwgiIw Lyj2mg.,.I.IIIH55 w3,,m-gf.I7Q..In,Wagga-.f53I.nzy,.g.Iig,,. .ar13WI3gg,,..gg 5'2,f5j,,,..I,II3.5,N5 41.-.s1gW,.,.Ig-E33 H55 ,f.,Ig..2.-gg.-ggI.IgIg5:fj3,?..g,gUgm5 f - f .w lffizff fiiiw -2Ivg:ifQ1::22I:rf1z:fI .. :zsiIgg2IIf::.I-:slI5aais11Q2Mg,:Igg::III1:12limsaw::-sigma...W:faiamsQ..gg::...ggg ,w.IggS5gi,1pg.Wgs,..wge:mgg:,5g3I,Qgm HQMHSZEQWHIIESI--ziihwmzzslzfiiiwI5-3532-ZW-122121-Y-iima-zzfilhfiif-M1112--if" ..I1ifc:i14f-ziiwziwzz . ,.wzzilwz:z5.I.fhei.::.iZ.I.1mZ2fw53.IIfII2in.wwggz..I52IIgi2.qg2s.Iwsi.ag::2.wg:-1II.xgfg:.:..gm:a.W3,gz:IIgg1g.,.gggyigfzgwgIg1gI.,F55,,,,I2.-gg,...352g,.,.ggigI.g,,6..2g.3-gg,...xgigg, Hiigwg.-355-'g'iw?z':Iw:'1:1....I.I.wfzfzwwliI.wvZi'g,W:3wN3!Q.Iw:1:.IifQ- ' M ,.5..I-izlwzziwilwg . QWII 51,14w7LffQ5N"9f'if.qaWWf1QkS'NW'24J,weE3g2sIx2g1,,,..5A0,-wgf..Iij,g,A5n4v3f4iQ,Lyi75WvFggx,I.d.fg,gQwQsaijg,U,,,.,gZgi,,I7335,wig9,FEgjwvgwiwgigmggwmzgysvgm.. agWgg,M5I3ge,,,If. iH?,wmII-wwf:.pwMiha-Iowan..I.ww2:.w:w Qf:,,.IfIQ-we-.Iez-,g.I.QY:',1I'g . a II ,.III.,:g.wu,wAg,Iw-:UI ...Ifg-ww IQ.HIIIvQ,Mg-IbI5-:.If..ffbzg'g',4,.Iwgg5Iwgg,..m.w :Ny .II-Myew-1,g,Wg.WEgg...I3U.,I.w5zIIwf-fg,Iwzmm,,.fm...,q,,.IIw mfg?-.wIW,.I,,,g?v,,,..pg.i,,?I..g4fz,g,.w5e,t.,.III53,E waabigvriwwgzII.Wg,?:.Is.I.Wfg,. .wffzwb'ss-s...I,f9..I..yIg.fSgHhw.wI.I - .I.,.IIf.Iwiww-g2aIQgga.w14II: III Mggzw imxIg-.fmmwzwp-.gwwwg,,,...Ig1Im,f.QQ,W.gwI.A .WWIggwh,,mgmefagW..5M,,.,.I,:gE,g,,.3g,,,,.?:m,,,HM,,,,5AM,35w,.Mg,g.fm,,Z35w.gm,,gfM,,15 M,..ZW,,,,g.Zmg,3 ai-f'i2..Iwg,.g wEsIwf':,,:I II 1 we5221,awgrfziwgiymgggwfggliw5g,ZI..ILS-4' gi? I-gf Z , I I .351'NEZESMPZQSM-.Wave-giwi.Ig',1'.I'1 H525 H51 M3135MffZ'eww0gZ.Iwg2i?i.wf1QIQuayQzw, Mgg.-I-5254Iggy..wivzggmmmMmSMW3Qg,I, 3g52,,..,Xgigg,Zg345I,I5gg,?pgWM5.,wig,,.gQW. Zgaigggmgg-3g,g,,,,. iwifi' - Q'BVaiMF-:IMIezHi.1Iwi2w:Ew:5wb5:Q2wEI1wf'2Iw:mmm IIIIS:-:..Iff-wrlimgziawii. 4:23 :,II.g--zW??M5,:?EIZwfg?..wMZWIS.mlmiz mf:.IWim-ft..w2wgs:.wg:mfg5zffI.I-:asmggi:wma..I1-1:2M00-wgfziw:.IMz.Ifeg:mfz.Im2..w-2I5 fwfsMiw'5v...wQ,II1.wf:gIWIsvfggh-IH'gqwag,f2:1fgwMKrwi,.awi2S-IQ1 new! I.QW.sIw?3?.wg'QnW1w-Sw,sw H, Ig ,www '::2m1W:S.IwwwImeg?..wi5,.Inwgw g,Iws,,gwgw. ,.wsg,,w,s,gWa3,,w.U,,M.I13,,,.I5,W..I.:,,,,.I..,aw,L,.,Mggg,, 3Mggg0b,gg,,. .. ,,,.,MW.,:g ..Ig,w,,,.I.a,,.IWe:m.II.w :IWW wpw,I,..wf,.w.,,,,.II.egg.II.g,WIf,,.III,, ,I If41,.,..IIg,,WfI,.,,Q Is ..I..1W.g,.5II .I I,mmggwFW....M,,F....m,...Im,.g.U,.,.gWI ,,,Iw,.1,MU8,,.54,..I., eww... .igwgmmW,Aww,,,wM,,,.f2gg,2,,wI4,,,,,,.s ,,,. .ywwwyeg xwfzviivdliwmgg mm-wi21wwmiisgwvxgswitiwi-swggez Iwg...xfgg.,Iqg5g,I ,,,,IIgi,1.Ig25fgaI.w'3,Iw'1-ggi?-lsfwsgmqs,II -214. 5 . .IggI...f3,wwfw:,E.,I...wsW:,ImvgwwgwUU..IIi,.Ip35,mWw5,.II6kWggym?,wggg,gaegwmef5m..fgMmiggm.f-IQ II ,gg,,,We,g,, X.'wi1Iw:SwgQ1ZZw--vw-:gz3.,..Iw gfwfflfisH5z,.I:.g:.2-12.-.IfSQ:-swfgzfzzfmizIwiiiwgzz..gg:asmgzfss.Grgiwfzh-MQQEQIIQII.. gsm, NqzzwiggQ...Iwgzzsaeggmswgggggwgfgzg.11g,I5g,iI.3.6Mg,ygg,.,I,:5w,.Mwzgxggi3wgw,qm:g,,,.,,,I.. ,I II 7 gmmgqgg 5323-'TIEHWQIILH-WiliffiwWU23325:iiiwff.lsziwiiwe-:rwrzwizzswazfz-1fz:'2ZIaI-'22.M-LiiwysiwwisiwisowilsmzII-iw ..I2,3-iz..2Iggzzmggg-gs..Mg:I.mfg:.gz.egeggL.5g,.II5..I1g,g,.ggWfHgWgz,,wgW.mfw,fw I V , mgm.g5,m wwf-'fiwlf wfM"'f 44.-WQFWEI-W'EmMW3ffwgafifgaifi-fviiwiiwwiiwWM?QWW-'iwMQW1wwf-fW4s.wf""5I.fw",,f.w2.Q-...uv11- ,.i.w-v,,Iw:g,,gmaa,gQW.: .w5Wsya5,,.pf03,n4..1f3l,,,I13ZmM,I.gNWI.gg,,I.p ,IW Ipgw h I..43Q,55i,e,, HSS?-aiiwsif-wwtizi-IIIHSs52wait.H2252-fgm,z:1.gfg::IIIigg-..I.3fz.Iwf3:,.,I.3gs.IIIIggg..I:lggg...wg,QQQZSIIWQERf.IgzwgI.I.I,3MIM..yg3WIg3Q,M35zawmgwwgzxf-z.rgggMggmmb...I,NI Iam, 'lf , I ,ZfN,..5g,,?,.I?3 f26Zz2..Iff:iIfm1322114-22:zzz2...IfzhizzszmmsiSzzziwffbsimiQWEz:z:':g.z1:g21sri,misIHgssmggazvwgsihggi:.gga2fI3z,zz'.1gg:,:Igg11..w:IqIggggzgmfgg:.IImgsa..Iw...,,..., gm ., , , X ZQZMSZLM SagiiwffgiiwwfWESWMSYZLIMf-.Malik:5ffS2w:2M2SEm.i402-:Gif-IgwH'Zwzgiz1fQ..IIWH325ZvmlsfwvzznfqhiyaffgimwIg:.ffQ5f,gWf3:,,.gg,.Q.Igg.,Ww ,IM-'I , ft 35,99 , ,.I.gg,,..3Igg wiwQQMmwM2WEwaww2fn'If.Q15f5w'q:'5QIM.wE,,.awgwvgzwfav-IugzwQQ.-.wovwgmggz.Mw,WIgg ,gpsggq w.2gw,..1Qg,,,,xgW,mv,,.gH.,egL2... ,MII f , Exim , ,Igg4,,,.IqQ,,M www 5s.wf1i:f'gwewv2?fQN1 -sswg,II-wiv-'fir fisvbipwwaQihwwwvH,FZi,meinZww?WZ':9f559fiQxWWgQwAPf5f.0QEAIIQW -W weft . 7 sw Www X23wiZ5...swf41fff.,fIwy1,...355IIf-gg..Iwgwhifii-..s135.1wizfwfgpfgbegm.Q5-HgiwwqW-3.wsgVMm:.I.IwI- SW, , I. , ,A,.Z,g,,,.II wwwvWf22:zILiW2If:,EIq-ffm-25-211 2'-is-212Igsiwzsfqwg,g2phgf,,:,.W..gg..,..gwm..I.I I gg, I,,,I.3g, wg Q1QWIsw2f5f:w.IIf. wmmw5,f,Wg.,,g.,g,ag13 ,mI.xg,,w':IIwgmQg,,W.IW... II , Iegwy Im .I II., mfg ,Q .I wg, Www ,ywwwew ,EWQIMW , IM. 3.1.1.-.Ig,W-Ig,F.-v,M4.+ ww , 1 ,Wm IMI Z ,-I My ,W QI ,wh ...If-.+f,I.Ia.,.Iff. ..1g,,..1,w ,III , :ww , Q II WMI. ,I ., in 94 3 film Saakszzmz. ...M ,, . . H .Ig.I.IQ A " 335. ' ' 4' f 'II'4z'JZ.35f ' - - MI-:iz I Q3 f fa Sliv- .Iwu 4 -F341-13223. ' I 5:25.55 :MA - , f zz ,2 L5 .- ,, L ., I , 4, Qs. gaggggi :LST -' gg EIQEES 1:5 ...Q-3: f - ' ...WI I .. -f saw. 1-Za gf , WEEWH is fs V 5 .I Zgsgigzwg EW, , ,,,,, fa px -1235 wg , ff I .zsigxggggss .dawg W I 4 I' gg' M wx iii-:se 3,225 - ' mi 2 WE Wai? my-I f aw HWS? I 22 -ggzawfg W 4. WM 21223. 1. I .Iwffi A: H :: - : 45522 12122. 5 ,A , M . :ww V ,II h 'img Q -r.:.r- 54 . V4 gi ,' ' E21 'f Sm: 'fy-f:,:s ,, . emi. 4 . ...,. .I In. V Ii I. I. .. .. ..-I-. I-IH. .. fbi Iwi gig? if 4 . IM , I MII w I l 11 ' ---::::.:.- :-:-: :. .-::-. -:-sg :-a :-.I:: I N, I , .MEI , .. .... f wiiw W , H-251 . , ,. W .x.--- :I,,....-:-gy., S-W ww- -I---I: gg.,..-'sig-.gf-:,.a2:-9-.g-.,.-.- 5, Vw- mi' ,. ., It .-A-:-:-..:. -: .. ., .... - I-IEMIW W ,Naval W , EM, w,.,vaw"qqy,v1: gy'-1 ' ,Q-p' - -:--fg:5g,2:2r?cf.::::gg,,:j.2.-:-535:g2g:g.5. ,-'gIgI:.-.:::" E-'22-5 ' U J 5:21252I,I::-E:ig.2:.I..:,:::j--2,552 --gf:-QQ2553155232E5IjI's--EIffgQqQ22:II:I'i-I-15,2 -5--52:532:E..::'f:I5??-I:,:---' :.:E::,1,::..:: 15.5 1 mm .. .Q New wfgzmw. gWS3I .I.w,, I..9f'5f,..a A S - ew -: - -: .... if -BEM W ,MIM -if-.::.:::f::: :-.-: ::. M svf5'W?if.9rf'5.4l I. Ewg gzm :fy.'I :5-,. -. re.. s sew.-Wxpw. g4:v:,12 :, g:g g:.:::::Q:g,., g 5 555 .5 3 ' g151 r:':2,:,ag-iw'-g:, :g.2.2e-51:5 f- -'-'-" W -5g,:,:.'.: -5:3 gs.. 2 .M Meg-apwwwk-Hhfzsdq :: :, .... ..: :::g. M .2-W.. .- i3 III.Q .-, ,--,, M: I.:-.I 3 I-I3.,..... L .. W.. Iwaagggg Q ggEEz:.S E z -isis -' gi s:.:-. 5 II 5 gg: ,.IIN'swI-113WQMMQSWMQQZQP-QifiwmI Q.. gg .- -:EM new :5: - .. -:-:. .. K W Q if -IZ: -""' :::::E.2' -"' E35 0' N43- E 4 IS?'QSZQFMSSHMFQSSQbfilalmiiwgaiwiiiiwfiiMSS W3 W1 :ga::2:-:- -:-:E SQ aff :-:::r:5...i?zgs::':r:2..-g,:5:.:. .Qfra:a.:E:.:afQ:gxg2:s55:- 2 -:g:::... gXgs - -' :--:--::3::g1,: g:3:.. .... I - ,...,,, , M.. .. -g-I--E:. glin gggxi IIIEWSF?y'5W2k?fEw2:Zisvtwwgf. 124'??i0-WED' Q .... e-':2?E:::2 ':2r2fE: -12 ::r:' 2E52 2:1545:sim:-2'2':2:'2 ..:r.g-. -E-:-g:-:. W .Ig za...-.HE rs:QE:'i::5:-sas-5-,:g5:3:.s:-:-: -:-:- '::-r- -1 --'- -' I . A -gg,,:.:. ,Iiggwgz fha? as ... I x . ag? ,gig-fg?.gg If 1 ,U..1--Xlfvrwaw I5 2211 69 -5.5:,5:-2:fg 2:E:., Iv :-: m y M 2, II: . . ,I - 5 5 if-fi saw? -if I Eg gs? gE5Iggg,.Iw5,,,E.vfg 1g3l.,i5i ,.:.f:.... .. . Ia gg. WI -1' Y IS wg g,,,I.w 5 ---' - , - I , I 6 s:a: :: :- :5-5:!:f - fg-5 5 Q . M - '-fl 3 S3 vii QI 53252256 LL,, I-322 me - 1 ' .- -' - . I , 'f Igbi ggig IE'-g5.:g: Mggfgfwwzfw-f"'a - W 5, Q MM I, fl Q K 4 I A - .i P ,M I-I , 3 I . ki txxf K . , . X Laws . 2? - gf ii i L I1 1 .2 M35 iii.-'SE 0515- JI' 5 F WWE 2225- I 3 Xa -Viv .. J F? f mf Zefigk' My . M .mg .. . Q . 5 ,. MSI I.: . II - wr- 'Q sw ww Igiii- Q- -vw 'il A Iam? :Ea gf. I- . mea 122522 - - ,I ' - MN A- awk an., H im J 22252 gre--if - 2' ' 5- 5 ..., :H wg? :asv , I Q I L, .K my :.:-55,25 1 fy WW A Dewi ' - 1 '-53512 M Z:':.--I:- I 'if.II,, Em gig: I iQ 3 .. - -W . '-5 . Ff 5 - 41,13 S2525 N. , I -' E 'S -Ei -::::.2a-5 aegww if mm Wig 152152 5 1, -II. if -I Ig zwygmfggggi 'f iii-sf -1 R . - 122559223223 ff QQ . 5552 1 -. . Eiifaiae-E? y' ' W 2 if ii I f ff :REQ Qu- Ig f - f- 22 2 2 4 ', ' I W ye ' K wg N I1 Lili- - -,..-I-:-1 5. .N -:I 4 g 4, ' Ez 1 -- f' f I W if 53. 55 " E244 I mi I , rI I. -I - 2 , Q z V wi. fI I .. - I I .wa ,sum I - ,:. w,,.,.I . .SI - :I g -2 Q-.51-.: . I- . - . I G M: I. ia: rf. . K i V ..,g.::..-2 1 .I w , . i -1. I - ' .. - E- f2.:.:-ff.-. .. 2 Is ff, nf ' ,- I' -:,:. ig W :,: wwf . N b :W 2 - S525 'ESE - ,W gm. ' -:-::.4f.:. Q W 2 f .., ....:. ,:g::. ..:-iq.: I 2... I I I . I .- 5 fggzw . I ., .-:g:g-.g.g , N, ., -.-W .: :-'-: L 5 :::--I . 1 X -2:.Z:,..:. .,.5. -gg5g g. g-H xg. " eg-sf - G -. -:-: .- g-ge .-5: in W ' x - , ,. W W WW... -: :- iff::2:-f'::':1.:2.:.:aa-:--- -iff---::::5:...5-:5?':::..-I -sg 5129! ..... - - ::.:.2- Pvfgf v , w w V3-S 0 Mwxa' 4 ,Q 0 H -Q, --1g:I, I:':3-Ig-:::"Zf':I:-3-:g'gI'E35rgg-:-Z5EQI'EI.:5:?Ef5?E3:5::Q-::IQIQ.I:,I--2423H' -:':lI'.- :-:5:'ZEI,I:5:-'55::f5E?45?E5-55:2-:lifii-Eg?.I:I'fEI:55'::-Ef3I'3I5EfSr- "'f"l.-.Q-5f,u.::.:IkE:-':I' 2:3 5-52 ? 1 . 22 5-5- gfsm. .,,,L..W.a.4S iE iw -s::E: ':- if--1 -.. ':E:r ::.:: 5: -'-- 3 2 V 14. E MSE' ,I .. WI - '.2.-Qi-:g:E:22- .':..E:. -1-E:5:-2:2-g::::f':rs5.:2::2:-If -' MI?-I,QsfIwZg " ":':""f:?2.'.2 -.-:-Ii:fg.:::-5:2f2fPs?:.Z..I':-:2--f- 222' I Q :-:-:- I. aa F. Q 4 gf..Iwf2:s.-. .. ..... -I 2,,..I. .. gg, IM . ,,,,.,WQ,.If..ww QMIIEQW wb 3. 2 1 ,sw ag . : ek M I--1-:I ,W , 335 3. . ,,m..wwg-IP wwi,,,.g5v1S gay... I:-:g-:. .:::.:g,:.:... -:IQEEQ-:..5.::g -1 ..- -5g .: ::,-: g.,.-. ?.:E:,5:::,E.,...- .,.. ........ mm ,.,,.,,- , ,Q ,.::-:,.,.,-,:-:E::,E,....,: . ,aw :M ,xi f .. :-:-- .. W me .M .Im Sw ,Q w I--, MI. E M g,wmI .. . M wsggg , I -..I my E. will mI.3wE ,.II...I.1f...I,g3gg.IQ I Q I.. .wk Muir? I S.. .. 32. ,MINE 2. -:-:s:2::::::-:H-szg: :.asga-:125.-:-Hf42::,r::.2w1:::':5-E: E5 Qgwir-: fS?ef2i?,QI. 9 wmww 'Hia- :2':: -: -93525111gag:g:':I:-:-:-?5:5::::..::1945.:..:.::-...Ig-':5:::::'s.-2g:g-g: :: - 1: mf . e f- wsg,Nfwg:. , ...NWI Q4 4- Sify? f . ...IIIQXIIIIQQ.:-SfQ25z:222fI-11555253 -.:..:: 5g5: api? 1 .-Q. ..m.I.I X 5 g,g:IY3.gz ' .g2gAgg.gE5gg.ggg:zaEEg. 5-.-. I -.fs:. .:'f. QM -Qing Avg Bgam s zz wiw If 'H - 2 33,33 34355. I. 5:25-:f:'fr X-f2.wszIiI,,:.J-6.3-1.3f1fI52P5'2Af12:ae -'-"' 511'-:mrlf 12-'Er e r:rf2'i1'1aQa- fr. '12i11--- Sify Psi? 1. '55':-5 55' I f .- 2:5-Sfzszi-253 WSRMMI-y.,' fi' M A 12, ...-:.r5-'g-s:5:5::: --g New a:w,es:.wff:Iw6 IM ,gig , IM wk W.. Q, wgg, Q gwig? WS. 525 -: 5. ,fm -Skmf. mzzawm wg A I . we is Q X -I ,...s5k,,IwEZg3.wvf,3:lfSs1fmZ'SfIw I,.3eg,g5'?sE way? ..-.. - ...Isa ,SIZE as E 3 ,., .F ...K ES iz.. ...W-I, I.IIa,i.w,,,,W .,. - wwf? ly r:-':- J um g QNIQEW faswkgxw 41.zM,.f9j'y,,Mw Q -I .ww . , aw, Q We 2 wv3g f3Qg2I.wIegggi,ggvg,,w1.-z . IW I I 5.32. I gig, 2 QfSf2f2'fkWW' 25555 ' I M Kimi -gs: 45 -31-'E..::.E Egypt 4 5255 '2f s. ag. .Q w 2:. :i 2E-E' mi. Q32 Sakizyib 251 Ins. .ivgig fz--2. if ' 52:5:'fr If :ESSEX II ....- .....,... .. 1 .a:.:.:.:: .ggggbggga , 53:2 - . amzgmgi mil 5 12325 " 'iw I' " 322252253 iii-:Z isiifgzzssfbs ,Mgr S5235 -MI , L-I ggi... Q-5 .1313 :mf 53223 Izzagaasgig if-is -- 51223-522 Sim 9 '2 1 123 is .me M211 M - -'WMIM Zi ol ,A ' Z P wwf, WM 3,310 Ig ,..Ig,.gQg..I 22.223 ,rm - W ' Iffgifmii S" -:,L'f-SIT 1 :mg .af I . .gs ' Wai 3213? 5 4 My 513233953 EEE' W 35325 11I Ig X asf I 395 a.I:,:.I-.-mi ii? 1 5 2231 .E 2:55-12 . I . 1 an ::. . MHZ? Wiisg I -5.5-f saga. , M W-,g . . ii.. :X ff I in :iii Wgiigggi gg zip? 1.22 -::s2.ris'r2 ,....IwIIIwg:sIzI :rs:':2-5 ,ss-if III. If-ESI-1iI.'iEg2ii:22fI-In-2-W -lsiigzzisfies , TW 'Xe T Ei - . ...II-...Im-f?4M'W?W.. :::'E ::"' 3 3:: :::rE' -- ..'5'I"S'r-: Flay W-1-..SgQg'?I2Q W.3'. F533-?i,,WB"'WUZ5 P ' iii: .I .2-.1 is-Swis s? -I. , 22322 . .II Iw.I..I.IfIMs:2mf5ii2iff:2:22155 :siS1QianQ52E:22I1g:giiXs:E2vwiEf.2If :Lei Zzzigiza-ssiifgzzgieiihzeswig -S ig. .Egg ww-I f -- ww'2-I-wS.'I.3wwiiwmwbiimwafsiigem'ftwsls miwfz.sIflsGS..v-.alia-:Si Sliwsiiwm wiwsziw::xi.IIw,:::w51.w QI... 1 5.1. .ww.Iswg2Iw.g,:,...IwzaII.Q:mII.f .I.IxI-SKI , .E 2 33155353-..:5gIIgzifewigig-1.1.-59222..ggiH III1-gf:IIIIi,ewwszggI3g1IgIg:zQgz:-552515331I.Izzg3.E:,,:gg-gg..IIIW..IIgga...3Ii:ggggwaggMWW ES 5-:+2QIQ.Im.Iwe:S2g.,I:zI Iggsxg-3.533 . I I :FSE-5-1-":-S ' W wwsx WI, Ifffwi.-Iff f .Ieffeziwwffzpqseh iw-.1 IQ we-.1-I,wIw V -bww-2 3, y,,,,MIw:3n.I..MfgQ,MI. WWW... . gy R ,, - -3,1 3 :-,,,.g gsamIwwgIMx.,Ib-5, nv Q,35.I.wNw Q'Rlw?'3'S.2f-3333185 Q-we Ion-ff.---'..I .I..wNg..II..wf ..II.M.I..IwfsIIwgm-...QIm1Ima2IIIw...w52.. fg.I.gg,:ss.SK-Hz. .mIIwzJ.I.I.Ifg..I.wI fsgw. MM ...hm 1-... -. I. -: -..I- Iwswag .. gg. QI ., .WI ....M'9:,2aswMgZ1?.21tI4vimazgsmbwahv ' H P1 EM Ialim' M,,SmMqq,:.,1afIfIwfgggIWI.IIgg,,,1I.Hgg,I.I2g,,,IW:g1gW5.I3g.,w.:,,I.,5gmmsIg ,,wW,,ggWIIwiQ,,,..gMr.W'f2.,g.w+g6w?K,..wsR,g2 II kg, Slf vgiaiww 3gIII.ggI. g?..mQ, Q31,g,,,mw Q -- .. Q gggwgg I.I.ww.mwa'sSwf-wwggsAnita-.Iwfgg::g2q,,.JS.fww:3gI,.. gwws h -. M,,awwfgmqgwawgwqkguvw fwiswNga,,,.-QW.I..gE,w.g,w.5W.ak,.wgggyq WI. ,:5mzw,Wgm,I5m3m, IIQIQW W.. Q, ,g: ...I .m,5 was fIgww,OQgM,, qw U W,-,M I.. W,II.5gEiwx,,E . Isnswaw 5.I.wf?fm1 summit .II.IWvI1fMQ...I-'-if-a s H I - -w.:-- vziiwzmwsiwwll-WWNQIIWSHUwwwig-'W-IWZIIIM:.MYR-IIMQ wziifwiii m,Ime5zw.:MWIWQEWII WPS Vw ,Ip vis.-5. Q.-I. in Q Pxwiwmw W.. gms' M .-N Iwgg 9 warg. L ma.. ..I:MgI'I.IWf':. I -fx im- Ifpbyvawwieiivvg wuiiww -vga. - -: HQ -I Qfwekmw- .I,.w-1-v3g.b2g...II-.ww Iwe,..mx.. M I.Qg.I.I+g3.,.I,.g..fgf,.....Ig,,s3g-gq,,,Q... W.,,,.,.,Ilw,2..ug, Wm an gm gg. wsu.. . M, w f3,,...ggRI.,.,,.. , We .Q N,,I,gQNk.,m,., i,,,wIA.gu W WIIQQQISIIWQ., Hakim 'f ww?I+W-.-IIRM IMI ,.II,g,mEgS"2..-.W M Nw,W3W3vf .. i3'3Yi1.w'm0wM:':.Iewggg age-.sg2f'2gQwgMgw-EQI..I1S:Eu5'w:Q..wmw,I,w-1-W Im I ISI-H5.ffIw....Iwx ,M wwS'i,WQ.m'1,,,,I. fwmgg gk ,.w1,gf,g.1 g..r3I,.I..MggIgQ ...sb ...M ,. guuisg WIw,Qg..q -g,,wwi, .II ,,..Q.,,,Mg NI.. as ms Eiwggswf ,Q Im QQWIJWN vwwtggwsbasgggggwhmaaviggww 5:-:--- S-Zwsgm wifi., wwemww .Swv mmsfilfm'..sw:mN'5'1.w-fmsHg.,I.vgg5smamfii2Q2,IIpvQg,,w35,03..I.gwM,Q,...3m,,,wg. WS I -5525 QII.5,,,IM,3 wg .M Iww. Wm gwmg N. MMMW k ,,.Wwp,,gI..igQ g - KF4355-EQISMQIRQQNSIXEQQQZQIwwvwfs, .awww . W-wggiw as Srww- Sw:-A Imwma. wr?-w.IIII.XYf-,.,m2.w ...H fI.w5FNM,I.I.IH .,.1.1swgf3f2.fMe,II.I-Iw,,,I.PQ ,fm-I... ,WW IW. -gwI,ggQw,,,. Qgmgum .RMI -..IN gh If QSNQQIQQII ,MINS ,ww ,.gg2m.Ig, S5 ,II Q wx I wwfg"w3.W.I.II.I,S am, ,B . ,W,,3.. A m si m W as aw-m,..,I.3I1.-.P.,IIw.s hmXaI.wg.,,.I.I.1U. If. ,,,,.w.I.,,ws:fm.. Ww.,Iwg,0wv Wwg, WIRMQM ,,a,,MI31smb,,EMg.15w23?Hk 5w,,,,..w,,,II ,, ngggxk, Iikmu , Q Nm.. W, bw , k ,, ,MIN A wav? szwsM222-21Im221z:ssImeIIm......,Iwiii--sa..a......I..gWI.gs.I:.Qi-I as-QI SMX.IFa..:ge-.If:I.:fmI.I-II-fEaIIIgI-If-Q:..wfz..m:Iwz-IIIA:z.Im:.II:-sz.ILQIIIIIQ2..IIg.z.Imgg.I.mIg......Igg..,.II..I,.,...I ,Ig.I.gss,ggiMg.I. ggi.. mgw WI .I .gg I. ,. II Q IS? '0i'5122:II..Igg.I..:i...w:Iw..Iswgz::z2.,.'Q...If-Ziwgswgiw R Iiigz- Sis is-SSM RIfwisiiswxsziwzgwzriwztfw:wzr'w,:I..fI isw,:zI.wM2.IIII.m...IIggIWfxgg.-z..g..w1qg I.aIIIggg..I.mg.g., .A IIWIHII. P N-Q....I.g,SQ kgeww-Iwi., .wgm.Igg 3 1.I 3 IIgf:IIIg-I ws GmEg3I.w- swlzw-:XIWQEWfx-WIKI1.Iww+fg:::i.a2II.R'Fg.sf:AP.22Qg,.,.?Q.11 Q wg...fmI.I1fgz-5.IfIgf,:..IIII.w+ I.I..m,,:...II,,..IIg..f-Ig...gg.1 ...WI-w:I..II3I-IMm..II.I 'gWIgm,.I WSI. M.. IRRQSXEISEQS MIIQQIQXQW..5.1.33-I..g.HIz,,,...I. ...I EW.. Igg.I..I..,:II.g,.Sm EESQQHZQSS5-iiiffiiibS251WifFX-3Ez:-:Zi?33?ffEgWwa-zafxeailiiMW Iss QI: IHMSSQESIJSEH251M2E2w:?LZ??W:2Ewg3f3:2:5i2I.sIgggsfIfsilb-31:2.Qg,.zI12I:.I-If,:4s.Iggfg:iI.I.Isei,S sggggzaiwsswgigwggggP..I3l5ggg..5,gwggg-55:35. Sw: Sggyqggzwgkg EW-gmrw..gv3?xI.5gZg,gI.i-Q.3sT.IIQ:-3. I3g4gW:.G A: 3i,gIIgiI.3gg5S53,.,g,, Ig:-smsiwgifwziv6:33.wif.-iswas?hwfegzmzrziiiII-swwzzmiiw-I5':I SZSEAQQQEESIQIHS 1zii--iwwS:-:2:2IwmsL:pwi::12II.:IQ2.Q.:2.,w-5252f-9zg'.L..IW:Wf1iSIIfI5-m1f7S.S:HQ'-f'sI.....IIIQ12-S'IS.w,.L:Iwggi:IIw,g::.I-Ig,:gEI.I5,..ms ka-gfgsw:..wy,.g,gg.b-Qt.MEI.. z-iwwgggxgkggw. Ig. Ig,:f1N,5QIy... I W, ,,.,,.,.I.,M.II Egg wg,m....gg,....I.IW,I,I.I.I..f.I..g.gW..IIIWMI,,,.,Imm.I,..,,1IN.I..M,.I..,.,WM,.,.:W Q...IWA,.I,....bgb, r,Q,g,,.gMI.m,I.II5,,,,w.NI m,,,..wN,,A.,5gW,,a..WM. ,Mm ,W,,.Iw.,,.3Iw,,I,,..i 5.,.I,,i,.kg IgUX.Q,..m1,., wwII3m.M A ?.P..p.w,,,b,,,,..,......Ig,,,,IIsIe1 ,MSI ...IIS .WI ...Ist,w..+.2a E22 WgiggfwififazzmS-2.59 Jiwwewfs, .www 1-1'mf'w..wf11Wiaw IW wwqpaivvvqwf' hw-.Iwwggf Wim-f' mIwf'f,wI,..I-I-.AmpIvmwvsifqixmmvw , wmw1w,.IIff-'I.IamuqI.IIw1WfIIWm-.53 IQQIXRIM-,M -Q, M-.MN H if ,taxi QSwx,MIsgw IM ,WI4 ,,,wyg,,II M J,,.II.,.II ...K Is. I :nw .I ,?...wII.IIw.w I1II.f:,:m,,..,,.III.. ....I..II,,..M.Iw:+f,,.II.fim m,,WI.IIw .A ff....,w WH w,.,m.IM,,..I,,,WM... M, q,,.If.,,,m,. W., W WNW ,W,.gI.m,,,.,.I .W M,w,,.I ,N WW ,.mg,,WWM gmghx xgg, . ,A ,M M... M M wgN,.gI.I, Higgs-fww-IRTIvwmf'Iwfww-EMIif:g5,a.w,3I-.I..vvg3f3,'Wipwvwm-w,IIQ:w V -Ish I-In.2fgI,w'fg3wz-IQfg,.wgr-w:,,I,,I..IIs1fg M55-:B,..WIwA-.W aNMg ...h,,,....a,,,,wu NWQ NwI,3p1MWmII, K m.Iyi,pI3,,,.gh ,P,zwII3,,kgwQ..1Q WWNgfIFm,Sm3.w,E winds I I ,NAM .QSM WW,mW.A ..,i.3D,'MI5T.I3 v.w+:I..Q11.f-QIIH:Msn1-QIINQQIIQ-vw-waz:.2wS'2a-fIQIIff-':Iz-1:-.fIIg,g: WQMQWIIIQE-M W-as N-HQISKWQZQ....Iii-::IwgIwz.I.m.:I.I-I:II.w...-IwfQfgI...I.I1I-I :wwI:Wwe..I..Iw,....wz,If+..II:..Wz.I-I If-2. m.-...sm m,.,..-1g:I.Iw,..III- .,N.w,,.I.I.f,,III.IIg,mIg... g..g,,I.,,I.g.,.E PWMZSQQXQI Fzwi-fIIeF:.Iwx3mw-5.IWa'i1ff'12g.,,I..'f4.w.I.A5g:,z'S...:S MI I QSgifkatzffshxwiiwpvzbggwfzzI.IIwIg1,mI.IfwgN,.m,I..f ,m:,8WI1,Ifmwmwgmg..1:,m.I.,.,Im,,.LW, f3M,,..4M. ..M:W.,,5.w.g im, ,m..aMwN,,WM,,5.EU,,,,.3gw,.,.m,,.,.3w,,.ZM,gM,,:h,.Mm,,m,.,m3Aq Qggw-SEN-II1w5i2-135'-'iwuiswiIw0emISx'is.gf:QmfgI...wwwQ3mg ' m.m?mI1-Iszsmiwzmf fgzwiwggzwwgvg. Iwglzw31.qszpwggwwgz.II.IgQgM. .vg,y.,.w3g,QI,I..I:Q-5I.II3Z,.,.IIqgL..3g IIN:.gg5,..,igi ,WI.55gWg5,,WA:E..I.3pg3,,,,5IQ,s.Ivg.IIwg.g1 wg.I.gig,,..gI.I.gg,W34.,Igg.I-Mg:.IW I I.sS-I-22-2.wS'M.I:fi?I-sais.-22liwswigsiwfixmig-me-SIIXSEMIQ ' Q Wim-221g1IS'iB2:e2ws:WIfmm:iIfff.zzz:1'1IIlQ:IiI-:fl-3.II-s,Q:IIw:af.sIw5::sSII.Ifggz:2wggg:fI.I.:,g:,32gzza2..gf:ffIw.I gfillyilgilaii Qkggslwagz:.wf::I.Iwg.:.I3zi'g..Iggg.IIgggII2ggf,.IggI.Ifg::.E::I.Q:aIy.:I1z:IIfg.Ii:z..gz WY3i'Ii'fz?.3915z.fQ91:f5l5iN31-siiiwtiwggfgzhw .fswfvg'f2i:2EIL.1Ef22-I miw -wi EmifkgiiixvfisggiihmggggggIII.Iag,gizI.Iggg.gig..Iggi.I333gpmimxggggm.5gggM.Ig5egI:gW3tg1.Img,!3IfI U,,.gigIf5g.d.3ggM...3g,g,4,Q.3ZgW,Sigmai5w55gm.g3W,,gM,,,...Iw,mS,3,Im.5gw..bg:m,,:i,1wg:5R3gg,5 mm 555i'i3f1-"EIffffwGf4-SIWISIH'fi--fiiiwwIqiidwxiiakidazwwhi-ii Ifwiv Q Iwffswaiw-:':i.IMs1 ,wm.I.Iyzg,.IIffzg,3,W.wz,,..IQ.'-Q-:SQIW-:siI-Ig,4II.gg,III1 gi..f61:I.4-QWIQZQQIQH1ggW.wgWfziz,W.g.I.wgAW...5ipmggWQg,gI.gg,,I3g,,.5gmIm MIg,,5h,I.gz B W- WlM2w1EII':: v?mI:iI,Iwg,-fs. ww awww:-s..I.I3 1.,I.mwg5,m..Ifg.Igg,..I1.gQy.,wgQ .f.2IIgwgu,.I.I,fIIAgg:f1I3g,r,I:1,,..IIIwg.IIgg g.,.wp.I5gI,.....g ,.m,,WI33,,.I,g.,,.w. 3qM:.gg,,Mg ...mm ,Wm 54,05 w,,,,..Q w.,,,.g, ,ggwz ,,.,5.,M.h,,LW,L,,, xl. , 15 1123 22223335-I2 eQf:.:: Iwzifygsz 1522121 . Iggy:-: gn 1,gg,:.:.I .:zI.Iw f 1 A . IQSQI Q QEIQQQE 55,3ggagiggisggiggggizggiggizgiiagiiaiQMM---W M wi P ' UIQ "ZW QNII-.Hmiiwmiw-i'wwv: Aww ai 'If'R2'lZw' Nc- afg. III..',.'w1i:.. was nm I. Z,f:fwwM2g,::I www wl-551'm22w2g:Wq.,gg,--wig, I 3w.Igg:QQfgg,,..i,,., w Wi1.NM..f., W3 EM B M gg ,FIX SS Sm... ., W, W-M I., , I If I II aw SQSWIQI w2Za..I.z'L..Igwf.2MxnIW:..IIeWZIIm s5':.S......g,i'-LM asia Qsxmgbufp Igz..If3....wggfmmMmL,,...I....Ig3gg,. yg,.b3,g.IIg gI,Iqgg...IggW..g gmgggi-355..3g,Mgg,6I33N.G3e,is33m51w,i.mg.,,twW:M M ak. WM wMwNkiw'-whmmsuwwww-Ma'NNWIm:1?IwP,..e-I-s9S"i.FwffIIHQI.Q1a+:S?31',IwWMMUHmww.IwvwM1fQEMw.Iw Iffwme ,Iv .,.Im,.w mm:.,,.,,fm,,,w544IIIMQ..1M1 ?WI.,,..MM,,wMM I... ?W"wwP1wH'QSmWkssMuw'.w?,I.WmwfM.IIsIffP- vwmam.wg?ZIwwMf-wwwaQS-I.w0n.w'?Zmww?2em wwm,.I.e.IIwI'-iziswixwwMIN,L.ef'-.QIxWQ.,Isew:Q.pwwg,.wg ,wb,qwH4m2g,w5'2,wIa-wv nmgwo,WIA-.,,,I.sI.f,F.I5,.mf. ,U hpfgg.g.I1gWmm,.ww.q QMIW.IQW1,I.I,i,I..Im.,IAf!,M,,,..3.w 3m,2.mmgw,,,,M,,.III.,,.,IQqMf3,Xmw,...wm,p13m,WI b,wQ.,,,.q g,,gg,,,.,m...4I 22 iwmiswwmwIv-,im-QSIW ww..seamswwswwsvffwfgfiww-fueWIvvinwwHZ2wiI..wfIww'vg75mw9fv22fW1?awww'mv: .IIW-dw3...IIU53.Q58-gimv1Iwg:SmQg:pMewPIwIA M2-Iw:ffIM:'2'5w.:i?2w'si.1I W Mzmwfiiw--zz-Siiisgffasw5'.I,fg:HIIw2sw2fvff-YIww -QGfSgWI.II.IfIfa1.zf:-:,If5f9-3-Swimw...gggi,-..m....I..m-'2 'M- MQQIMSQMQI.fQfgzw5z22SwQIII-.ifiI.vzIsi35Q:z2.5fI:II2Imisss. .'SsII...I.I:.I2 .1 Ifizwff-:afWg:a:2.?SWzs?Q2zgISw .tv-gi.iQ2:.,,IIM, ,, I IA--223.0-'iii-ft wzifsv A 8 -'ismwiiIflzimfifzzwwziwggg mah I wwf 'imgvgiswfwggigilihifzqwws2-MIM6 2NWSMing-:.S2Sfiff2E.Iff-Qziilww-IEZEQIEHFZEAQIQQYQSQSQSQ 8 SNES.-ziz:::..,f1.I.,... .I - wffbixvgiiwwl :.,.If.IwgzII-.III,,I,IINgI.wgiW,:..Ww:.E.SfeI Q I ?igf"'3mWElZ2Z5W'S35wWQFS7Qs wii5SaI.e.w1I4 M Qiwgwmwszs.MIM. II psqszmqqfw Q , .1 'f Y J 5345522222 siimz is 'Y A VZ E5 M :as Wm waz zsismggf, 5322222251 Siismf ww MQ. :ma QP mam 59525212 A N- f "' ,fn W'--W.. ...M nw, 'Muff f37 'f 4w Ei "L :fs 'Q' 1 I f. Wm: 5,-0 E 1 P in I ww ff .z aww me Mmwwwrx awe w ff wmmm W ww-M fs Qi' 3? S Zig. M W, 'SEE W .. .,... mx' 1 L 1 W Ve-,EMM -: :. fWW""f . :Fw:'::,5:.E5::,s:-:::2:2:5E525eEE'2E:52- 2-:Ives,:::fEE5i:E:Ei-:f'1: E:f:E:i:'iE-'EI'E- ga -EE'E2am:-we-E',.,:E:5.:55552::g:1-Ia-5.2.2525-:g gzg if1:5:-'s5,g:,5::-:255:--:E'E:::::i:5:-55:2 - .: . :.5:::.':.5:-:vf:-,-a5f:5-j:j5aJa::I:,g-,-g-g.-.5.::fs,:,,-: :ima5:-::,-:g:5:,':5.,..:.-a- -I-1::5:'gs,:sg az:-:-:--:2:.':sz::s:::f:g:5s W """Q2'1'53 "" ww-wiwwwryf-YES-2-frssa MW M W-:mf ----- 6 mf wam -:wf xi -' . . .. 2 : ' , 159 ,.':g,':5 i:':I:geg :: 3- 52 -:, ,., g..::E 5: g. 5 ---- 5 5: 5??:,E5'5 :-:I -2 2:2--: :- E. : -E:5:':f5:. !:i: -' E'E: 'j::jEFE 5.1. 25--:-I '2:-':-- -:- -:5:g.pg:':, ,..:.-:-:: fg.p3:, -'-' : 3 22:25 -:g za-5:,5:3 f '- -'-' 2? ,.,. azz .,.. , .... H , .,.... , -.-. my M5553 ,,,, , .,.. z : -"- , 252' E5'E5.-E55-2. " ' 3' f , ai, r:5.::.:- , z. V f ---- :Wg 5, 1.1 ,. gig? mg? wma af: 6 W ps gnu: Zqmm ' f ' uw Amon Mimi? 4 Efisfi Elm? , y " S5215 HSS ' ,392 2223355 Aim :f. ,:gg,-:g-5- ,psi mv Zim .... .. 9.1 W U M was .szf " ish: ' WW :nw ga' T , :f'?EEEEf: .:. 2-2352 3225? 22352 55522 4 5535. . Zia? Six x' 2235 vb if ' wx , y gig M 2' 52392 ' 65 fsxifiz' 5 - 12351 i . Smog 5135? 59' 'Q Wig W? W ....,. . ........ , ,.,.: ..... A .... , M . ....... Q af .. . . M W W Q , , ,, ,,,W , W .. M V My 3 35223 i 525' 521 "' "" 'E ---- ""' W 'W' W3 'I 92 f"'f"i55:-'F 5f:5E'2'5-E- 5" :g-E.f5EE.:E5.5:55: ':' E. ..-::.'EE:i? -f ,g f-fr 5 Wji5'm ig:f22jgEfiE'5k2ggi'ig::22Q2 E ri- ,..,., , mf'- :.. ::-::: ::-:15 "" 2E1ff2. E.1a. 'E:.'-' Q 4 'IE-'if wwf' an W E QW Eijggbg """ -:rw-:5.r2s'i':1 ' ' f ' 3 swf 72: 1 :fs .-.- :gn-Q:-::. was f 2:' 'f :fir z ,msg ' Fw? :cz E W 35555 A - I w e ff giggle 5 ::E':5::5E2 5 'Wi 25:52 52,1 gm -'gafr fz-Q.-:: V 1 ----- 15255 1 : :. X ,Jw is 4 if W W' 9 :51:22 J vm E252 5-5 ' -235:24 is R figs ia A 5 .. - Q W 22 Mi f -:-:f-:,::,, f W t 3 vw F " his -5 55 1552 2 ,, f i 2 I r::::. 3 W I f K 3 - 2 as 5 VS 3 i f 3 1 323 5, gig dm 1555 Egg! . . is 1 I ....... gi b f-if 1 5 ai d :E-53: 335- 55f5'F'f'- :2'25f55 MN,,:,,:,r,, K s:"::':22f: --:2:: :E:f:f:5.' -- :-: :.:::: 4 ::'5. -:--::.-:.'I.5:5.I: -I - : I 2:2I.E.":'I23-,'2 , : :- : Z:- :i. . --g:g:E:E:f:5 1 g::::::.:.:: :I-H :::': W 1:':' 2:'-2- ... :::-.- :-:-' :g: :- . .. ...'::l::: ---- :E-a-::.,':- .arg EX? X523 .... 595. - :FWHM A ...- .1 Q S --.- : ---- - .,.., .-.- ----g mrff:- -- .,.,,...: g .-..- - - : E .,.,. 1 -.--- .-.-. as M ----- Ng xiii W .. N Q ,.,,.... .mf ....,. .,.,. . ws. V 1 ES ....... . .. ., 4..m..g, .... ,. .... ,... .... . .mm ..., f 1 Sly .. .. aww . .,.. , . W 279, vs, ,. ., f W 1 , mfs. 'fwfr WX fl' 'I "Q:-fs-,zi'1 1Efff'I E H1 . iz, 1 255 2 5 1-iw ,, ,. ' 2142,-2' 's.'2i'Z2 E2 I 5 f 4, ,, , afif S was 22322 , iii W , is si i Sig? 1 7' ,V , L K 5 T E Q 2355 5 X 4191 57' Lt" - ' ...... 2 fig 551,45 , , , , '1 M -::::I. ' ' , 4 , V' . ff' 5:25151 2565 5 5 gi Ei gg gg ! WV, gig 45, : 1 W ,,,q:,,, V- M gg 2 wg M - 5 + ' . Uff ii W ZW: ,H ,,,,, , f .1 5355522525 23312 , 2 ----- 2255353-S5 sg v 3 1 35- mv , my va, J. A f 32:5 H235 wi 19, sg QW my ., - QW' in X gf E is 5 f AV M A ng 5 E A, , I fd lily? gi 5 2 K Q 2 , fi ' Ffa 'i , A? ' vw 255522 Eg? fl ig 5 gig QSEVQ ::.-:."g.i: E gggfi 5125 EW 2 Q? gpg , , Us Us K Z M2 r W ' I ,EHS .,.,.,..,.,,.. .,.,.. , , ,.,,,.,. P, .... ,..., .,.,. V .. .... N, . .. .. V M EX VM ff ' if EV -fa.-a:::gs:5:f: ag.-g5g:.a '1- ,-wga:.2:s.s.,Q, , -Q:-:gg :f 15.131 ':r. ww gww wg ,..: .:.,:g .... -2 .. .:f5 ' 'L H ., 4 2- Ww w ,,,.,.,,.,.,.,.,.. . 5 g X Q2 ' ' ' 3532! f " ---- I 2 ff f .,.. 1 Av ,.,. 5 5 gg 'iii E 4, gg Q 9 is - -' 2 W rf Q if fff rr ' Sv Nm ----1 W 3 ,ue 2 my """' gwwwmr X S .af ' N, . , . . . N X X 419' W I Nw: ,as , fin 'Nw N 5 5 MW :YW I ff 5 ! :Na imp-'44 A Q igiiffiifggflfiswsk ww W Vwfama WW'W??'2'fTMZz W wx V .W VV V, V Q, V E 53 Vw pw45,wQ,wmwggEggggX,gvggggmgyggggizwgigggggggkzfwxggmmy,VVVVV4 B 'A 'Q Y EM 'iikms Q vim wif Q K Q ww, F Vx'Zw,'4H1 ww-4 Q W W. P 5 Q QW Wziim55iifmiii?S2SEE?:E222335622?3i?f?g2g1szf:skwffgfmfw.Q.W V W V , ig 3 ,gm V wsixw ,W+I?miwwsggmggxgwamggggggggqgiiwgghgggggggg3 EESQEHWQWNMVVW QB 2 MW 'gf wg-'iffeWg?,bfzwwigmf'2g3ggV2gEVgQgg3gggz2z2gw2ifgs?ssVA ,mam MMV 2 Q. miwwwl awww 8S swg V 21 S 553 iw 2 'sfwvgminieggwgel Qmfksiiggw gSQ2SiEg:-'E2E:-:m:.-:: ----- - ,.... ..,... . V Q 5 'WW ,WV wigs mwmgem -'-- , V gg ' 'V E24 Sami W .- -3 5g,-g ---g:g':,':,'g.:.:.:-. g-5.-gg:-': ,. W E aw W :gm Egz v mgggmfzigggeggawgw W, Q, ,.,. 5 ,wg viggg5ggg2zwgs Qgggqgg? Wx S Q ef QQ Q M ww p Q ea Zag sw ,Q :in awibww .gggmg Qs ,VW eqrgigww 5 QSM Bmsfgwzi N Q 2 Q 5 Q 9 www 'wxwffmssiwwfQwiwf W' Aww E ,E 'f 'X G me sfwfm Q, D .Y 9 'S is wwgigzwakwwggassggza Znimfwwvfifggiiwgs Msw:w.Qffw1w A ii Bw mms N .M mam?QQgsm2gg2W.1gig?maxigggzgzagwmgszmszgigizsiiwgmf wma 5444 we V 3- .8 amaiggwg iiimgwiawwwww, gg3,g3'g2M ws. in :way Wwg .Jim we .www Z Q3 HM? Q 222512-R35Qw5..51sw1MP,gimp: fmgggfangdiasswwiss 5 ,MW-. .Q Mzwem 'mwwwgSf'iji,ww :ww ,mama E9 M Q awww 21 gg, ,X ww X 5 W wp , Wg 'Q EE? www ,mggggaw as Q31 Q E, ' gg rv .M W W Wwsgigzwggzsihwgggggsggg Egg 23 4 44 43233419 591455432 A V H W QQ W aw M W M5591 QQ 3?1.s'w 4 mf Eg was gmmgajgg Egggsggggggmgigggggggiigsigziigsgiw,QE ,L 1 W ' wgagwwm Masq mg wwwgl, ssgw , 4 wisp we Kms gvwfggfev fgdfnwfgg W Yale fzzzswwffwigsi Q ' We P ima 1 W wgmwsggg W Q. .5 4, 4 aiziriwszismiwawzeqmmgw W- ,W W . awegggiiwfwdyggwfxg 22PggiagmgfgilwvwamiwkiweW, Ng Q, Q5 , V fsS?'ms.mwws,,2WfwExim Wwasgiwfgwaswmwfw,Sammi mzmm , . 8 'mwmvgg,-.Mspm'SfQfDw5f.wfg21,.2mrziwawvvgsifiwvwgywl?wmwwwmwg,Q 8 Q,3,iQ, . Q' Q wwv:,Ms wghgfmgzfsgsyiw' 350 Www, vgiwmzwwqwgvfgwfiysrhgswsgehgaygagw , ,L 4 S. A E ,M QM .sw ww E WW Mwmffme1is-3222fsfngggygfgimifisse135is2:31222Q3222532zggqgigiigigagadegfmysigg A Q bywwe-f,,-3,Sgmmww3gg,,,g an wzggwf Wm, Pm aw V WW-.wg me WM .sw N W,-.V QYWMwgmmmwgs,2Pa:wwQwwwge,W:QgnmViwQfwzisgiimms' www 52225122 m H fwaffzsgwgy 1 - S 9 www? -ww Wwazw'-4 4 Wwpeeeaggmiafkfwmssawiaw WGNW- 3, Zawww lwfw W ' 4 w ff me wwwvwggpgdgww. maid, 8 mem,-MS' fawgg'8'w.Ww ,W me Ag, , WM 4559 V, , ws ,, sffmwfwgogmwsgmgwgs mfwwg. 33.55 ygiggixsggg K2 ,g ww? 5.4, az' QP Q Ig , - .. W ' A wmwmmif mmf miie' wmwwg ww? 8 H my gf W V V V M ,, QV VV, MMWW. , 4, ,K M.w,, ,ggww ,M V. W4 V wQ.f,W,f,N:as5gVgf,gwf gggggsggzgzgsawsmgisazi2g5fVggQ3g,,mm?,W A , V WM" Q 5 kisiv Mg fi sms?-m www? ww ,wiwwpgiwsf fm Eifgwiigffw fwvgafgbpxik N 4, ww Xzzsmwiwegzm,-mifwsggfw wmzfgww Y, wwf Nw Q W WMM gg, . ww S4935 W wwggggiiis lsgfgdgggggwywia N323 45 ' V f ww Msiiigigimsiwiw ' H ' W QW Mg mmm A wg 4 'ma awp New mf , . W, ggi Wwe, sdsiwgmgissgffggi241v25Q,,.q,gVg,,5,5Zffag M244 P W 3bDF'F"5w-Ike. S? is-'I F9 ifzliwuwfv . 4 E wg WW gwgggf, lwmym Q . 44 nz 8, 4 5 3 P id K sawwfwsifiid w m Mm wil ,ya Zwfziwwfk W, 9 . ' My 'S iiwmW:Mzs:mfEzzWHWV ,W , V ' wwqf.Qg1g4g9g038,,iggg' W ps .A 6 2zXQ5wf:iXwggV:W MM W' W W Q Slibazfifwzsazmm V W , NmwwifmwslszxisssWW 3 Q, 1 wwmmga gwgfmzw XP? pf A V 8 . g wgzsesw ms 2151221212252 vmggg W gm wwwg W 5252212525323 Ewhgggiimq Siwzszzsziigf W Ez-,fam 3223551222223 Qwgfyifkiiif me W W' wi iifggigzzggg QP WSXZSQAWQ V mwfm S zsuigigivs zsasgigfzzaszz aaigigvifi 535325222352 -wpmigziziif iiiiffizzzzezsg QQSSYRYSWSZSQ 512522332255 a Sgiigiwag 6+ , gsm GSI,-.BEWEQ5 M. Szwimmw Zmkm-.msmofff 5223333555 E295 WZEQZESSZ kiiliiiigzzw V .VW is 22530333 Q Q3 pgiigigfg i 351315 fam: mm gmsf Wifi? f'2ZJ5Pifg2 :gangs saw: P53222 512223 ities 22535 ifwwsz. :ww Sams :amz 51224537 152221 Wai? 451, ,W :mix 4: mais 'f JRE s Qsiagz 5:2225 222522 33:22 was sms: asm new fm: wggifiw wg 0 Q yswxggfgai wgggqq M341 ,Q W M 'ANMWWWwSwzwwfzQfwzw,W V5 Mmm emifwm-93523.35Zgigggsgggggisig VV how. awwww-,,V.,,W Www Q 1 www W ,.V, ww fb ms'fHmWW wwwx .WMV .W W ww M M myvx W"20"MwwWW 4 lm mnv, V Q Q Q' f qw www w,MMV,W.b V Q,gw W V 52'S'SEfmwvW?fW 5zWw',Vv -4 W W . V MM ,iw Mwvfizgvwpwgwsa mm msfwNS,?QE1S42egw sxwwfwgwf 0? vmwza Tiiiwgzmziwilfiv- ,gf , V V an ziyzwf41gg:ggfggwggggggg,EEg224gE5iE454444444mg 4 W 4 ' 0 5. WM Q V f S Vg 'VmS.5gZ.,sgaggi,g ,M 54 9 E? 552Q?i,'gi'igwegw,,Eggg5iV4gg'gwwgE,445ge3gg344gg2gQE?4'im4 W4 4455 45? ' W f V,-. . , f Q , 4 wx 4 mam. 1, gfigsgigiwesgzziaiiiiggzarszkm gags 5 " A 19 P-, , lefsfdrwgiwgwmfwffg Sw g lfgwgis,-,-M M My 325 W wE,w4 gn., , V :.w,wBwwP'W"i,qQ in gww wwe W gmym Q Q M 2'2"W'se-w,w32Yiw9i '25 'wegsliw gg-gwzims-wwwgggs zwmpwm , , iamm ia ag 1 'A ' W W dsiiikmwhzawiw4f9W'Wfi13f1wffN'm.AwH 23vZ'SwiWfm4bg,,,f:WMfw5w Wy Qwmwwwwm ewwi was M ' ' U Mewifgfgspiwiwowoifmywwfvzim ewgg Wifimw QQMWHQENWESSQ Mewsswiwawmiwl SN? ,Pi sw Q e ,Kg 4,4 W 4 4 3'6" X' ?Jss2sg6m:51gwQW?sf'1? , f Q X m5?w'41W1W 'www-wi ,U 'sis Q 5 Q my rw, Q bm M WfzmiffzsfsisiiifiimzwM9w?gsqg5ggxi,f2ww1gg5:sPspy? ffgwsmsg WM ggmigfmwws Mama 9 ,,, W W MVVV M Wmwiagwvs' 'W fg wwwgew gfwl igsagvqww 'MW Qshwww, Q zfwznwowgwwgwmw W my swag? M .lmva wg2,?gQEQagN3T3i3pW0s.wiMWf 2, 8:9222 sims wg wwgehgfimmg umzswwfwr Fwwagewqgwwg wgwffqmiwimslk wwe., . ,N m,,Wzwwgf2fg'i'gg'S40,sS Aw 56 DIMM 5325 'QW miisasgwswwgwigif szesfwwaegv-Qmwwggwgwwesvawgiiiisi .wi M W 0 4WWW.mwi?.wg'g'gg?gnw,4 1'PW?,3sfsqs ws. wwgwgw mfvgwwg iagvgvygkgn wwasmwsigmmsmpw MW, wwgwgxgmmimwisiwymwgwwzfmWww :wg fvgbfgwawgw M' WM-'ra A ' V4 ' - ws' ,W ,faux J . ,E WVVQQQQSQEQmei53222ii5,fE2E2QaeE3zEEEEi2,?2?52Ef"2'2gi22f W wi ,wawwwizzwwwwwwqmmiiawmsi Napmmyswsbigggg Q X532 img ww. may Q 1 1 his viii: ifm 251132 as mv ww Q S5225 iz ws 2226531 122223 Si as we 1535355 va: .M was E 225523 196529 Q mf Wm sms: MW we 122532 sims f 55 11, ai :W new img? gm? EPM wig :wif L Q' :sie waz amz: 315633 K img, we .-5 ww 9 53:25 A igzzsa V Kyiv 1625194 ' :ww megs' mmf Q s iafgz 1' Q 15,-.1915 522253 'wwwv mm wma W ggmy Q owgifv W'-' W, V ,iiipwf ., 'fs Q V f QQMEW WW,,i,gV,V744W4w44N4 , . 4 Q Sagem zifzifxwf,W::.Q,E,V,VVVV4 K '9 w7:ix?awv341was, fswzwmw V S ,V,,,,,V , ffQQ:KS2isswgwisiiizasggzggdggmwgg444534445444444444444 4 Q S P gymWasabi?wgggggiiiigiggggggQEg,ggggigEwVmB an 441 8 2 M. Wmzwimzwiiiiiiggzsizglieisfgggggggwg 53555 , ,, W E fr? H'5225iQg:Esa:gagQ3w ,W W. Q, Q9 gg3zE3a1SgQiggS,,zg?w2, . V 'Q ' ' 1 Vg P zgqglsgeggsgkagwm W U. , ,, W Q 'wwiigwggiimiivfazsmzm ww v A gi as :Exif5F2?Sg51?2u55SSE3vg53fgu255a2:swgE5.gAga?VMS V 4 4 " W 'H M4ffM10e5z.'sg2.f:sigEsgiE4EggV1gJgQ iw :me 3, W Q, 3 sfiassiijgwswasraw p,,,:,,w w ,, QQ W wpiiwffq w fy? ZVVWVVQA V mg M Nm 3 iff gldmifgi5EZ,ig5253.xiiffl??faifgggiiigg2i?Esg2gsWg?4gggg,f,wmaV 5 E V Q V Q 2 ww W ,ww Q Pi sam E V wwf x 2 'H Q aw s T3 2 Qmmvz MS W Q, s 1 wi gg? M52 ,QQYL-2.53g1:gg?'z?f?12.2EzsEs3gQEFgHggg2 .dmqugw 5 ' W 4 ' sw Jifggizz H1 fmism MV V, 0 2 222 wi Wag Viz wi VVS 'W A 1,-5?m'1'2'.,, . :fo 4 1 sw E W W 5 1 2,3 sw as 2gggiggegggiggfggggigiggz,MMM V4 2 4 ' 2 QQHeSggvgz4ga265i,21'?S2ffff?2,3?A:,m,,:::gM,m WV 3 N ffWf'm3'Q1sfglgwgglwfvsgzaiofsxieiliiag Q Us W E192 Hfigapiii WW wwffgn ww M M- mmm? H55 as ff :Q ff vga M X. S5523 QEQESQESZGQSZZXQHI iggigiisgeii g wgwfw e9'wg,'gfi2 , N Q Q .. 1:-Q: wasWigsmfe2iM2w5Smf:sswy2H53Egs wa Q ,gy 4 VQSQQQQWQHQIPQQVQAQ wemww W piwvw Siem my wg4gg5i,g1,Nf ,,,a,,Mm 444 A , Q Sigma?A2VVQ4,2213223252925ggigms332523ggggggsggggiwiggiggmgszsggggigg535235Esgggggsigggigaggisgzzsgagg VXQQSEEQEQZWEE EM W, fagqwl 'H Q P M www: MM if iggsggg R'Xwii3'5w sf, 'gig m,g,3? EEN SEQ gggggfggsisgxgw V 8 QW, ,fa-.WS ggsgiggwg Q-iam, Www 51, ,, QAAwUmfMgzaiwswziifgwvnivvm.Vsywfiiiii awk KsgKS5vEgGf3ifi2E?e2f'2'??S5Q M249WSHgiiwiwiifimvzlxwfaisif M sgww- sw ,A Q ,V , gm V, N 44 4 4 ,Q my AM" F wg swim: Jzagjw my 'ESQ QV? ' 34 wi " 4 giwww Q If M H , , S' ff A 3 gg, 15914619 'pwfgw pw: ww: My w ag , 12222 P Q P 25a QiQwwiw34?i25?EiQQ12:3me2222522222255wiashiessigmsgi 53 252 aw wkggzgwegggggggigiiihisx wa Jwxmw mmf msg NQA55M1af1,AQZSQESQQQSQXQQEQSQSZSSQQQmmmiwigwzgQvwirgwgm zssmgggggg was gang: Q W mmzsaiwmzzsswihwawhgf :gg-:::::r ww 293.353 wing xml Q'-Mwwwf:-z:,g:HgVgg:,gV E312-ggi za fmt Weisz? M M 5323532 313322 5123 35525 5392535 xx was' mfs wgfiiiiggia mf: was EER 5322932 125222 :Sw 2222225 gggiiawgigf img :E " '31 Wu MER, ,SAS A3122 fimwgiifigig 5225552 1 Egswwiifis 122,22 ' me 222223 3355? , MQ 1:g:,::.:.-.: E353 mm 226553 is-':fE:I 'i. ami? sim Mg? ' 5g5f5? f.f:.::. zigzag: was m wagsmiigg Qfigwg 122352 ., x Siww 30152 2222? fi'a5q 521.5 Egg 2 1'51.:E.E.:... V F N5 5:.'::'E'.i:'E.-5. f 492329 im? F V as T7 'UMKW' ogg Mg ',,.W 'SN wi 5125234 ' :wr Q iiyiggiiiiigiiyfiiriiiiggifiifiiagzQXQEMQQQQQM4444 522252 wwigagggigigiiizvymfkiwrG22'w?gg3w 5:mg2225333wagsawfiiiiiiegsmssWe-MW WEE -.:. .....,,.,..4........, . .. -.-.. 1 . Q, W .4 V 1 Q , ,V mm W V ---- giggswsa g gggygwggggmgigWaggaQSQEQQQVEQQQQEQ3222223255232mi:iiiigigzggwiqgwggggwgbfgggiwwwWS,.Vgggg I sf E55 15251 15-'f ,. 'Q Q WH EZQEEWGQ 1 W Q ZW F322 512135555 A:f,:2'ffPYiaW1W3f25ziWl 5222259g4f'5q"W2'2iz:PWw WW. V VV 2 01 52462 E?2?zi555sgiEsw?EQEmi?3?:SW22225522Sizziiisgimagsiaggifigif H V 4 was .. .. ,.,. QM :ms .... E Q 2 W vi 2 RAE., , H ., A 4 , M. Vi. 5 M M 4 4 Swan, 9 GH M , W N. me ,VQVVWEQHN QEQQQ 5225335522132gfgj'??QigEEb5?gaEgi2ii323iggigagmsggggifgggggfiigggggggggggjfgggg ,gggzgigg iggggglgggggggggsm ESVWVNSV sages .,.,. :j.':E:ja: VV V 4 V Mm V W,-.iiiiive ggiiggksws gggxggggsg gV,,22agiZm:gf?s,Vg2Qg 35233:gg22QSii2EE:za:Emz,iVaggg:aEg mek? QEEVQEQQQQQKQQEV QEVQEEQQQ VV.: QW V,Mas,ggsggig2gis,zze,szQg:fWm,,,,,Vg,VV, :V-Zz xxi. gaaiasw-Mfiwiiimezfzaagg52223533123agggiiggggigiygnzefzsgp'Sggggzgzge2:V1m2g23gVgi Qgezizmv 2fggg,,,??az3zs, -:1.rff 'e:f:. ::.-:z :: 5222? ag iimwwesgiszeegSaiigiikzzfgwgiwwwgV'fmfgigwa-gggwww to V I-f-f-"f wiP252SggiMHSiwSg? again M5314 fffigEgA:2 ,.giQf1s3,iwg2gpw2EgEw- :,-::-2:-g.:.Q::. H 3 gg: as M wwwQQY32w?vi42?:iH2E'1if?SE?9 QMSQE msg 22522 2 We ,L ..-. gE2?iweQwg:S'iS gE ge ,g0g.5s2S2254Vg 132523 fgarkwwggassvzfgf'azgmsiwfeggyzwggawxig bb " msg: Q' -. 1 25,231 'W I: 0 6 ms, Va " 3 4,-we fe' FW 'Q SWE W 5 as W W, 4353555 44444 4 4, asVw,EEQESVMWQEEEEEQEEgigwiyggggigigggigig 'sx,:-:,,:- ':2.:: .... : Q g,gV,,g,, ,Q W 'W 'Z ME, W Us ,gg IS'5E'E-'5- 'E lf-'5: .. WW -:V VV - VV h"MW- x .. .- gi E S 35523 1 ' .325 :mm was V V -4'- ..4.-.. -. 2 Wm ska . ,. - gig? 2252 1 V xiii? iw? 5 9- ' V Fx 4 Q K TY 1 ,H W ' . x 22223 52352 W2 - X A sm? WEE E552 , 2, jg 1 ,V 2 29 V 4 f -lx 44.. . 2- 1 X " A ' Wi 25 X? RM ' A , we 2 X X V wigs? .E-1. 4 ig 3535 NZ, ...: ...... 2441: :':S:.-2:- -. 52.592 ggi? W T2 5 we .--4. X QWA EVEQ ypfggmgiigwel Vmw R .3 is gy gm: V imma? , ff gf . Q as 1 ' L sr X3 xg V' K1 gigs? ,::::?f5'E... :W is sggggw gk QQ w wg Q x W'- 1 L , V. V , ff f- l H 'iw Q' f iii? S df P N if ' 52322 QV 4, , 4. sw N ,Q W. fs ii' 4 ggi gg 3325 4 if X-h' V! .Q W uf an .E if sw diim, s 33 XV, ,, V V, m,V,,M, ff 4 min saw M K 1, L+ Mx s,N .ns , .. 4. 5 ,xii ,M 4 V, . 'D W 5 " 'f ' K K A 4' ffl F U H f 55223 523325 "sf .. I. 2 "" fl . is: ji., E322 . V iw fe is-S gg 4 .-: 4 4 ik BEEN- ' Zifawagwys 5 Eiiqww 25 www Mgiggg:QsWggggE,,.,g,gEV 444434444 A QM EW 2 is H5356 af ww. wa wwf WW, V WWE' wg sw M . MM S M W 2 ENN QPQGSEQSEQQQQE gigs WV 5, 'Qfwfwf W 4 Q 1 X QQQQQQQ ijiiiiqjgmziivss wsyygvi 443W 9 fa .ff W wwvsmgw W 45? wgiwx H25 Q sfwwswwgig Q Q V QRQQEQQ? Mggiiggmgeigglggggggg 423332444 V4 V Wm 44 4 H Q W2 5Q596Qkwwsgigiwgfiggiisivzisziiswiaxian Q sy ln ww 3 RQ-'GigiWi,3WQs1g1giSgf?wgigiSQgiggiWg521243245E.VKM4 W? 4? WMA giwmpbgfs 35525 ESM-.ggx wg, fm ,wg 0 9 V Q ,V , QQ wg W SQ . 4 wg? ' g ssmwfsv ,ww ,fr M W 5:25 1WE14jggj5S5:l'i35'?,2ggiSQgfegigg,-ggmpmgigwma , V ,gig W' . mmf as M A E Q? igwifasiim V V .V V ev N we W, f,Egg4E5Si,3iEiE4.44154Ei54xgg?:wf1ggg5:4g2:Eki:,2,i WMS 6434444 4 4 Q4 M ,Vi L E 1 Qs W ff faq Wm gi w2Q,gwi:wiwfs'23G'ft '51-:. 1. 55 5: ..,.. 4 Q sw - Qs, .. V V ig .W 5,13 V WH , V Q 4 44 4 44 ---- - ....,. Vwggf wageg, Lsymyg W 44 4 Q as VV ,J ' 'ff-35:-affa. Q 521.. ., uf 4 E. . ilk? Q2i3i35E?gib2Z gS iz3mgsggk,Xfx.W,.m Q, V M 5 VfgigE?SggW?z igwgw .444 44 44 E A '- -' . A .ww ,V V B miowsg awww :ww miswws wggg , W V V , Q Q W Q 95522 edgggggiaivf Q52Melvinsissaizzzizsffgffzwim 135 Qiigigsfgfiigiggmgxii HM wvwgsemx ff. ,i2 sW5i?WPWhHawfHwww2E2vwigwswzxzygiwiiiiiiimgaEg ,Mig ,g:3:s3?wwVggggfg,zwQ5ifw A gig QV f V gan Qggsgwwgzaaswgvggszapwxgm gg'xSZS35i5,sgg ,ge E22 , is V50 D Egg gmsiwmmw MHgmgmFmeggfgzawggmmmggwxingigizwfQQESSQQQQ . V Q Q ,MQ Nw ,ww wwiesdwwssmgggaiggggi wggwafzweqg 833454. Eg-Q Q ,ggggggg gwgggiadggi . .:.,: .-. 49 W ,, g.:.a 1 , Q R ff Wiggiiigigiggki 'wmgfzigifisii 2 My gisuiiik gm X V """' fr,a1: ,... .. ,. 2 2 g'S315g?g5ggvi,gW'ff'56H'E5'i? '-:-: :S Weil Wsiiigiqwgeawes g, 25:'2s-rf' f:.::r.:'. -, f-Q55 Q23 XW XWWQS - Skwiigg. " U s -5:, -rE 24i: : :"-5 W iw KNEE? ff 92SZES2S1?2?'?Q5i ,. ,S 44 . 23 LQ' ,Q , v 4.E,:::?g.:.:g::5:.::. Zg, .g4.:..E:EE4 :EEEEEL 54:5- E4-gg:-2:35 55 55 3:54 wigs 4 44 . ....,. g. .,..., V 44 .E4 :4.E::E:.5:4 gywggggwmw ,,VAgi,,uV, M. 44 ,444 4 4 HA.: .... ,W ma-Msn 49,5 53442431 rw gd hmmm Q. V 444 4 My . ,V Egwiiiwzigszfafi 3,Ma2??AgiwwwE3gEE?gmEm444y44 4 4 4 44444 R 4 4 gwwfe 4 4 1 Nu 'gs 1 1:5- 5:22. '52 H - -'-- . .- Q ',:,:.:5:. -: ' 4.43,-'zjgg,-:,..:f:,.:af: M 4 2 ? . ..,. , ..,. . ,, " " 9 'SM 4' gg ggi, W HP Q9 .... 4 W W M Q V V9,gbsV4V,4g 4 E vggmgwssg M4 44 8 8-5 'ww 'Q in 2? ww in 821218 angina wi is is W9 3 N. 81' ga Q wa ,V ,V EQ , B '-r m -if.: .,..: ,.,.. . 2 V V VV . 4m44w44 4 . ,. . .. 9353321055 :gVVi4gsggiigaE m:g?g3gggV,,4 gg 563,25 WS, E3 ' gf 4 W Fw 5'iS'm?i-Y-milwwf :::5.:g:,':i:" VV Fw miiiigigg pfglzxgiigigigasg gggg ,,4,4, 4 . .., , SVWQ. Vw? ..: l:: .g5:5,5:..:g,.g, :g Wa . . : :: :g :1.-1 1,1 ..... ,4,4 -' ' Qi H WK: ' -g:i.'E'E: EI.':2EE.:g'Zg .. in swim W 4 ii 1.4 if fi 'Q 'iw iifgw 2 rf' ,emiwg Simi .. mt sigifxgi w i g E5 ' ""' ' M' W M 'E:, :g. :i:::':i:-3: i::..:::i.' 4 -:-, .,-gg,-g:,gE .-.... 5 '-gy P -V . , ggiiggBg44g4EgwzQ44g4g2g4i44 E 452 as ' EQ L E:-Q. N ' my wiv :. 'H W Q QA? m3vggglgggg?'Eis wggm Km Q 4 44 W Wwgsi, Qiggjwiii 53? 3252533252 s igfigiggg i wmgigaggpn 8 5444 Q ' ' -V, X Q3 gms J, , 4 8 " ' W' , -g: 5:.-5.:E.:5. x:' X, - gE'X Q 3 . V "' ZF vi QQ g Ms W A M 41 .T 4425344444 I is 4, Q Sxw we Q ggi ,www 444444 4 ms Qgwisgsaegbwwss Vs E si? NS S we N at 5 we Z E 'Z , ,... 33 E 15955, ggi ?ii?g ?iq M2iVgigz34gg gg Q Q .....::.-. 1 9 ' W E Q wiring emi fi Q 1 W Q2 W diff? MQQQW M? V, ,M VV 3543444444522 Vg E gg Q wg N 4 T ggi W 2 .,,. ,.., V Q, Wagga 23152, gg? Ei . 1 Q Q Q' 3 4 'r Ex 4 WSW 2 .-'I . .::E5EE::5 - 4 fd , V , M ws, 15,,4Q53,,,2,vi4V44 ii in MW 8 , W Q j4:.::54.E: :4 S4gg.s,ggE E Q gsm 444 gg f X Q ga 4, - 4 Q w f 9 2. Q Ag, ,Q 9 ., Vwmfiwazgwgiggdggggs 4424444444248 Kg 4 , M W' Q 98 9 89 . Q, Eau fm, Zig? 3, we M252 W4 5 ' ' . , k if 154 w, M 'nik 0. p , P wif ,. 44444 4 44 ga sg? mu ' if QS 9 V, 41.5 -s.-s:a . gag f M5 We 358 ,QSBEZQQ Q lv ' 5 4: ,.,.. , ,..,. V Jfsgw ,nw H we ,Q Shias? ., ..,..., .H . E .fggsviliivg gisgaqgi EE gigig3w gf53Egg3E wagggfiggegggksggs rg Q Q and Q gwzxq lggagzgzgggi zgsgi 355435353 444 5 is as 3444 X B44 D .... , H . . .. 4.,.g:4:2:4 Q 0,4,W.m4 .w,ggi5m34w,8WQ5gjseVQggggggw,i?wVTiWgwmguggrgpQ E 3 3 S 325' QW :wigMyTwiaffalziizfxmaxg'QSSWZY3352? Q55-4? if 1 33215 3 8 ,E ai W ,,w?,.,,V 2Zf?iZgg3:1Qff?iggm5i44ig A mana 44 2 is M ggi is f Yiiiggzwsssxsxmifiawggiignggqds Ssagwgaiw QQ? s W . ' wg S4 Q gay gigs? Q .-... H 4g,,www,W44b 4 V, 5 gg,-:g: ,: K 8 E .EM-::4 gm digg, wg? 5 ' W Q M was ,gg Q as Q 2 9 4. D .5 ,V 5 V, in Sims? gl Q in W' 'M W gs gyiwea 2 W M Q 1 ww Ziwgzh ag gzws psig as E ann D Q awe ,N vagina sxwgjsawwi is 544 ,qi Q 8 wwgv, img Q 5 E D W bg 2 Em ,V Vw 4 if 9 N 25552 ws gg 4435, fwmg . Q' N ,Vx A V ..,. V Q2 V VV, fy Vi V EW E EW W isisgwg 2325.35 ,aw ,ag 4 , 3752 22 QE? w 5 4 ggifiiggazizewgggmzwsgwma.gy' Kgs, E ,Q M Q B wfggEEV2w2Qggggzzx, W Q M Q V fl 5 ,V W W V mx Q wi gig? Emi was -- wg iss Sw? EH fswgamwfewwszvfw gmasmww M HM V S Q sg RS 2 w 44aus4 gQQa g g W bw ga if 513521 Si W3 S wg +2 - Jn- 4 P1 'L 8 ':::f4::4g:"' W E? iii?-:iE'5Ei'E:'i:fEE: :'T.f:'5':5 -:.:"fg5g V, .,,: 3 5 V Q4 M iw f -ij 4? E53 f-5 Q 4 ga V V ig? we 2 tie Q V 4459.1 M :54.54H:4 44 4 52 fs ..,., V gm M E- , , ' Qsmgga. . V Qgwfiiiiiaamiigiiidg 's?Sfg21aWiE?v,.mbx,Q,. New W ,wg A 1 W.myY.dxasxgSSREQQSQQZSEQYVSSQEQEEQEQQEEEEQ:Eiga ng? is A w Aims?-masigim Z Eigggg gw- nlyazqgg . dgawqsbxw A wxqgwmzaysgezggggigszxw Mmm QV, ,J .-.... . M MM QQQVQVQWWEEEQQSEQQQ fr-5: 5-am. 4 if-:. .,., M W M -15-g:, -::':'.'5:: ':E- if -' - -------- : . .,.,.,, .WM Ex H3 fdiadi T1 w2E,::n212i1zs?E:21winxi +51 -,sf ,5g,e.b:53-,nwqgtzwgz,wqw-qu: -' ,wwwfw5,NQz1W HUM U4 Aw' ' " z:w:Zf536?Qf:12S?iVf'V ' u mbsf .W-"9" " ,kwa 1 -'NYS' 5 ,f.,,J f'U'fw, '-"-wr :L g225Z5s12'i33?iE'1z:zefgZ' if, J ' 2 WW 01 f Z Ay f ' 14 X f A A " -mw,., ,H-::f,w,,-H mm, , .W - 5 1 ,,I"', ,Q I, If "i" I f Af ,',', H' X X M , V 2 9' X f 4 A J X 1 X 1 ff 5 il a mwwws vwm4m,x4,w.sWmw1..Dm. w ummm fmfzfv gms fwgw ,3e'zZfig,ii ml: UZ 3: 1121 11162155 QYZSQZK. Qwiiizwmgw 'H N 1 aww. ,Mmmwfggi S5ZQiZ5Z'3'ZZXSZZlMZ'T1 2213 211 LW: Zag W iw mv, W . Q Q mf Z if iwikis Q .pf L - S 3 ff: X Q '. KN .sf 5 '.-s Q 5 sr 'A ! i V 3 . I I f wx i Y vi- M 5 gf -x a 1 i5 g 1 , Q 5 li. QQSS? I f es xxx, ily. GMM .www h wdfiawgszwb W gk -,-- ??fb5'Ti1z:m iiygggiisgggimwzz f Ssqwfzlwizszwzbbi Mwfgzlzgzgsng 'NWSZEQZSSKZHYSZFX U g,L.W15gqi:QwM'fQ g M . . M f xivzzzziwizzzzg Y"4-WW 7vzlwzkvwl,-:,:1,wsL,,n Aw 1,vw'.w "qw1Q,w1wN',,wMi'1w ' nU4fm,n'2,- ww Eff' " ,Mx iizizih qwWw,,wgxW5,,,ww. 0 MPM .wwbwafwxm s1W4'Zi?5wWZ3.m 13? ei M 522232222 lin Ngww ,clan , W..,.i.,w3nM wzzzwg'-zgrn.. f U K ww! Nazism 4spMygsm.Qggzzaiggzsgqgigzzsfp 3 My aww my M1 .Wim mmZZiS+ff"iiisQg: ,, ,Wmwg Yimgggzwagfi M :ww 5142335LL51gg::gWgw31wz3.., M ww 1 ,MMZZ Uwwxm , P Q J 1 1 2, U My ff X Q ,n Mpffeg: mx., QZLESAQQE3 ,q,v5ggiW.HgW,QAiw..r VUWLAMM. L- .wfg4.., LW, . .fy lemmfggmw ,WM,,kw .wmv 2 Q am-m,wwg,nw21zi?' L'1lf , . . U .. .A N. , W Wo, ,Www , ww- ww v -me -,awp Mel w W1 ,Wh Mmgw, , me Qgpmgmwsagq wamvw. ww ,UN W Q.,MM,WWMw,n.g..4.mWMW, mwah W 1 ' Q P I X' P mf JZ P 0 3 0' f" XM :Zia-vsfiiaswgff? my img Rx if :mi 2:-:SE 214221 is 22:32 iiifri SSW :am 413535 55132: -Nw BMW nmwli' vo 0'7"-W X., 1 3 ,- .f ,,.- "I 'I 2 F U 4 aww ,4,1,,.m5y M,wmy,,.MMw,,,wg U, , w ,WW Wm 1, P 3 Warm HvWzQ,,,.ww0mMWwzsmwmw Q fl .QW N ,wwf .mwmlf MMM, W7 UH 1 12 , 'Kwaww-ww . lm' 1:"iW120:zz:2:1z:NfzP'ifffgxziwx 'A 1QNf?3i in X w2'l3M.,Wwag5,e1.11-fwgiq,-wb H M33 223 mi? time W1 1223 wwiwgwggmwggzwm,W'1::,..H 'A:W,.wmu fm Q my ww . ,M P 4:22 Qimzwiszises Y 1 5 A S f ik Fzfzmwzzfh " ' V 1211335 me 5.1 D, 0 X , MW 91 Ylgigzggm ff N Qu, Q All 'E U,.w'Z3gM.W:Sma W A , zziqgzwz ,N L 'Q -. i1wiQ.z,m:. N5 wggsaixligzizgaiw uifii k Tw U M M':.ZmpxtZ k Efiimffzzhiw 5 wlzzpwzzzzwbwiv'-fiik. 'A W 'Rx xii 'Nu Q f awzgwggziiiimmwziilw:zmzz1 0 T ,.ggg0wQ.,q3AWw M .mjiflimwagsw Qi Q mmms,.iUq:f:Ui.wg'g4maSisp. .qymw LE an H ' wsihwqgztifm, Qu itiiswgggggmafmiswmgwwg,Mm Mmzmwzixoa. ffgw g1zf52gs,::QSWfEzrs'z:2f: nf 21 g sling-335112:ggggggggfiflsezw 5 Ll ww . Y Z W613:214QWm?lwziwisssaaimzazgqiz Wfiifws fgjhgwwv SEZ aeggysmxggqw Dilip U Nw mm., QQ., ww Www www v 6 EH Wm wi ZZ M 351353 1 . 4 1 V 2 :fa s V if mis 1 ,, U gg Q, U ,Q Z Sian : z 32211522 5 M 3 5,1 gag Wi .ww 6223225 Q ww me z Saw 255' 231555 WE 1 mggzsxg 1 ww 525' V My gum gwiigngglg pzsvggg , fwszf 236 Aggies 2 32332515 ,zz 1 v 9222? zzzllgarafd , AwA,w'5t'ww35g ,wwjgmwgps silsfliiizsz is ZEZUSEZ' :swag S3523 Zifzagiflzk gigik Z2 Zmwga 15335 Eiga? ,assig n Nigga :.:. 23335 35355 g'i,iii1 :2 a. wfififigfg zxdfgazzim mzgm? wiv QEQQS wziiimgf 31593223 7 1: .mi 3 61132551 gzbzasmi 4125222 Q X W il 1? 2 52337 AL il 4:5 :Simi Wzzstms Zwwfgefzi pf 525 SN zizfsiigi zz:mi:1x?m,?gg Jw www 1 Www M ws ,w W f"'Z:1 sw fs,-p4Wm'm +iM'60wWPM0 Wm-My U S' ms55e.wggiiw'5 fs . WMagiw3mz.B2wzwgm.w,gw,, mx ifH2iziwgaiiz,5322252225215quash ,filfnwg:iiiigziziwzwisiswiaiiiiiapgzegiiifizlzttswwg V Q L. ,M.mQ, , nf k I ,Q Q if U 9 .5 g ,ugzfiw Afggsmzizlimfezk 2 f wsifv: ,iwzzifmmyfzm 1: 1212355321 5155322255 123 ifigggz WMM ,Lx Maw E wgmgw 4 , , 4 .Q ali., ' uv ,I W w Mi QV V .W ggggwmgieigggfgmwMQQZMMEQQEwfggfgesy WM M sf Q Q 9 Q-f K wwwwm Q am - ,y L. s ,ay wa 5 wg'.mW.mww r , H Q WM ws' , M9 wwwwemawfig Wig! lqgeewma DSW, dw fx, m,,Wfm5,Hg my W yiiifiw gsgwgwgiigggsawwfawaweszsgmzzdyg svzwgfaeowsiwgigwgvwggw P? 'figs f Mi'wgwm K5 ' gy ,E 1, ww , , 1. W N W1 my ,,, lgwp-,Mei 4 Ng, 1-lm My .8 'www s5iw0E2'Z.mSq,Zg5iZZwwwgggw whim wifimmiwifimgaslz www' g5g,,,4e2mwm 3 awww, , V Q , ,wmnma m,WS'5,,W012, if Wwgwgw gwwy,-Maw Www zwywmgw mg Mwmimsw QM um Emmy gmsmwywimgg wwwQiqs22iZiwZi'3w3a'fZi,f M239 WfwXgw'ws3Swww'Z1'Z' WSW wixgwgqiiiiw W: ifEZX'W2ww5fm5s1N"S7sf55 f, ii3Eg"W5??gg,g9,Ywwvww-'SQggawwwppiimg?321,ZSZ:ZiM" WWWQNwwieiiliiigwvzfmswgDEM1-fbM421,-Lv,LQYWGwwzm-bex0xMw.s,a'31i"fWgm , Q Eqwgvggmwggvfy-gxwgglgvo.Nggwgfawgwwgmizigigvgvwawgwwms5mgwzgggggfewegsaisigiigwmm,:,'g2gw'mggaswgs8,hg"1w Wigwam W X A 6. 0 W sg my W sw pf 1 ww W ,gf W f w My W- vw v ev E 422 Q .ww 'aw ywwm Mfg' W 'Zpwwzzzzgwafvgws?gfgiwgiwswW.Ws,z.gQ- gwgsmm, gggwmmmi awwwmaizewwwwifgtzfwwzgifz "'MwweR'5 wg Wm M Q 4 W 'WWQE-ZQZWF ,Q 5 ? , Wi ow ww' ,g,,?f4,N Memes 13,4275 4 U' ' 2999? S wpgggm New 9 ay, 4 4, QQWM1 1 47 as gww67?W'553 M ff 1 ggfgaimgmigggagiidgaggzegirwiagizifgia'ggi-ggfzmzziiwf3352grzfiaiiisiw155azzwiiiiiizfgfim1::?2Z?2gE'is3g:5'fgk?1.ESzgiviiisiiszwzfzizzzgzzf,..., -- - w,,,,W,,,w ni we M Q ' .WW Q, ss ,zlvvgfgflwm 1?fg,,,m wa '53, W W 'mis P 'fm Q, im W4 M ' mm M Q, 40 Q M WW 4:1 ww ms Q Q, W, W 2. I ,eww 4, gag?.,AQ:eEi:.mii3g335aaziezseisgiggggfzszziifmf:525'EEQ15-gfxg?5312525Viz:gi::ZFMgmt1Q12zWai?1'H25-izffmgmgg215151:sg5mig:'gE2f,,gg2fig2fQmg::f',1zz5gg1,,,,, gig gg Www Zvgmgwwzswga ,,,wg,y1sWEgZ'gk w.3SW,gJ M3 ifsm,.sg.,,g wfiwwpizif-ww me NMZMJZASWMMM awww? Z ew zwvmiawm 3 'M fm' mm mai ffgfwf W, M , . M mg, M 0,4 W Mgr-ww: swf .W ,, Q www m,,,J,,1yf'wmm.W M ,ggwa 4 v M Q Q www w' igwffy, mswweiz, 15,2 - Aw wg S' S V, '00, M mweysm' fgggfwmmm 2fgywsmm4,eg3ggMw,Q4ui 23155 wggpgwiwm ,mmywygm fgm, wwf , 'Q ga wwggwnm, 9,1940 Mm, Q, 33 W W H0 0 ,M ff'.mf22115233.25:ggmggwigfmazm.wegetM4.15:aanuihgifwi231:zgsaiiwwegigsi?Sqiaiwigggezgifggigi1351352,mga:Eg:ii3212225iizizffgigiiiimzmw if 1 aww ew Vemzzgv zzgzwwwm ,Q:g,:g,fyg'weWw vwgw mmm gym E if "mb, , , wf MJ S1 ' 'fm -,SH YM, r , Q: H '- ' " , 1 0 V1 gm v1wwmx.,4N,,.,, ,wwgwm W ,zgwg M my .Jw 1 was 12: www Qs Wim 1 mmm, '35 ew Mmm Www M ww wwf W 4 as ifmsgw QVASZFSQ rn "Hdwffmixi,,::gg,w6iw,miggrggmipizgggawx-42, gWM-mimq,512wwewmmwfifggggggwfvf ww wM,iJ2W,g,gPygpim. 'gggiziqg ewwggwwmgw gg 5 X M5235 N.,,MW,4f::c:z:sfw,,gm,mf.,,Msfaerzgizmmmw,ws.gghemmm?WW4,igggg,2m,,,gw,f.y,,i,,1a,g.g5mgf, p,giggfwgA mm :,,., :: Qgvg ,WM 'Aim M fU-mm,wgigwzsefyfmatawwwxXmfrwMms,z3wgMwwww W4g,svwwwwin1,?',,,Qifgigffgwm0MW0m mm .'wZy25m,.2 3 gwswg waw me 'Wx fwgw M, ,,p,w,, 'WML gmiwwwhmg5'1PMMmfgwwwmxW,iifwh1www5WASwamg?ggwiyaplswgsxgxsmigw21g"fvwgwNw,3.8,em, g .Ms-wgv ssiggg 'wi may 5 SQ W. g WW egg' wzm-M gf "mvWMaswigyvwawmgswewnmanQ33235034ww1swwmegmgfgafgffmws' .71gm,QQQUZQSQQQQ,lbgkwwwggsmwlgwdgg A352 Q 2323 ,Y kgs aggagvmxggg Qian QE wgwgz' 4 N"M'MAA:z:2w1w:32,'mwxwQgmfmzizagzfgzmm mzfzgywwwmwmmgiizgzbvlm QMQSSZggEg2sg4,5gg,:0mg5 gaggswfe' E352 gmisgmsimwmgsg' 2x.2,5sZf3a?lmvf Ami' fvffiitzwfwweziiiyggg QQWVVXHWvviwiggim,2-QYZWPflegggifliSy2,1522,222335'YWWSw61w4SmgH9f,2E7W'W934291965 wgmswigg ww WZ ,fp lewigzggfwgzffim' M52 mwmfm Imwqgmwmas1,f,ams,f'g:5ze1f':Q'fmQmizzzf wegmmzgsggzzlfwwgm'migiziiiezgzwgwiw,Mgmt Qggm sggisggg g,gmwg333,wwgsw, gwggggwgy Ewa MM WWMMMMmm,agiixziwgga1rwm5,AQf4Qwwwa1m1magzifgisi hfvifnwgmzqiwiiggi wi wi Nigga Wggwswav 'q,,ggw.mW3g' 525553 MWEQK 22622 ffm "W'Mem1mm.mf:J:g,gfffamW ,Mywwwwwwxmffmgawweszgwugmggwmmifggiwf www spiigvwafwuwdw 3353448 sggdd 1 Mm .Wg fam. 'fmmfMfimgwgggqwmhzggg3,wfwmMww:'Q-ww mmmfw Qbgmzzzzwfwdwgiawggfdiifwffffwiw wa mga if A-fff ' Jw 'UWM "EUS 'Awww nsmgw Ffwzwm g2?"5HWNSww39.2S-W9?WvE3'XQS'waez':fs.56SfSwsN2S' ' 'E95W:9'9WQw q2wg4"3'5Ww9WifmsZWQWs9A5??? SWWWE 'mf' im: ' "missiswMmiiwgimwwwm'imfgffvigws. 'www waifsgwimuqlvrwif' lwffgswsifffkvw 'Si Wa P' f '. new fi: ," we me 0 H11-,',,.f'f 'fw "ww Mrwgfm Q2 4' M219 F2 mm ,Wit ' ""Www1:e ,wx lg 423:95 gwfewfml ,gf X www wh im: ,saw Wwwisewgiizbzzs WJ 111522 2 Wfzzf fvwizssz :mfr mm QQ ,fda 2 jgfzj' ifkfiifz Wsmlf 2251222 LM' mm mm mag 1 van www Liam 522:11 im me, fp: QJFW' 'W' lim: sity' ' ' 5351255 ' 4822232 .,,- WM, ww assi: mes? f, W 6 giwmsz xfvziggewl 4 , W '50 .i I up ,Q fm., x3geQSN.g2 gggwgmai KHEWME QU. :72i':: .. ugigrs Silt? 555231 , , 2:31, 'WI ERN J' 1" Swap f ,.,, , fm: in f , ' ' ' P , -- -, ..... ..,. - ..,. . .. ....., ,.,..,.,, . ,. .. Q, ,3i2m.g,,3 dw WW, U V 4, ,, ,V , 5 , ,-v,f ,E f , , N am,2::: - :wir-,:..::.: if'imggiggggwavobisfimggrfwQ5.ss1,,,,.,F A1215 fy y f'wA','e Qgqfzfv, 2, 1525? mn .V .. 5-gg -: ----.- .:...,..g:fg:g:--g ---- f.-.- a ,.fgg -:- ---. dm Swim gm m,,,rffgg,gg,mMms ww fmmn.,,, ' dy, Y, , My Af, , ..,. ...,..., MMQW MQ k ,:2?agm,, Q Mmgwrgg ,0.M,mW,,, V V .. ,Vf , gm 9 X , 11 S memggS,ggg?g.3g5g22QQ:y:2M22'iQ2'wrQ,,:,,gggd?221?:Q:gg:gggf2525521wzm f, X A w'5fwE.s .-'-: :':-:E:- giwggjgaomwizmgbiwwfizzisgzff9vslmiwgvmWszszzvgifsmzgwgggfu . .ff 1: Wa .-... 622.31015 SizgggggggwxiigzzggggagffiiaiiisigfigqgxfihaiiiggggggdwziggzfiiggggSupsissggggwgmRA ,yyf Q54 I img M W www, W wwwmq,-.Q,.,2' iw mmm, f w4mw,,., fmmeaiwp Lfwwvwqm 4 Wwww, nw aww .-.. : .,.. 4 '8ff'?E-EEggggfWffagizafygggwuwsgzgwUgfmisfgggigwwbmgggwwan,'fzawgmw1,l:zggwgMwgm.g W, 5 ww 'f , A ----- AMEQazgwiiiiizbiwwQ'KQam::'gg'5E2 maasgegmfzahziffg' V'222:azfsgwDmyqfgfgqwgglfszzgzszgggn, 1' - V, 'iffzssqmnfgzrgzaemwasAgfygmtfJsf1s1:eg,qgw:s.ff,za Q,Qasem:Qmqafwsuwsfgrwmgasm.,B,W, , .: ---- ------ as Q5 'Z 11ffm1's?g?i:?-wwiwiiwafgww'mmzsswffwm-fv,'5'::-1'-fwsfa ,w"2'wwfM22f?2q:,wz1g'aff'-famzw. wk fi, :::g5:::g-:,.,.-gf: 2222"QH2myQif21155125135is2:m'a':'a:2g:+:i25S1Si1gg:,wfg5151:sgaigifgmkizgggggfliwsmg:g'ggz,sggws1:ag.g M W 2 V 5, , , ' ' ff 'F :Q ' ' fu 2-IES kms' f f lv' v 12:15 W ''Wii:i?2SYflJ::V:si:,,:gf55YSZISIWzt?Qwm5'5?2if'6'23":varff,z5fi2fQiiL2vS2::'?'Q?lf5f1Z5'sAS:1iV:E2WMSfsa?3g,gf,1MMV " 5 , 155 S -'a..,z.:g.g-gg,'g::g- 'M 2 " Q 632,11 53:fzimgfqykwwmilsfibgifwmwHUpfgigggfwgwmiiggw www sggy.wm,'ggg mi: Q' 'Wmmm:zgmgmmwazgeggwwwmzgggmwxmiszgfa 2? 'iifri 12511: we s:::z:QE?g.2?2:w::::f'::ggzigfsrsrsfag-'gif as mi L' -' ASU will 3: 1 ' A2 E ' if 15 55 Nflffmsfzgrgig yiifiiszwg' fi:-1-252-: :fi LE m 1 , Q5 2:15:22 . ' 3 s i , 2 121,21 SSR? iam' N H :ii D 224, Q22 Q 4 ::- M522 -ww 5- -45. 5. sigh if D .W M W Lum gg 3 iizglii ,U szzgla ig: ,Q X X ww 1 N M gg A2141 if E 2: 21-1'r- W ma 'qfi W wfwzg Q 'aw I , s2g s:.-M .. ,. I M ....,.,. 1. g1.5,.g1 1g:g:1g:5 :. ,i ii-:5.,5 as 5, Egigggsrezzzzvzism :gm Sl' is " .-..-. giwagvvg gizni ,gfgrsimifggwgggwassazmw,M wfasgzf 1 f 15 151: -f: f ---- 1g-1,5:,ag5 m 5:1 -22-1 MaigimgiigxgmwwfgmQiw:'sQ U, . V :gm 5 3 W 1 iZzQQggEg?23Q',v'5,,4f52355523223:xggf5Zj5i?33Zf:QEg,Eaiigiiqwmm in H 553 i f EEgEE."5 XE M5 121 ' 'fx ww'.122?wS2'2'2:'gew'W:1f'2mS2v 221:21 I Q .. W. 5 1, Ewfgs Wh gi M W, 5 Qpmxm, ww zz, , U iss? 25 mg f V W Q' m Q Eg? E W ' ,Q E . Q we mimi? 23,2543 21f:z'wf?g.igE5i2misss55:32if-sf45: f , f W''QH2:Qmisfg'iaizxawiiiiv'fmzlziiiiailf12::::'gEiE21ff"'1me'425Zz2E?i2fSf'2s:fz2gEiGisW .M zg:5:,, ,,. ' M I M:-M '1 Ms? 92221 I 'f"'1i'Qif22'Sa2wsa Vfsiaflvisamxfaffiv' f2lf"2s:sffrf1f1f'S'v22'w zfzszwwwlidwl 3 Lg ., - in 'Wag gwg f. -, , WUM-gggggwmgmipz,,aggmgqm-fyggzz ggggwgmm tz,gw1fmfwm':g:gzgvg,fwf1 Q Q We ' 1 Sw wif " Em 32 my iam , W SS f ' Efgiigg 'Wg' B- ,,x,Z',5,'35S?Ws2 dqgiwpgliidiivg iw, 55555925 W' W 2 X ' 251222 ewssizgi , , Af"'m?f W Mfg 23593 4 2:12:22 I ,, Q? fl W L 7 fff X ' 2, Q2 vzazf , 553252 ' Q 2 25532 5323? ' G wi? was 25:65 mf WL r ,Q X ,,:. . H is sw Q' 5 Q- .... , S2555 iiiw b -' W ,I wig :Pam 5:-E5 iw img .... : E E, f 4' 4 -W W xg wx Q W , g .W s ff- sky' sw ' ,iw .:: .:. ,',, 5? LQ!! ,M wg W' ---. 2 .. 5 is , My W ig 1 Y saw W Q E :gg 11:5 M mi sm? 5 'E 'SH :ww W, f 2 552 ii 3 , 5 5 ...... W, gf " w b ' xv -:-::.5-:e:. -g-: ' WEE WW 5 wg a2z25::'.g::a5: '::'::?5:, ga- --52L 2: '::.':r:, . . QE 3996 was M g:::a.fs:: :.-.-:ga -2-.2--:-::,-:W-: -. -. V ' . ASM fm?-551' A Q -I-:22:E":' 2-'F-: :--:-:.-.Z-' :-,-I-3-5-a.:f5':E-:Z-:Z-.-.,:.,: :. Zg g: M4 :- .:., 15 Q' gfafuf 2 gg :-:: 3 gmm Wm: :Sim 5 ' ygw iwwfw New Q, W we 5 EEEEEEQQEQQQEQW sgggiigggggvgggggagiggggi Y , . my , f i5?,5g?m2w2.5E E5f25S. Kiifzgiiiiii wzizigzwiii E l gEi?E?g2'M osgigwiu Eaflifmggxwkki 3E?i3iSzQf"fwf , 2912 7 X i -. Z 253 ik WQQQQELNZPERF, -':.:g5::.::.-,: ?WKWgt5g'2 gwfwgeawipw 55 5 -gz,-:: gZ5Q5v2p,gi3252 lim giewgzqzsviizg Egan igggasiw w2sEgsS'f'q5M,gMV, mi? ,ff a Q Swv ,,, --1:-5-5 q Mmmg H Sig? Mi W2 www NW -views wlsyzgggmfngghissa w'mw.,s1y, z,,51a'-'fav Mig Rpm 5,-. ii?:fsggf"'2gw,, ' ' Q' nw f gpg? , 2525, gmqmwggiisa awggzh 52555:Mww-awwPiiizazggwfwwifwmawwgissscq: gg,aQ2gf22m1:Qg:gyw, ' wwe V .srg::fg:::.-::,,.-2: 3' f wa ga :. gzzg w ka F2 M, wig , gag Q',mszziwmgsiizzszwmga:::':::swsQwi'mfv gwwmsigmmggwgvfiiswzw , 153543 f H ..,.. : .-.- : 5 --.-. WH A W sw. :.::-::,-:.e: Q .- Mi W :Y ,w w Q Wmiiiwwwifaw-ffwasme WMM mimiim ,3zigEz4w:,xwQ smfsmziw Mwiiizfwwwv. iw w iggv Q, .-.- Q agzmgzwm M2 wi ,fssggmQMgwvwxffmvgwisgwwwpwiWmwmgswv mm:wwwsawiggggwym wszwmw M W ,, , ww -. a: -g-:: M ymggexgg S9525 Q -:-r: :-p::.::..:f-.:.-::. ,Mag mgwm , ggwgw mli5.'51zggwwmE2ni,ggwMxz's,vsg,eg,eQiH'fszzmwiWwwgw swim,Mzwnzsggkfwgsligawgwsigv SbS,m,3gg.s'ifgEg55',isg,2fg'gg:s,v,k A , E, wg, wif-fm mf, wig 1:-fr .- gm:-g: :: g:-2: 11, gm azzwgissmgwagmw mwmgg 232519322533212:zzimaszgszgxzgaazmsmgfgg wggzgzwggfwqgsgfyfazmgimiizmpymn, I 4 13015 22 1 A g mg ww ww-ggfgaig ls wie?lzmgygsmazgggeikwiaizR265.22232maui,mmf1Qsgsmgmmzzzzezzgamiiiw 26.2222235msmgiz.mgggaggzsfigf-2313:WMF,M Eiga 5aigf2:2'2:2Is! Sf Q2 'Pl-M-.iii sw w :- '2.,a:,'5:'- mgggm SHQSSMQQQSXSZ- -' w m'fvsJiyEggpf221g-fmaa QQEEQSSZEQE mgfgmegymwasQMSViigagzzzgslgwmewwmgvmgmmmD.wzrf,,'wW wms,"Eggi,4Qgiisgssgggamd My 2525532333 f ME' DW Sami ww gwwwfww siiisizzffigwg Jazwwgifa ii mf4vgwiggwigsBiagssfgqggzwwwg EMZaizxgwwiinWz5gggg'1vm'45wweA' 2,,,.,wgwQ?sww gsm, swag?-gen, , ':s.fsg,:f..w 24 2 www gg? is 54 Ewgigiiggfixfiliamigmigigggigggggggigzmpg p1mgeaQ.sX?4ii2,'gw5EhE4wmsi1 Qggsmgm Wgifwgsgimfagskissii55:2:Eggfggmgsavazfzzfgzwwm1S22:"fs::f,Q'ggfwg,1a:1gggggm2Pe22Q:s:zmgg5 QW vaisfssgggmw, -:j ig 5 sf gf?35g2g,,fff Q33 Q - :gg-Hg.: sxwyw, age dw ,135-Mfg'w,??3f'S5ifH:g:ggwwmzz2sf Sigma wa fgwgjiiffaiiiimzzgggzzwfMimi1Wm,mgQgwwgmWzlzggsgx55255241DWRwfgggggggfw,,igggggggpgfailw wmggwgggwm. aww aigggsa M .W V mae e Eg we Wx :gg gigwmmsfmiigiw Q ,gs gap wgygwwgzsgm Wmwfsfgg 31 wgmmzm in,AWlszssiasisgzzzsgwwme wazzszfnegwfiwi wgsgmasf,zwaszsszimgmsqzfgsmw,aegffggigig gggaaggg m,x.?iMw,WW,.V ffvsw, 6,58 ,,,,21Mw'3i,?iQ, mgq:EZg?"2 giggggggg? aaqswggmwgfa 1 W hgG3g3Eggz,agZ wwzfzrg 523355 msxzfzzzmgzzgiQgggwwgfnfwwglswi 1,gzgwwimwb22me,,fQ:EmwmEsz2a:,1gwMW Mshzgggfdfwgwmfmeemgg1 gms? :gg wztiwzgwwxw- M, giiwgsgmaswg gQ5m+,,1f-gfM.,,gs ,I ww s,g52,,,zQ22,g.w egg Wgzfzw mwfzmwrizsze w'saS:f,v'WfW Wmsszzzmsfzvzggwa1361wmiiwzaizmsebwsgauifgimgg,sms: awwqxfaszmefihmg f::z.,:z,:,n'9ff'ggwfaQ5we-figs wwg wwmzl.Sws2wQiS,qas:gf'm,WM .-.- z W Qifwgggsemfg amz ,gwmifiy 'lsfmfig wx wikiwgggfms Nm zgisszizisizgzgwhwszgwwawfiiiizzzasigzmwwm-gzxaw ,igmsgHimmwm:,,m,g:,, mamsazaamgggfgggimsazgzQgiamawSsmaesg,hgzgggiwiyizizmsmw QvsaggwgggggmwggggggwfqwWM fs gfzggvsgigg W WEgf2E,i:z'ww.,fsg Egiwfiwiiiii 2:-ss:agwgfszzzaggfigzgwfi?imzmgifzezeiiflgsaszmwgfmimgssssgizimfzszeggg fgfgkiiii22:212e:':::siEm12im:'az:m1:sM1322asQ2isa111313322rrSasiws522+1lifnfzggzifwimzgelivfwwi2m"ggg2i'55?222f:Sz21 QM ga ggvggwgggzgggigixggix,giggaizegagg-5 gigs wg?SQwggiwwmiiszizsazgggggiez55,322yzzszagfiiaiiiigzeggmfavizgggwgffriaigiikgizazzg 45mg-M252s::'f:gsg-wmafisamm1535544.in243:QQMysgii2meggggaif:nzQ5gwf:23Qg12mfzigg,samzezgmh 'K gig ,. ggi? ,gk giigmggigigggmggggggggqm 5385 553355 Egg 23319ggmww-mszzwiiffizzsHfwgiiiifliik gfwgggfgmmipi:42:iMzz,ggegg'g. ,iwsalEZSS3SZ1FE4EgggQivfSi?'aifiiiiiifcgvbgfswvigaiiiif ww?H2QM?22:gg9SSQ1'Qaf:2ig-ggQffHiigsfwmxagwmgggiisarxffsmig 3 .: .... : ..., , .. ..,.,. wg 5 W w Q, S H Q, gvmw i aw my gsimswzgggxmmazagmagzg gm'-M-M3.imanypanM-wwfM.W1.i.Qz:wrwwQ-,'g.a,..-ww:gflfglf-M,4.55.2532'gh-w2f?,s5.:.wwwmff,gg--m"sfm.v+wqX-wkQW,:dfsgiawawasmaag: ?:- 5. .... 3233M5315fgwigikpzsiggiliiwifswgagfig :- aw? wmiimgg gf W Nglmgmqwggdwmawzgsewmmwn x,,t,'JfsfzwmmmMm.,W,mEjggw'fgm wM?sm's5,ff,, ffQM2mmaWg,,wwmn..-.b:?Q ww 1 wvgwmih, vmgsms? Z aww mm-ww,,,,,,E .. ,...,. , .:,:.g:,. QE SQ- - --.- - Q ,awww fg2gg,ggwwe-Je isfsfw 25 Qg h igwgwwyw W MyQimiv,1Q.L,33gwSmaygsWwgggmgfgymqJ!S1m.g,smgggrgggggggggwmfmvgi,,'3gS,sfggmgff gmqwefhiszzigsggggwaM1QFSSSQQQQPPQQQQQQEESzgiqif-Eiigaggswemiiigywmiafw 22f?gma2:Q2fs2i3Q:-mszws mwmfsswwg ia We gssmiamgazzgsswiiwwisgwglzgzf - H2WSmgiimshifvxiiwsiizziwz'MQ21wm2'9S2m m':m22S22W:a:s5'fP ww'HQ'gM522zi2z:2z':'i"fw3Mwwkzzzfsalfa-'ffmwyS2s'az',:"ww A2H2Nzzwwiwzbzmwszm'gmw wiggffiiiiiisiwiidifggg 'AMM5 W ...., 64,32 ami ,,w,m,mgw,.,g,a ffm N 5 ws mmimm EEm,fMPL5,P'Hg'9f1Ms:E, z'5,asg,gw'5W,sQ53bwwgifgsmziaiizigpwg wfwfxmiwagi Xifhwgvgg vgiwwwwiizfsiiwwgww smihwmwe-rswzifwfwiwiwwfiwiwi, qw ws- Hfewgigvwwaziwiiwiessks "W QESESEQWQEQQSQ fffiaaggffy wwiiv. WSH iiggfwgfgwwfgzi wwwmixiysgzzgwiw22553232152 Yi 'sf"Wgww wiiaitezgzezwf' wwiapimfgwiifi gssvswmwgsgbgfiwisz wggmmmxgwwskmgmfzgwaiw Gifgwgmzw msmsgshswwsggai 'L 'f22Umig,fg gm S W iwgfi' dam,-235,525 ,,:2P9:gmw15vgFqfiQM'S'5?Q3ai:f ,hiximrgggwg wg: Zwswggwgw' wgifiyfi zwzzzgwssgzgv Qvviwiyihliifiiigggw3135252352 3Wgzefgmf.,s5Mwggw'22fgq3'fg,gga QQRQQQEJQ' H Mmm gm my.2wwwmmmsmmfzwwi,m"f:'mzQmmzz:fi,wwms22:,faw 'feiwwwfsifmesziihzwf f Wim' mwiamg: gfzfzzmzM22mwggzzwwmiawmsg, wwmwz' Q wiwsmmawwggpwgiw wgwwiwmf ,Am eswgvgzgggggffmgwmwmm..u..,.u:.z..z::gQ,.wgzzzzwfmswsaiszazfflgfQWig,is:z:3gsw?3'gw1f1- A NewawwmfWfgssemmagmwzsw W. wmvfamsmgamwxizgg sesazxiwzwfgi M,-5,5 ,v www ,H ,, H Q' sv W .0 nw , ' ,uv W , QM ww W ,iw 'hw we. ami Jr: W ww w Qi gym www? gugiivmwmimfvmfsmp,4gbXwaQQ.3Hw3,,M.gg5lgv. am wswgfws Qiww W pin azwmiffif N '-'ww25124.rzsmszuwiigiiwiiaxif'iii'Simiv-Awami-Gmaezwllm.i3.:a,v,m3wi21g..?x.zwa:mz,ywww-mmf:za'gm-mm::1g'31'w--wi.: QWEQQ Swap'Mmggbggwgimwwiii yQ.1,wmsaszsmgitezzszssgwwiiisifmw gimszs- z5anisQQ1QfMS.zzxzsgzwaigwwwiviuiwizszfzmwm-nssgrgfmsfhmgmazz.gggwQ2mgQ.zmmggQSmywmmgiggzgazggssaf "' 11HweNiiiiiimizagigsairelgwpig giarsifzszsziggwSSZRGSSEQQZQQQH imizaisiiiifilgzswmiiiiiiizmgJsgiisisfgkwZimiizgwiimz. gf'eggas59ggQgaggmxzgsggggqswegdgazwg 'wWm:gg1g,Qg3W Q, wwwwasgs:5:35ggi-1Mfan1252:zz:myggm'ff'w,mizz:5mgfflyrss:z,gmQ22:mqgw521Eiaz::zs,Embgf'iam semsgmagaszaemsggig fZB,53E253iP53QgE5?'5'iQEiMa5Q1'm55i52'E22fiWtzi?iE3g?zwgfgfzaEEKZSQSESSESY2?if-1g?iZi35zi:5W5Q33i2SZ?S:5wf?g5'a.25323??5S2'SP'?2S233-545523 yigiliiuimiiyiiaw 'ff af'M1s:'Ez ,Q agislowsadssgiwwizzaefzwkl,122':'::sgF2S?iS'wmws3H ,gvgxagaiipfizffbiwig mi-YS ' NSW Q J. ' Y 'Wisaa:12QXQ1z13:23'ggMA2222avEEE?iiwxisgggiiiiiwswizmw M ?ES3ii:i2'S3QLZLh-Q3'aQ-.N-fn., 7-5-Qziiaifz .I an f I21111122?zz223f2Sgggg::za--fleasIIIIZM- .- -, . ,. 2512? :mf 1 ii aw IQQ.-i affwg-,w.----.w , 3335... 351211 .fat-.QfT2bQ3VM,,,Z.y,-I g,Ev3331,,g5I55', -A ,.,wl0.,1,'v.-435550,,,,5953355,52,5gQW,.,,-gig,lf -Ij3h,,Qgs:w3gmQg5-I,, WWE W - , M - -. -III-w,igg2':gW:mQfggW--II'1':2l2wg,:--fish 1, age., .. I ,gqfzmvzzzifmmipfI fu.kgzfsmfwzfzswwggwwzgfz..-If-pw 1simM-mm2g:1:,:sW0imMWM.,,. , V -www H if,fgrgiaW-443592351-wgrfrifbarg.:-affffziwQ24-.f,-.guyI JSIInegpzxzxfifawpgggatzfgfn. 'X M ,Ifsiwmiifw:ys1iw?i2'iIww Wiwifilfzlaiwwgzfaixflismi'-iii Saw2mg:1Iz'a1fIw:a--MII--M W. W.. X . A 1, , Q 1 W A 1 M - N I. H ff ,W U M . A ,W . X, ,W ,WW Lizzy-'KII lg: ' wwf. r N-1--13:23:24-2i3zgiQIIfA I -4mx-lif3i2EgfyiE:g5sIg3zLi1AIIII:2e -2zgziw:-:gi2gi-YIMgffi22,':I2-1iY1W?5gi1Mraw WIM-7UfI..I-f..-M..-,-Xfmfmw SJI xhtziwmifb-1931,--vw S: I Mi? fx UW'2Qw-Mfl v'g,ifv'-1fWQQ?f1YwM mv M fwmm mv -Pi..ww,,1ii--I -wggsgw Lzgm' fp .1-wzgiwwl aww:-, wgggh -Q wifi-Q E-M-35134. I fgqgggwv- x ,, lj-Efggzgzi WN qggqiggigzma-343 51.5,-xg! -mm ,Q-zmm,,iI,ggeL,.2:'Zg V -:III-, i1 it-Qziiriw -Inf,-,212-H - gggiw I f giitk-f1fg1zg,',-wyzfg'7 '52-5 7 .fiiflwzus-lwgmi :4-1i?'h2e- , - - IggiA--5133151-II32335.'Lwgez,.,mwg?Eigkiggllw3,,xAwg,g,gqmfgg gin. an gi, aw2ifa-g'-g,gg5,z-5g:w1za4:E-1y:.?Z- -IWI,I,gzff:'Ww1f:z'11:fM1-I 11 11:5Mfalwvgiawifizifimfill-Ing.-Q. ps,-zzzaza-Ibati?linyggzgfavlwjzqzalwza -Ifvzgi-egwifqf-1223-22, vtleilwiwg, ff-ww . IP-Q-SI iw-xmmil'b1SIw:W5Tw'71m . M:"?3w1iLI21:m4gawk-IIwzizla M-wwftzipis wf'::3?wIIgwg11f: Nga.Iffzztlm--lpyggfgftiaIf-zg-' " Xffuwggiwffjs Wv5,...mfg.atwf ii -,-mfflwgziihw-Uv.1En-1-1525 WFS ffzzlw,f'?v-ji2.w+1f2,Qiwff:f-iw fiiflmy , ssfmizfmszzaqzmQMzzwigszaffiiswfiwagfizsf1:,:.:II-gig. ww. mea-11111212512-1-M5223-XmwamwIg, ,ww -QIIggMgIfgzA2-1.5.12---Iwaf-In-ISIaaa,.D-,M.Mp1.,1e1:w-I-Iggzzxs-2-I-wana--fewsvia z'mIf2zISIE,:21-ws::sw-wus,Wrmazzrie ww - . Wmfff. WIL1-IMz.:, QM my -as www L.:-I Li: I-I-4 I IIQLH,--A-1-ffm: mf ,W ,I-Qs.I'-.zmzgmfasiwgw W-w:f,.g,,i 2- ,W ,-..f,.,w--M.wzzmwgzgwgmlzw fgfizqmww- gsm we-:I 24 timwlxingiwfmf-zwlslwgafzfz1fvggg'ta'3QIwgizif--WaQs.wy,,gQ:1w?'m4m-vwfwia-II-,Enix Q-I6Qfiziwwf-fff+f3iy'J,fLliII www ?'?H::1?2m1 vw 'i-wiZ'Ew:,f9 22111 amz-is-wwf 3? may W x mb- ww" WNW 1I'IMw:?.Szwsg:,:i wggiwwgzmwiiwi Zwf.TY,,w13'w1PEif2iPL wffgiiitzi21Zfw'2fa'Z,wS-Aw255-s-q-ixmgzw mfgmf. Qiffqiiwwfg-11 vm' H Iww.mwwifi-wzWwg'2wN'vmm .vXgiS?.wifi-Sspwgvffgiaa-famwfgl-wig, 5-,Mig-9,4ggffe-+'5,,Mw-W,,Qgf?1,g5 ww mwg, i,,5.,hm gi ,wi 'lb3W?w5?X':?i135Sfifwgii i5342a?5zMB5w-Wifw wfgaiwf iwfwwi Wfgagzsqka ,WI Q -,M -M ,.Ww,.w1g,gwM My ,M W-wffvyggm L ,fm ,W V,,,Me1g,,,-.wgq mx 1? I '4' Miffl- fig 12. 52,1 M Q .M I ,gwgi Q .wffpizigg Em 335255362 as ff Q is wg: ff , gf?-sg. xr ,. ,, 2135251 'iz , , 1 mm EM ,, 1' A3219 -I sw I1 -www? li W mx. -- 5 125 235-sz MM V IJ-215122 H 42, iiwhtt Sim vzwwip-3 ffm- .W , 4 ezeiivflkxaf 3341552 if HF - Si .. wh -61.114145 iii? -wg 'l"" 1' 5321? WEEE: Eklwiifzi aarsiv Fw' ,Q 'Q-.wr api- U iw sw si mwgig 52313 gf :glam xg ,igiiif Y ii' X iz- I -Mg ,W SQHEKEQS ,mfr 2122: 1-33 Ei. 323355225 f L ffE'55,i:'xibi Q .iw Sig:5.i'gf5gg , . - , Qiiiiavig , I- .1 1 Q, ,, , ,,-,wvrggm 1 ' H33 wk. ,gm-53,-IX 1 ,ram , -gm . , I .1 I I I, , iam ww- WU. - V an aww? .- fn ,I I .fr W aww BMW 'fwiWgMw', I, k T- ' MM M ,vfv I ,IL QE--I' W' 2Si'?3izih-fwfski Wi-xifv f'z2:2m,mm-I,,,.--M -I 4, ibm I -airs 2 W x fps , gzgiiilgmzzw -3- A X Q writggi-3gz,z'5fgmz,s::21iggggggiieggy,E. g:i51i:Z1igigsgggfQ2,'2'gQp3,gg,gguiy-Igzm,-Q.LI , . iw? -me zitgsgng Saws-y.tYz-w 1 Q11 ' f-:g2L2iLQgA:f',G?5QHitif,-5221-1-fm? mein :1:BwfMg2zm.Ii-wg if f wzfu 15231whimIwgtiamwwggti-hwwfiiaw2:1 -fzif11gfgf:,:f:'S1I21miaSssa-ImfrggwIM .- . wail " " - I , Hfafvix II:::.f:z1:'--.ai-I Iv , 55,13 ig "QI-..-A'imeEsfme11:2Eisgazwsgiggasmimz::iw 1 IQ I 15323525 , N - II 1 -- f- , f..,.,i15gg-,g.fAw:q:.s,,Q-A-.I,Q-I .wax W K vampQgg,gg-2wfg-fX:::-,fam EmiIIwggzflwmmi-wefirf-Uwwt 1I-lammamzgvw'Lexi-wfi':R I vizi'lM1Pa'Swwszwgwgvgzzowsg-XYwgQ:?aim:J,WI1:,QatmS'2Ifw b"6s1gE'SfM 'wziisw ,mm .W 1- , -, V MM- W- N, v M. A M mm ,,--.M NWI . .Ui ,ww .W.1gp,,,3,-If .MII-. WIN W was iam M1 aww-I ,, 0 A ,mf ww,-3 ww Q S1 V ,I 5 , IMWY2-Muzi" Mi-gi-I wmfziiai U E-navWLMg:a5wwgffg'i,Sw5Q:z3 -1Ifz5:..p2:zfT2sw.--fs ijgfygmags-QQIU-me-lgWWfiwfNzgmtssmggggwuwgi-YI' 1. In Na... we ivlwigigggix' 4332552 .- - -- 'ev -7:13,--53,-.M -Psi' IW'i.I--gvzili-Maia I 7- 5-Wi'-STK mgi2:iis:..ge.:i,ZM,4 fffiwgfi-Ei gcxllmy yzwwazsiwiw-vg: :M-15:13. ,gi , Mmg, - w 2 -gg -if gy F wg . W- . ,iv-ff . , ..f:mm5w::v' 'V Nga.---,SQmwgmiiqixi nw? Izzy- -I - 'P Mwgp.-sw I ----.,M-aI,I,,zgs-Wzazmffpfg-:QW-IW,M- . Iran..-Haggis-nwigzgek my znmgigsgm Ima. - -I zfmi-II-is .. -.visaIwfgelzs-M-gg.aa----wzwma Nz.I-ffzsf--Mensa-gwezzz wgfz-2-hw - ,N-X' Q -' . -.r 4 MJ-wb Y uw? ,mwM"1..-ww' If . ,A--wg nwww-L4 iw N9 N I -If '? .-Jaw H -I . ,, .,,,,.N--g,bgS,,R-li ,,,.,.fQ,w,..5I mu..,UV,Mm,w,,L,,,,w,,M,,,,i!,Nqm,,,, is ' ' K .Lain-I-fwfzwwzgfzm-1g,1.z---.gfgiimfiii-fwzrsslwg-ggazww , WI. ,,WXv:,Uw1z,Mw- :c,:,.-wgw31555Mf55,gz,,,Qwwggk,5gS,l,55ggg, ' X' M WW-iffm,m3igi:?S3v5,:1:m-gwawgti n- EBSQ' il :Avg 1 7: I7 gi: Q4 .y 26 254 Rav f I-, ,, K I -QI I, -E gg ,bf A ' -- ' in :il 1. , xx is . Z. gf- ggggrgmj Xp fi, . If V' Q- , I 1. fi 1- I Wu f--Exim I . . .zimxli Q ' ., .vi . .15--Ifg 1 M .. ,.. L, -. V, -if . , - ::' V f "' 5? A .Q , S i' J P . 5 2,4 P af 'A II ks " KV" ,214 WM Tm , - v Q' 7292? 'HE-1 J N . " I+ Zuni' , ,W V' I Tw I . SMH f 7' - i was I - U I imfm, mm 411 1: ,1 Q-K, ,i L - I ' -2552523 I i ' ' g I : 'R N 5' - Hfwlgzii ge. Ke 1 i I J - Nz,-Igfgg UJ , 'iQ55,P'.4 " I- iaizliiib Wh -- I LA . . I ,, -rw 1 - -5 iiiliinf Qgg , ' ' - 'yi 12,3 , I - -I J Q.. Ja: L 'f25i?ii,.zf1g--3 -- ,QI I -, 4 5 .Q-'Wi 1gQl"z my 'kim' 12 ff? -f1Y2?tz1sfYE1?Zq:-- if +I." ' . A K 'ff-.ix 1- Ip.,-If, X- I -- . 331152 ,- .. - A , 4, b N- fw., ., ,, - , - ,lv x,....--.?g,. W W.. -Wg .-I V kb V .5 ,Q I -, , W,-V-2,4 ,, - I3 .-W age f .- M., -M-1 V . . k .pl ,, . , 1:W,,.il5w ,H ' - iw ww-QRI-Ig . -I ww -Iw-.-Lifiis f --ffswhsia 1 I- X . ---'Qin Q, - yrs:--wwf, -Ia. I ,- :I -,e Q.-ties., :wi . .. I ' - K ,fix-1Lgw..n W: 41 'K A " I - .G 65221121 'i A , M Hfifflzzi-xL2f.i ' - fYb2,gf'if'Lizi1L gel? .. ff --Qi-lg U fri W 'W ' I:'15fEI2-QQYQHQZ-2225-f - I , K A U 'hyfgefix fggiigk-,i . A ,K V N'f2f2f1g:f gQggLgfj,5.,i, 335521: " g ' ' N' v 1 I . nil? Q 1.Na',g321p12g-Q291:31,,,-vigg 2 I -- -ww,4.--5-fg,A.g11g55,:k:.f3b,g' Fig ,, 3.7 at i ,ww ' I 1 Qi" ' ,gh QI 'M X m C!! ix ,.,1,w,, X yy' W Y, S if I k - F W, W 53, 5,3 ' ' ' I I N N ' fziiifim X - I - zzaiziw A ,Z L , , H1219 ' ",.,- Im, M alex '13 ' Rx, S ff: Iw '77 lzfzn 1: 1 F' N ur ' xW I R' . 1 J' Q1 - fi wi- I .3 ef-f - 4 gxs-wrzm I .- X. F ' I , wi'2f'5ImFW' -14" ,HSI 'I VI. - ' , X ' .. - . 1 'W wmfvmfqggm- ,w -,fm .I.,,w.Y3ggW,,, ,,, at K A - -, I . - i mi W4:Ezwr....-.WW-fEfzi1w:L1wIfLaw Ia ,. ef :,xwSQ'1-1M11Zg.EMg:,, A..'4ifzTwL'g2fIQ5,21HS'ffW'imghim,tiffIgigl 5221fswwiszxgwiyyy N I-I wf:1wiIggZMz2mfa14-- ,I-wa:2:5s:.f1M2s2:Iwg:M2121-4-IvIw:4wf2IwWrfz.sz1I- , f 1- 411- ,IzszizizzciigzzvfazziisiiiiflgzsziiggifiI'sEIzg:wg2i:1?I:.:2za-215115513:-fy I I 'I . :L AEI: w:1w:gqIfg:,.,,,A,4:,1W1UwzwM,.',L IWW-wwfz,M-QM-giwuuw vg,:f.W1gy HW. .wg-LDL., 1 'xr-235 M giimwwgvgzwf exp. :gg ,g3wg,sa.11g5gz., N . .W-Iwyjz , ,. M W I iiwwgzlweyiwWy'-':g:IIg,gin.yaf-1-,Wai-f,sg5gUQf04'fvffgfipz-gag61-gzwgyg-imI-ft?-1sSSgzX5,g,z2'E-.iwmgLg:fsfw133LI- 'Kiwimzizilwwgzslziwwii v3v.II1',Ii32w'4iTw Uff,I,ggs12LIw ,z-MTH'M331Zilyi-Iwiffzliizvwwivw 'A I N wzfrizmwmgmvw- M U-W,.W,if:-If'-,v I YI ..:wIHfMf"iz:AP'wWI 212z2w1.,W.4ffzwwwsf.-M,M wmwm9w,,4fmwU :amd 'fa NM?.,m-wg,,W-Ifwom 1.gWMv,,,mggWw5, .a,,m-Iw1:mmwy ..mawgzm?Mww:,.1--Q W, Isx-,mwcfK,,,mwwmmwfw'Y' ei 1--,mea-Iw1:2,141LQ-MLzzxasa,-QW.-1--gl55:-Iswzfwwe1212555213-'SSWwzxizzizmIwazgziwggzrz 1g::gIIgvKaz1:4s1agv!fIgzz-ifzbgg 2.-15322:Qffgiizzi-fvgzgzzggz,-WI,mmmQIf13:izits-10fgmzzwwggggzfswgggzzr 1,ggwwgws,::Q-wgggegipg-Wy5,31 'Z 5:32-Hi 'fIII12,2az:-I,1m:L1Sm5z'2:2,z122t111,MQmfI'LwqfiiQ22M11iwzzzinxiiswwagzzftime15113-3 Iv fzgliegzzkimiiwgfit -ff:-M I,miSezzziawpwz:.g2am4ggzE2iEsQW-gm: I335114i4wgz5:3.mM'1,f4'2z-wgxia:L , , sf-w1ii2kSmgwj5,i1i.afsIwwzgg:,g1.Wgi 7 'LI 5iii1l?I1SZ.l'5Z2Zi5Z'Zi1iZ,T'ii,, g'2i,Ig,,,Ly1J:Wg.,gg33g1gwfg1i,f:f1iQ2:f:x,m " Qfzfzxaswggaqg-4-3211255InL .4-IggwsM34123wgffggzggl-IIazwvzgzzwzw zzwgizgzgziiimgfzxgi-IIgza:1mg:,zHfIggI2I f .,,.-.--www-,n., .n-fam ...gift-4-'anim I u:,,z'mM51,g1,z: 3 U:-A I" :'IIII2aaiQ-Nffzztixwx,f MIIEMM-wfimm.wgifliikima--I:A wg?1W.vw2a5'Q:6Yiwg,.Z,3'M12Z's.f2i1i1-,VS11 wil wniei WI. f:WWwxQgm2:L'izQ- Q-I1 .1 N ww,-IS I 7771-' - : mywIIwx9WwwffII'mvM 2IIm:Aww,-,gzfwgswfmgm-zzz,-dgzza-ffm-Mmezizwwmxxw f lI -:ew 'izffsiwb'-iiif' - F11?fii:z?Zfz'1f211Y4522f7s'I 11212151511 .-V-ewzsirii TfUai11'Er,:ii21II1g. J ' MI ' 'mlffrmmizizii1gmf,qim22z'f2zE 12 'ww .- 'zzzswggisiihmi N?:zslW-gizwz f rf' -X- .273 ' 'L I ' 12 L- : - , 5. , H Y fl-14 ill, S'V22f f-.LQ f' f " 'ii ,A - mm Limffw":III,, I W IIII I ,gu- ' A me xmasIvg:'2zi?mw1ifgg:fi...mII rhiiwwv 1. - -M-w.MmMm1"' W' -I ,ZLQL-lggg VS.. I1 wg w1ws,LI1:gg2z ' L1-I 153- L'fZEzfEsi1221f ffv I4 fix' , Wm may Q.ws,,,5,. gg wwggw H53 gmgewygmzsfm, H.. 9 B his Q, 3.55, u as 9 W VW Wwsww-vw W ,Q M T, ' M my few 12 V -, mama mm gm Q Hg,,,m gm wg V SENT, SGW wswimzm QWeH:z:f:Q:w,wmsm.wQ meme- M ww ssswzwmmwsm was-Qsswfzwszas WWW, , my figfffsszszizzzkszzm5Q2Q2Q55aszzaff2z2zzas5QsWN2N323gi5QP51Q1Q0fy:has2is3Q511Q5gain?22Q2Qii2QQQSwgfggfgzzgiswmgmwy,.W. , 2:6 Wi222256wfwwfazzzsissiiSivawwggzzffssiissieiifwwHAQQEg:mzszzzziszziszzsmszi22:2fsa:smifsswisiswwwizfslffQzssszsmzszimszmssg WWW sfsgiwzsgqwuemwmxgiwz .mama sgswmyziswswwaswwSSSSSSQQSWM,-Nizwwsmmwmowmzsgmammwww, MMWSQSimwsiiwsfsliiiwiwmilms-fmafwfgsew Wfwfiifiamsexsefsgssbiiiswwewv. 1-4 27 Q: Www w ww P-:Sw me was m,mmwaHM0W32'?sEs.w W M M mmm .vwzgmwfsw we mmm ww ww w.wwwwefQw'P5P xmas wwimzswwwmwmsmfsw M Wwww wfvwwk Nasa MW msmimewvwiwiwwfwwwwm W V 'wgwwwwmwfswtilf mf:w:w2Miwiiwwwwvfgwgifki 1 wg as w If ' weMmwwwwmzwwwwwegumwswgggwzwwfwigfg, . .Mb , 1 5 I 3, W Q M5WwFsm0wqns+s1g'ffw w,.5,g,,2 - SA' , Qgwmgyspgaw - - S- , WH--Q, r W, Q 5 we-aw ,mmg 0239 W nge. mfwm wgggwMsu0fQ0QZi3aE85fQai3's2wZwwagM2s1 Els as sm mismscswg mmm vsmsaw Www? Wm L3 Sw2ESQSZSSEQEEQWEWMMSXW as fa wmmwwg W may ,sw wg , , 485 gfizgwmw M H mm Q Q-W, .eg wa, M gy, mqmggmi Qzmimwwawfm 5 m,,,m Siwgwww, as agg,,,,'3.g,-.www P4252 W Qwswmwimwwm Nw Qwssfsgw, mmsm mxwwsm mzbmmf Qwwwww wwe www wiwgfw Kiwi' ,QAM Q5 0wm1.w.mww ,sm wgaigwfmissi mmm sw'Qf'WHAP9MaP?W'-fQzfzwwqispyawsm swwww SQPWTN W Q sm' W-Qsgfkgwgmgwgsss swsl-wwwwmwwwgwmwyfggvwvwn M. gggw fgwSGW0W'fZa9p0Nw.f0wvewssafswN8QZs6 mmm is Mm 'mm wmwsm mx W ww an W wwwmmw was wavwffyw iwdaiiwwmwsm sm .Mm-.wswmmsw we mm.-Mfm as www WM Qwm 51swwwwwwwuewrwwi- zgwwffs -QM ,bg W W ,msgs Vewdmwww-WS-vmawsmsaimiit1 Q23 SWSWQW mn W ww, wwwsm 'fa fwwgwzfmq, vwgwggn, M21mmwmww33wM,2eswm,,wwssimsffsiw.mswwwwmmswfmswfwf ga Ag, -wngwg pmwmmww M by mem mwmmwwwwa www vw ek - W ,M Wm gm wma wwgdww Jw?-flgw 48 gigswws W.m?uswgwgQww:0wwww 5 ,ww 3. H Q5 QW, qw- Eswwwv vw ww egwwmgwiww asp! Awe. A MEM aims.-mswswe sq miwwm saws-ws' swim, ,mam gwamw wg mwmwyfi 'Z mv mmm as we ,ms gm gswmssmsw mm M www wmwww 'QPF Q21 vwwww ws wma www 'MWNMQ WU- mwsfswmesw, A 4wsswwwvawbgaimmgwqwvwgdSw? . wg 4 wiwvwf 182193253 223,-gwifgqgifwfgswf 333 ' Sawwiwgwgggzggs gmvmfwwwh wawemwwq migsia-aseiiqs-.uw Mass: we gwwwfzww m"Q3'1'5gfi2S5-M we .wa woman wmwwswwswwa mmwswm swawwwv Wa? W Wil? AN- Zmmsmws awwQ2QSQsfyeQ2WSfwA3a2agwggg3gw,wwgQsisawwg ga-Qwfgw ww svn WN- ,W v..dmsQe3fw. Sims ww msiamwwwggggggwgg vgggmigwgfgggkgmmmWmwmmmmgmwwmW,W,,N5mwwSMmw0fw0H35511253352fsmmsgwwmwmmMmmegmmawmmwfw-MQwwvagasiziiiwimsgmmmwwwwwgmgv- 'ggiEdfgesixwgwggwgwpmoaw Qww.wfmipfq.,gggwhahymwwiwpsmwwfmew , .wa 4 M 4 0, Weavwgiwmowwd,Wmfwqmgwwwswos-mewwe53,53M,Zw,w,,,,,,3,wQ,,w5wy,sQxgi.1,swboxwwwiwswgv,q2fg,y.,,gQgQ'.,4Nwfgqwwggsamww-WwawMWg:.ws.w5w,mwWwwwwwzvwiwv- P- 3.5 'ww ,,f,l,,,i.,g,,w s,g1w.2wwf92WI 4419- gl ,mf W spew www wnvvzfzmawwwgwww ,MQWWgvgfswwwvwwswwgwf, eEff5S252f'i55.wzw N ligne Q wggkm pgwwgvqangea wwmww mm.-1 wh M30 fr Q gk mgwwmsww sw evgw H S 2 we v ' ,awww ww Q www . M mme-M wwfmww aww Q ww? ww w-www' Q W My ww? wf-4 ,P lf , , -iw ws ,f QM Q wewww W, RW -4 Sa, f .Eva-ggwwzw as wwwwww off' www SW A P, N :ww 0' W wa 5 Q wk 0 M 0 eww im' 01 V H Q -fa W 'Q Q, vm ,W S r ,, -A 1, wwf 2, 4 M,-.M www mwwww -Q MMM yaewgewsnmqwwswgspaeqq Q' W ew Kg .8 Mm-m,wwQ.Wwwwwwiw- uf" Q S mwwmwwmww-4 wg 4 f H WWQM' www Aww lv WMMSM we-me M W,-mm ,S Woagwokgg Waavawtwgawgag .W as Eg F353-Wmgwgfw gagmmo M pgs mm mam ww 5 ,S WN Qflmwmi mf,-. ,Q-.gwowwwgw 5, mwwwwiwwdb, K3 .g W whiny ,M sw, :H 5 mW,1W,W,3,W,f W MM M .bww Qgwgw ,A mgqwspwmdagese Nm, awww-.W was wwggwmwwgwwd.wQfwwsmf.,w,8 49,338 ,ww ,,-W, f wg-fbigww wg WMggMg,,QwgQw5 wfwfisnfa-w,,m Ezwqf Wa, Q52 25319 313323361 wwawww Www, ww mm W W ww PM P-Mr' gf miwmef' M NH' W' JWPQWZP M viwflslfefefff, W Mgfm ww wwwwwmww wa wfwl-W' W Nwmfwmww mmwmm ,PM Qwwmsm mam ww wewmwuamekig -wg wwgsmgv gmfg ,Wm 5 W , Y. M ,W ,W is wg Q. ., . 6. g , 5, .Q M Q Q vw ww N wmmggfw WB 4,w,,,,,M w ,W Q Www W y ma.,-.g, w.,mMw.Wwf., my ww so Wm may www-.ewe1S?, ,, ,Q QQ 0 Www Q 8 Mwmwm mwwm My fm, ,, ,N wwmgvm wmswmewga -W V -, w ,4M,,,,,5gw mwwswgw, 'Jw mm sa. W' f g5N,w,g3gs0fg3,g,,imv,g58,wagagmeggggwm,wwwgms,mamQmmw.Q.f.mwmgazg lwzimwwwmwmfmwQi, weSgwmmmpwQMWwwwmmnmmwpwawsw,wwwswmmwwwmwmmmgwwza ,,m1saswMa.W.wQf:wwQ mmm, QQ lwwgwwwwm mgggflw wmwww 5, ,W 2 D' ,Sw , 41,,. fe- Q v aw, ,, sa,-la , Q was wwwmmwwmmmwomnw sf WQ,wwwsmwwmowmwwwsf, awww. ,,,,wwsguwewmewwwQmwgawmsewasaewfewff,,P-W -Qi-w,f.W5 NwemmgmwgmwwzwsswsahMm-4W - ' mwwwzwaf mam W. xgd 49, Ps-wwwwsilwg M WW f M 'Wifi ywfwswfgvigfm meaveixwihgqwg mpww., Wm we mwawfmw www ,mmm Wm W-.wxiwg EMM .fm-.www W wawzwwww wa? w wa af M HMowmymxwwwmwawww :Q mmwz as Wwwmiw,-as sw, wimcw swwgm ws W ww wwf Pfam M W- Mem wwfwwwww gg ,wgww www g :awww W' gwinwf leeway fqggmzwsw vwgggswnfm-wa02z0P1Mf21fwfwz2vw wwvwmwse ww pg 03.5 wewsq gsqwwzsparfozvigeger Qswwn is Mm ww? Www? W PFPMM2 XPQMQFMWQHQ wgwm-W1 me swwm we-M ws QWWWSM-.Q wwwwv Q4 8g,,,5,,,,1gx, ,E gmswm M,m5,,,,w,5M iqgggggkybg zgwwwqeei gwfgmmg wg awww. fekgwmawaswfi 355,11 awagsmgwlwweff , Mm-Sw www ,Dm wwww gs www wwwqmm wneswemssaze wwiwwauwmzwwwwW- ,QQQ ,Q mwwa wzwwzwwwvw www W W ifwwsslwwew swpwm M ssfm www wma we wmwwsaw 2-Swmsswaze mv emma ww,-.Q emmfowwzawem we wvwfafwfvff-W WwwQ:wdwS2H'2W'f555550 :WH WM-Jwe-sq ymwwm worwwf J'f3-335g,'gg,gm0Eiww bgmmwwmm-ww was me ww-vm N, MW swmwwg-5,91 wwmmwmggm, .49 W wmsfmf, my ow was ww Qfwwzawv ww mm MWWQ.-.swqnmwwm mmm-.Wm weww 1 giwwg was we W W aw-zmwnsm sm M mf www mmwgwr Wi- , wmwwwelseh, Pwwzw wsmwamwg PG hgwswgmgww ,S ww 4 ,WW .ggqw12Pww,,M.,,g0.gNfwss vszws as mwwwsiobwmsmwav simslw sd swwwewgmz me wwe- ,wg .23 gmmvmzso so me wsjvww W2?PWivW9W3' Q? iweveaii as we www swim sd qmsbsdwsm-sxfwswz we-.Q-vel fiawwwaw.-zfsww we wamiwwpegwwm-wa awe mawwsf M we are 213 mm Sfbwwiw ,gi '.,3.se-1,sz.vsa2SMiQfg2Wb3W W0 galbwwmvwswieiwcm? W' 'imglsddvi wigwvammgwwba aW,,,,wwwwmQ.g we www W mmmwaw ,mm www wwwowggzgg ,Www-M ww W we ww www saws sw-fwwmg ww mam mmswm 9' mx awww mf Q-.ww Wig ww Wim swwwmwswswz W gm M as we-.mmwmm www -,P-W Wwmpw W ,ww vw wwmm, S2 www W, QQ Q ag E 1 gwowwgm, Q wwmmwgwmmwm in 51 QW: s mmgwgymowf W QQ gbkzw Q, 'Mm ww Q wwf sew we W? vw www was P we mwxbwzww s ' was 2 wa' ww. wa 'www 04 'F its :ws-M me W, mfwzzz b My K' we M-Iwwwsw p Q Hzzsdewsaflsiwwsisgg W M1 ww MW lgsfgw wmmsq 'mzfgafw 4 'SSX - fm, 453mg..z,,,,,QgQ,M .wgw aims, Q 4ggg,V,g,3-lgfgggv w""0'sm Wwsaaiwswmw 1, wg-W Q, 'musesmwwf.mMmmgmwswswmomeml' S3 iam, W 2 Q, Q2 Y ' , by P, 5, 2 wwwwwm WsivsmximWiwzzwzm , Q5 S' A ' fn Q W wfmsmmmw Q: 4s56wsw.,w ww, ww ss sz '3W1W"?' W Q W grgww , Q, 'gm Q mm :N 4, 3 ,vgse 4 Q, .JM ., My gm. Q0 ,Mm M ,L,,,,W,m, ,Wm iw, www A ,,,,Q5W, M W M wawwowsww QQ mmm, ,- ,1 -2 ,gb .wwwmmwm M is we my 1, Wm! W mama,-W,-..,swwNoun 'M' - 'Q "Wim 'W M 'QPR 2 W -W ws nm maww Q- M N mwgwv was we www wwwaww 12 wwwwg N,,1g,gN.w www, 5 Q, Q., me wma y.gmm00ma.wwmvP0 W '20 Q is Y www PM X M ww was -1 , W , M-44, ,,,,.,W 4, 5, , ,, ,, ,, 0 Aw QQ H 0 51-ww awww www .wwmwswwwf Q M ww aww D' , -W, M3 ' ,Q-'gy sl? P 0 WM P8190 H Wiliam si aww W if W? W- Q - -was if 5 we ww, -W mfg an wwmmmfw 'W Aww wa svwvw gg wswPf5?wz.wa.was1 wel M2 Sfwfw-few? N QffwwwWvMw2wa:ww??s mm M pwwaqowswliv sw Wfgg1fejgw,59,,2,ggi,4,.,Sggg,4?3Q?Pffgfwfwmaggewm ww is wwe sw mm , fwwief 2353 fam pi we Saoiiiifiiiiwwsiwiwz :gg fggww' Www wvwfwvw wwf wwlevww Wish www wzvibwfsww we ww ,swaigiggwsaw wwwgwaw is 5Wf,f:S:,mpwfPfemsmzizzwzi02215222222z2zzzeszszmmzssmwfgof zzzezszzizzzzgzszwasm144Mffgmmzzgfzasafrgizzs22H2zzfszzwfzwsiflwwzz2 x MHMwszfiwwwMawfmQSQB4amsmzazzzzzzfszfzfwmzwwwzfwzfzszsmwwzfwziw sam wwzgwxwmmmsvw ww ygggsdgueifggg1ggggwwgmwiwgwwQHWQQESQ30paWggggggggggggggshzaiwgiffWSWS?gwwmyg35ggbWWQMW,W0m,mm2,0f5Mz msswswixzm Mmfmwf 3efefQMbWQ9EQQ2QQ'S:Q5iwZ?wffff:2:2fsiz:gzigwsiszaimisiiimsssfsiiisiawigiwfi me5WCS?83,80H53ZSQ2QSS3SiSSE5ZiiiiwiiiiigsmziffzzszgskmMsmwwfzgazz:i22Z,SziZe5M2a-miefimiimrmgsiiiizziiziifZZiiviifzfiwgggzgggwzewgggggfgwgigfyggf Q' ?M22113assmgzszfgsfsmzsZzwmfmwgggeiffszwemgsfitwgggggwfzamiwigzfgzzi ,mfmgmp Q, Wm gsedbyggagdggg ,Wmms ymgwwwwggaggag sgzgqgme-.Q wwwww gwwwe-awww was we eww QQ mmsgfsww mwsfiisafszz gm MQQQZQS 011 050 SE wmmzmmsvmmm awww miie wwmtwwwii W iw 'HW SM Qiiiffm-mfk 4 me gpm We fm Wm W Wm,,,, mmmw-mm WW W W wg, gg, ,g,,,,,,,,m,Mm M mmqwww aw lwmwmmm M .W gg w W W wwwbs mfmezwzb www mm 0' ,eww W2 wwf Q vmwvwfi www ami M2 'NIMH Hfwwww w www 'QE Qmwmmawwfmwsm Qwwwfggggfgff g,Qgm,,,mw wg W ww swwwwpwg Wmmwww W W S Ms' 21,-m,wg,m, gan 1w'wswsn we ' Mm? mf' - -aww wif ,ss 'H www 'ilkazwfs www: iiiiiagassfzzzszimiwSwogewgzfgszfsszaszzgszzzazsmWMM zsazzzzzfsszwmwi Swwmfmmflwivww mem W Mimi ' My yvgwgwwzww Q. as, 132 sim, ,Qwaissiwwwadswawomovwv fkibiiiiiigwf - was gsmgwww, Q so Sin ii'Z3QfZN,fa PM we w www? ww lfww,-.Q Wm A w, M 3,3-MZ Jw? LM 0275 ' " iw ff ' - V 5 QS '43353isasawwg3'3SSMvgmwggepofqwim-aww?WWSEZZQSSMEMaww fswwwMiwawwmswmswfmgk,155EZZPQZPQZEW2wfPHWf1'P'S""1YSWWWSifsfsiifiixgwislsaim2 ww M ff 6 diggs'4ifs.s3.5S2f'5:2f92v3pwz4?wg36f592g507g6"'5i,E2232523253520'533W5eamez'wsZgiifgigiggfsgifg-'W1FM'i2gQg??gw' wwsmaqswagaiismqisxiswizaiisiiiiiiiaiifisiiiiiigimawwiwigwsgggfrwf lim? za f 0 Sf 0 ggi? P? WW' Z K-9 hawaii Swgvpfsggffggig X i?fpz?w?2m-ww ffezmwiwifii ws-vw A ibm gc X125 2 5 W 't 0 A fs Wi P 3516655 M HW MW? WW? HW? ,W 'ip W V Y Q W3 m?"wi33LE.i?e sw 955055 W W W? ZW aim wimpy ymgmm Q, wg Q, W mm S N .. 4,.,w,3,W,M M .inwd , .. 4 .wwe 1 wg. Wmmwwwf?mpwwmmwwwfaww ww ,Z W, .mm ,mms if 9, W, ,mwwwqli m,,,g,g,m,,ggg,,q,w0Wwimg Nxggggqgmi ms M iw sm ,M ,fs as A E ww A ww 1mwwmmWQMmm-.Wwfwwawfwfswgk f,g,1,q9, ,r Q, lf we w ggwww M pwgygwms MwwmpW,AN,Wg,,-.Q gyms: gsmm, w5.gg,4,ww,,w,,3,3g,,,, , ,sh , Qvwzw -Q, A ' .16 ,Q swf was wwma Wag mm www WM wfwwz we wwf M54 4-fm 24 2 W Q ,Q W 4 f oy wwwawzowgf 3g9gN,,bW,w-.Q mf .MQ sfw1g,5g,fgig,g5w, ,,m,,,,.,.m,,55,g5,.,,,3,Q,5g'2,5,,315,21-MwsQsmawww,wpWowMmmyfwwwwaqnwvwawsmpyswgwsgggwwwfggggfgg ggfmgw 5, f , ,A- Mmwggwggsgfzwmgwwffwsfwmgfg:wM,mf 21 wiv :wgwwiw-awmw.2.85vmeglmiwWW02wewwwwww2:Iwww11Www1'2Wmgagzmiimiziaagmg4 .msgs ,.-w w wsffgasfmswwswsoff asssazzszssszsmmwwwX4 wgswwmffzfwwwamiwwzsffzzz ,y wgwmw .,im,4 2 ggwffgz sf,f,,w,,w,m, g, ww 4fwws,zw,W.Ssi:4imzf: 2 was ga Jian QW 51,52 f ff 1 aww Www mowwwvwsww www, wfzazzzxzzszzww mfzmgzzw V 1 4, wg? 2 hi Nsswsmegp ,wwwwof-1-W ' gwswwg-mms 2 ww Q6 Wg, 6, N .M 1 ,N wswfwrfzw WV W mwwnm W M gmwwvwwwgw lm- ww 0.2,-JW Wfiwmwmw Mm M aw M mag, ww, -wmmwmmWW.-wwww , w3m,m , 3, V, ,, a , . wwf Mm.mwwm 9 Mm. V W W N. W mwmfww-W ww M4 534 4 wmmmmm www 'f ' if sw, gegwgw m,,M,,Wwmmwmwm , , , . ,ww - ,f F N Qs 1, ww w,swWmm f , M , lm .1 ,ww ig :1 'mwwwefmw ww-wg, Wm w W- Q,-5 1 f,,.:m 9 - qw , bsgwggbwwwwm wpwmw giwggggfmo1ifggbgggigwipaiiglgwvwgz, .es awww nwww .Q W we if 5,05 Q, Q Mm X' My f. fy H fry!-1QVMZRQBZSWZQZWSZgiamwiaiwiwfi vimmw ,ws-,M Zy- Vv mfawwsffzsfzafisiimawww.. wgwwwwslPswvmvweiweww-wwmwfiia ifsxziswgm-.Siege-.3'sw3Qbfagtnwzsiaww 2 as faw:ffg,gs1:wzazsgziizifiisikitiSwiss? mmm U SSQQW evwv-.Wm W wwe,-aww f.eMw:w:A. sw my-1 qs W M-.es wwagppm wmwm wa wwgawgzfowwwm gwm Wai Wm, www me Mm mnwag , M aw 2 4 4 4 4W,,wa 'gwww 3, am-W ' mf- Q Mwifi Swim mme on ww 1 ,g fm H y N34 ww me ww w.aw.mmmWi swam mfaxww mwwm wmww N HWZSASQZQZZZSSZSESE Zifizfs-mmigw mm iq as W .mf ,M gywpgeggpgogm, , ,l,,,g,,z 'QZg,wgf3,sm Y W., ,gs ww W ,sg Www 53:1 WZ s21.!QSw2?e?sm:Q 'wigmiil 02551 ww Ve af fg5,ag,29 295: .NSS ZQLRGQESSEQQ' saws www fame-bg :EZ SZ is .1 gg25335Qgg55ggEgiE25asZz22sam:szagzfsgsssszzixgszzufSw fmwfygzzgf gbg 4, gg:gzwzmsziifstgazazzz iam: S 9 Vw wfsfiwgggszgwzaef gsfffiffs? ,22Qfzfsrfizmzzzfzsszwzzzzgm :.sg:,f,f f L14fZv3?Q"5iE?'i z:ss '2 ma222mff0i1r :Mia 9 594,65 ,lg -ey . ,135 W 2. md may an W , WWW. Wg, WML ,www M New My M, PW ga , gefgmitgtwa fb f,V,im.,m,5f:w4Q v .g swgwgeyfzqzf-W, sg,Gg,gm -1, ,mm f . , ex swywsm 6 dw wwvfmfw, HN g' f wigs wg gf' - MWF 20-W, fififwiffwsffv, W Zwgw rg. fm' ll-"',gggff':55f5Si 2 -,953 55 we .5 iw www wQHef50E2",'Zg' S,-.03-5.533 ,semeie xfmmozaw siiwmimm ,pi svgw ?,4f,zzL4 Q.xpQswawogsswsqoszozomomwwwzg swim, 1? JW 'SWF A 5- 7 Wim 6309092 WK isis' NFUFWS Q FSR, ,www mulgxmw gym 6 ww Vw ff 0, ZZWYFW Km an w-eww was wwwzum aw viva 1 :y M: , wg if Eizgwgal W fgmwwwwga Qgogwagwfwlgg-'0'4gvf fs gg? swf- ml, ,E ,g,gwgfwyfgffg,1g,ggg,gW 34,1 WNW WM W zgyw 1 mg? W H, ,W Www HWQMMQWQ M mi mr W W J. ywwgv lg 1-bww Yiwiriiii-2952 ifiimisziniimmifsimfi:2z:5s.Qg4sz5.93:Q fr, 2 My M Qs, wi fm sw-MMSmmwwmm,wwisfw wan M ww w fw mmwwm WPWN f 1' fi - A 5325525 A3353 Sffsiiwiaim 'wwe N 155 ow-.mvwgwsgqogsase mms ggmwgs Mi 305 Q 5 if ,355 535 mtl 335 53,553 gzgmiggiw wggggw 335333355 53 5535333335533 gm 323 ,fy 2' " Zgmiggaigiggiggigimggifyif5255E5EESEEE:H215ii25522233332Egmiigizsiiaikiisiasmsmazzzxzzifi 2,W5'i2'2E52fff,aQfszfzwfsgefsfmzszm H H w me .,,:,m:,ws www, W Q .,,z:fz,f::g:mmw:w 4 sw ,4 aw WmMmffgwmggg,gg,g,2ai1w wi dw ,H Q W www. wmmfw ,mm , I ' 3g5gE5E3EE3f"?9S?QiSZi?2fB?fiZ?'215Zig?aE?55? 1SffQ22?E5siis2isQE:Ze22sisweise2if25EEifsssiaiisfzzzzmszzzzsmm,ffm ww:iiszss:fs:f:,::sam:z,: saezsaimssszzzzsazsaz 11: 12 I 8 'Eig?Qgvwygiggyfvgw'-Q!'fssg625.ibfsgQ23f2 fi f figf v N1fffXff'wim'sifziwsesidfmfszssmszzzszazesszazzszssffsgfzqDfw?Q:if2S22si:s2zfzsmzissimzzfszisfssfii - I -S9 I PE 5900700 WWW '59 M, iw 2 5 ,W 'Wsvfw 'W b Bw 'Z-",Tf W ' 5' H 'WJ '03 2 wail in msgssiwgviwvweieswsevfvivwwlffiw 'wilwfffggs522,52,355wgfaamaisamvpwwiwivdwiivivoswwox saew2iw LZ-353 ,fur . , mgfwiwgw ffgwvww , -4 M 1 wvflwzwvmgsff ww 4- MM Q Sw f iw , 19 'f A , J WW we wgaswpwywgmwsww , fi, , P, , , M 46, , , W QS., r Q W www pw 'Q 'W ,, ,fm , E. , we wp Qgaafwgwmmfaf Wqgwg wagfwgwgsmaw, was ww:fzf:wz.Q,, by W,.WWWmwwwzsfwzzMsz,:mwzm,z:m: an 2553259 SSSSSEQXESQESQEEQSSEEQZQZSits 233353225 inigggi:-gg?Q255ESggQv0NgBv,f?gggg.2,,,gmgg,g iwggggq Y 5525 A ,qw 1Nb552Msg?3g,3g5gg33g3g2ggggg,gg5ig ggpgggg g ,ii ,aff gs . wysgp my gwggzggsgsfgsggangidggg gg 153 'f . E A ws- Q- swWm.Qm,,,w,,zmse asm. Wab,,:,:"a:::Q2::zw u 4: M D Q Hwwwffpgswgmmzwzg is ,gm 2,1 am su 21 Mazza , Eigigiwigggggigggiggiigfgqgg gpg? vii 'V534'-wgggiiwiwgivgvagfgif gelgwi- fgfiggfg 232212 3,53 5122 :QS-,Q 51?E1QQawwiQ3sgpgv5l'Ea?gswiQHwisZggngwalyua Q, wgsmgiigggis be at 335 'fx 8 W M K- WFS: agua 1 'Q J 5,3 ww, Ui. ,r Gsffiit W Q? 53,fBS,50iZi.gw iwQwimmiswsoaewwfzdsawbsg lwvw A2 W WW fads, WKPZEE 31552 WQWWWP, 9 'Wig' 21 isimm ff' Wfwgv Qiiiwdwis Sassswyaiiixia ' 15? .V 423 'Q fa 5321 v 3 Q - W mwvwwiws wx we wowsw www S wvvww, M f ff 'W' F 1 W 222' 1532555552 W' 5" S?" ' SZQSSZFSWSESSZQQZZYZ Qi SSE 99 ww U I 1 gg - 'S f .gwgismwwginW?s?Bwi5gmmwg.qg0mi 6 52 0533505 2:33 gyjgfggfgggggw faseis25eggigzigizsaazisifsiws:saw nga P hmfggwzw imp Qwzwgigw gram? gag swf W W- azgggggggggsgwsawgggiagsg22359322:gigsA M may 0' f wffiypgmgggggaggugvsq 3352353312 if i'3i33U?i5?iffSE2? wefszsfmssasagmszsggazzz PM r 9, my ,H V W mgwwzswg,avggggggigvgfQ W W, ,ggi 44 ,sg 'W W 'wW0,,,-.W,w.,mwma, x,wfws.,wg,f0mfw1. wi-W wow., Ugmgefa lwgm szs:esgg::fsfse3aE2,iw2w5: bA12S2gigqigiwwgwgmawgwcQS'fa-'SwA 'ff Qi 5'gffe2ffQ2efoffszsazssfzsizzzzzzgsszgazgzwszssffzf nag 555,152 g,g., ,M W , .,-msg is my ww ss W X Q ,fam U P Awwwwv mf ww smw- la 3,1951 Q, gg, ,fm M. my 1. ,-.MM pmzwhwo Qwdamwaswlwwwgy. ,kmmwmwm W qw -- ' 4 ,ww fb as Q ' 024 if ww an nz we mwlhvwwwwsfwsan bww? HP-M'i'f"M 'P 4 - W ' f ' 'Vo ' 1-Awww wx Q M9 ' awmww 9 me Q sm aw m WSEFZW' - SEM 2-:MSS QQ W" ,fe iwfsiwwz-1fvxmgzwwwufr1.M42vdwlimfwzwfivWW39vW?m?'P?M6'?9? fm W 1,652 '02 ':'z,sw,N.,U-12,9552 Buff? asv Azwfsviia 025: mu 20306 P Q .0 ,wg wg .4 Aw. W Q V , , . ., M, 1, W,,,,mm,-mvmmMMWN, , .V 0 ,, . ,, , Q Q Q, xg . ., W W., , za. .:sg:g-2: wx Q im ,ff aww? fm. gif sf ww .gugwsm 'Rf' wgwgwwwmfww-vfw wwvwzsvwvfgzyw S ':?F2f,?.4Z 1b.33L'21W.? Jfiwiwi-0325, wkmpliflmfm''Jim mmm. 'www asm gwhssem Www , W sw - we-:Z b Q W M ,Qfavf am by pwqwfm , , V gsfwgwgwwbwfw Q gms Q, 'swf ff 1 MNH Mfgpmmyffwmpsszqf fs wx wi wow-W QQ pi as wgpgwpwwawbgmqwwahagw ww.W,wXE,W b m,,W,A is SE WMM wgvmflfs iw? fe wzfww A A fmvsgfg: an ns ufm2:2Sszfs622:12YEQ:Sassign iQ2mzSwS1q'2Q,mQiiQ N ww M Mm pf Q?f5M2w5w Whigaifwifwawmwmvwmivgggffgzszpmggaisszw amy as f ,ysfgssszssxggaassgzm Qwewe,fszpzzszzszsswgssegbamwsfzV 2 :ww MQ,,WW,,,mwrm,wWmgwmgmgfgwffl www :wg ffm we21zsmmwmszszeszizassszzsfmzmwawsWmwmwmw,dmviggvgffgmk Mmm 1: W md HV Fvm sEQ?ief1f?,mMwgffvfiwggdsiwmgggw H3,r1g1g1ggwgff2gw'ig:,f5fwfegf -Wfssmgs2527,23i3f?M63ia 2: mzzswig SzwiwzfwzsaiQ4fQJmQ0wMiwysf2MfswwfQwswgsgg,gg9:0gfgigQ5sgQgmzsgagzwzzissisaizxfsz Bowes' 2z5QSa2S?Mg2QmQWv,. , , ggagan55a3Eg::?:g:sggg5sg,g:gg:gxgfgszfsgz? -'I+ W 'Q 'L ' '29 V35 oiwg V' 4 ' 543313932053-5V3w'J k www. wifi, Ufqwjw ww Q ef es www www sf Awww QQ Sw W WH? - SHQQHM ag ff 3 532 Wasil WQZJK Za Q ?wQ"w2iZQ-ifiwii sign 1,614 4 mf,-.U 11 mwww wwwwzwwg 2 ,wawagffagQvgdvfgkigiwiggik5390545 xmwwmwiipfsiv aw,-M ,gm -5 3,15 EggmzgiqgsgsazsQaigifaigys3ggQ2'gMgiMzs:f4Swgg,gW5mg,4g,2ZLggg wr if 552aQanzaegsgsmzzzaegzagsaiwa 25355: fQ:he5ag:Qrgszigiwgwgsgiwwggws giggmggpggz Wy Q W Qs gwzsazf 9 M 7 ff, ,4 T 5139355 seggqgggwdgggigsgg wg2,,,3,-.ggflw wwf.-e 2-WSW' lf' fl MP 5 WN' Wfwoaaw? M Q" Few" asm Y QSM? Vdm ar PM fm Sf20f'1',-.5 Nail ,SSMQEKSK pfivgwswwwawremwagf mwswwa wifi ww W F, 2, Hvwewwav 25PB,f3v,Q3Zw3ia ewan-M wwe: sw wpwiwmiww QXFSQNSQQ 33.2 avg 2 ef 5 lg-gg gay .V ,gg M M 1, fb, lg wt ,W ., my M ,,,QsmW0L Wwmw19v0QQ.wWvp.wW0Q,.MHA as MW, . as mm W www w,:wmM0 42" m'Wf""aW" Sawiksigwawmw' weziwwmwgammywoWWM-W1mywswogwwmgamwpgwgw ,ip ,mi ws V M WWQM M mmm M Mm, mmwmw, ,www - Rf w zwggffa My W ?f"W3"" W2a3""Em2M'2Sb U mi 'W .2 W Q Q 'W My V.,-aw. ,Q is , W ,pwzmwms .Mm mm ww www 1 'ww W W1 W 'P ff: ' ff ' W WF: vw-M W PBWQ 2 -Qzgwmiwwfswwgwswsi mwwmasosagpgwwo H1 mf www M www ww ff eww wflwlw Q ww, A 2, ww Q M U me mm mwmm E 9 Wmmaw- ,,. ,wp was wg Qsqwemws M, 1-Mm, gw, - M4 M, Q, g, ,,,, . ww ,Q.5uM,w V.m,,wM,m,w,wM...,.w.f0f..wmwM0,waa.Q Aw, my X wvews 7 fs. me mpmgeswcww M week -4 3 , - -W 3,..,.,,,v,MwWMQw.W.m.fas wwmssw ffwsyv:-Qwwvwwawvv P- 0 W- ,, Q ,NNW W3Mqbaqwwpwssmqgmwwnqgqwww : :. Rea ,Q mgmggggws 3255188 ggg,gs5Mg,g:wg:,5,,wwggggggggggggaegmggsz so Jiang gig, M , -,Q V 4 5 .4 W ,,g,fQN mf,-MW W www bww QWMQ, .wylw pig? 3333 isgggggggg awwwww:SZiiiiliiswggwwwswsmwme0swmgwwwqvgagaQ:gg0Mia:Z2i'Sfz2i55SBaZ2iZ'SZLZ1iZxXSE,Qmf..4fwswfwf,.wve.1g ,Q mm mawm WWWQZ. E 323322zwmgszimiizizszezzsfiz152222 :lf 3wxgrizizfigziizzioiziiiirzmzisazaiiziflfii2?Qima mafwswifaf m eW,,,W,Qmmggggg: asszsfmzfzzzzsaszsasmaa Q 3 EP3315?fiaefziigwsgfgmwgwMgzfgxafv ww? f aff ww zfwsewezsses azsssmzraasmsswzfm Sb Qramgwgmiggww fffmfwwwmswgifzwifmswfwf' ' IQ 9 'W ' a 'MHZ ' Y YHWB 9' 323' 2 R 55'2X,5"E.-fif 4 23332 57,3 Li SQL as-L Q is us' ww sw eq 'w5wwm.wswww0vs,p,wwf 2 wpfyfa Www W ,gash ww Nwkwm gm pv ww ww W, fb, 1ggfwg,5,Qg,,,,.i,,mgw-.gpzssmQwiwmiwivw lvmwwm-612 15 wg E N25 WWI 42 M HHSGPQKWQMQQ Ps PMN-4 Q Q WM' 4 W U PM A - 'ax 5 5- -AMSW Laim?awww-.wwgmnuwwbwwaww. V QW Q ,Q W .gw wqmawomabg wan Nfwfawwvwfzmvwfv ws- W Q Q 'Wim Wzwww Wwwwaw,-.www saggy 11 5 M f awdwwsfvgmwwav A1 uw wwwfwwmwvl-1QQHQQVPPPPFFPWPM4021, A U 'Hag ' imgwpvmvswbsgwmaiswwwwinwwdwgwygqvwsgpoqxM, www-spw-my .WMM hm-ampwwfw? f W-,iw 3, um, , Mm M, ,H Q,-4 ,, .ik ,. Q if 'L wWW"'70 bgwfaw W P' f W WW 3 ' f6'W"' QNW Mm'E"W QUEEN WWPJXQE 'Wil' Qiwwis We Qgwaiiwpwwaww QWeqmw0:QNa Wm www-Qgaem mwwq www ' M www wgfag-wwwwv ,- 5 My 0,gf'P-lwwm 01 8 W 6532 sigiwzwa wwgggs Sf we w vw 2' W gy ff' 2, 'Q' Zig: J,-3 23 2229 S?f?,ww3iZZS533532mE iw ZW fzmmwiks we swwwo 'wwwiywmm vw sfwwwoww Www, QWQNMW P? ,ww in A "WP Wffliw 222953555522 ES S235 mg QQ,simQE5simzzmzzsbsggizsisazbszgszmms,Agy . ,QM ,gm ,, fat E nfwwzwms.f.1fww.fwmwwMfmamawwfmwwwfmwQwffwgagzwzszzz ww 4 ' -mmg,mg.5,W WW,-sm x Q, W ww, W M M ,Q wMQ,m5,.,,.WW.,Qm W fa l i W ,E ,WW f N' www yvfiwwwwgfgggvga gAgggsg5,3azgaszzazsziizsizawwi'SLM Q M 1, 553,35 A he Qzgmwamiiweaiiw fm if hhvwwwafwwwgmswwlgmamzggsf -2? ,ggzggz sdffmzfzw.. fq,s2N,?2f,-fs,-fqfwffmmmsswmmmszsmmwizgimgii MM Q LQ 19 me QB: pi? mawiwgwwmwl WSQQBQZQ pwwfiefsspw ww beam Q5 P55 f uv' '1 S52 W ww ' V M Mwwgmzfiifiizggiiiiik2323352555331 il? 252 S315 If 552 252 fQJ?23?q9Sf5.a3fZJSs ,ZS 5532 SZ M5153 bSaswwggvwewrf5m if 1 Q :mf A wwf 8 wzwwvwv wfwfawffwmigv 0W'g:,f,1,f2gwg325f ii: 122' ss? 5, , 0 ,M v V mf fa We-av UQ ww Qwswwwiqsbmgsww N A M wwwz W-www W Q my messy, sszszazazgzawazmzsws Q: ga: gnfzzmfzszf zssz MQW .ww -,Q 1 wwf ,V w w f211z21g,zzggmaggzmzgmzezzzszz asm fgwggfawwwwmfmmhwfmsWwffk Q ff' M M mgffwefwsmffzfwzssssszzzea szzszmzssmimzg is L bmw, as ,fqm1,W,.' 6 wswwfmfwfl M Q P 92 Q We '?gWBWW'3"' M""WM'PW? WM MMP PP' fx fm 0 W' 5, r V 'F' W' V Q F . ' ww ws. W,-zwmww ,segnwwwswa www 5 M ww Q ,H ,Q aww v sw pw wwwawwweve wp sm 3 ,I w. Wm W Q w.WM,W MW,m,0m Q5 N, U ,A , V5 X 4. . Q , D, M, ,.,,wy,ms,mm,w Y., , ,, .,, W 7,,W.mm ,W ways mmwwm mmm., ,,. I W..,M,q,Ww ,M,,m,,,M , i Q mn gf 1 . W V , V is . , , ,,,mwmmw,,6.m,M JH 2, ,mmmmr W W M-.wwgmwo is Qiwmgfm. E ,M W W uw-.gf W Wm WM Mm.m5,w9s.Umm,,,.,,-.5 .W fi w NM mf ' cl M 42 Us 2 , W ,W is .fm-Q.-.ww is M51 ,ss Wm, ,vm-fe,-.1 bmw ,W Sp 0 ' 1 N M www ws Q fy,-.W M z W 0 S W QQ P 4 .W sf Ap nwwgw is wwvw is W:-wr www W rf 6 W. is diggs :rf ,P 25.712 f Q Q V fi wwwm ps W mwwmw awww sw W wb. 53:iii2::EEeiiiasfzizsmiisizssimizzzz?5314425zgffszfzasw:,m:faz:g,faf2uzmzfsgazmmzfaasmgsg,Q,zH,,sf sw. 15: in ,M5 ,mggg iwggigzazfgzgiz gm? 'WSE?ESQSSQXSEQZQZZSLYEZXQT595226354535533Xfliiiiiiiliiiiiiiiliii25521355 2 ,Z Zfiiifs viwgraiiiiiiizifiiiiigfgfffigfiiiiiiiavx gg Ji? Qwsgywgfffi V0 ws ' ,-as we Wag Q es W M, ,:?.nzw5','., M Q ww.-.we-aweqf W M ww was M QW wwmf. 41 g my by , gy 5 Q. 5 ,, www ,nga ,g:::,,,53'ga 2122 32,32 922024715216-Sgisiqylqv lisfief eww 9 ww?ggiwwiwsiimiiffimmwfmM: Qww'fffwz-swfeziaeizsszasfazszsza,-:iam::saag,::4:.z2::me,asm Ne,Wwwmmm,m.Mmm mm :imgm 5 A eiZvw:'.e :: as sg gf .sa FW,-amz 'sa sq was sw-.aw nes 153.2 fi dw is W,-.ww mm M QQ V ef gs ww 5,1 W: aw ffm Jw' wif '2ffKg,15,,3iZfitbgiiiiwgiiziissfgf i2sLEi,2.v SAWZMZSQBSLSQ 130 W Www ,fm wgzwumam WSW,-5 W , W, W , W, 1 W W. L. ,, QAM wwgmma M Q1 by we-M W my EW.. 4. ,A w ,QV Q. V , W .U . 99 W 4 YW eQ,,,W, UWM, ,, WZ, ,Wa Q, ,W ,Wm.,,,,w,..,,S M ,W m,M,, Q wwdeaigegss fm mvszzgyzaamw 1 f wtsexwq, f, .1 v .- ww 3 ve' as v he 1 wav Y 2 Hfvvafd SOWWP? wwf W Q?-Wfffw NEP M' 315 gi ' Qi? 'L' if ,if V5 ,Fm QS v ,bc pm ,- A fiwww M im mi 1 may aw wks is gs mmiw S y Q eg sw Szwfww ww S'953m5'WwaF'2w5fP'i'W 'A"'Z3'ii2Z,'ff'?' :mica zsmisiwzf .zapsimwms , 01 6 W4 5 ,V Q U mmm wg ww ' SE2QE5QEEEEaiizisziagmizamifzfzigzwazfz 235552 153 2221252252 ., fm Qwmzmsw ow,-m.m ,Age ,jp sig, 7' fm I me 1 hggwikzwgfjfqfzggigigfiggtiaiEZZSESYZEESLISsiilffilgfl 5f,i1i2?ZZ2iS1'?Zi'Z21l2Z:Z 73351332x54i'3i?S5z5isMi0Ugfw0E 'ww Egg-ggmga S0322 geygwi wggvdmvgy wzzwa- Sf A fgyg 12312353 ,fs 5 Q, :V , W, QM Wiz .wwgwsim-aw Dm W we my w JM wr f 1 ,K w 9 6 M ,. .ffm QQ www wwwy.-he ma Q, wmv, "QW: Mwgrwas mms'waamgzmzVzwzmswszss, was ,,QMf.,w 40 WWW WM W QW Ajm vw W W f QQ Q 1 'f fi nf va , mz gzwzssazz gsm: M.-Aimggzwam-i'Smw: wffffwww W,siMm'3m1mgmmQNNW, Us my QQ K W W W' -Wmww Uowvwzgzfkgizwtifwaazizzgz as mmaimsspw Em N 533 ad W 1. Wy W ww: 'ff X G 6 A QQ gf.-wgwwmws. p0w0ww.smQm.W,M,E, on M qw b-gg f sf Q',5sPi3P02i2?1.,Za'4'3z1 4.7.35 zlwwfmmisg'-',.,M,.,sqmaswwgagw W.-My gg mgSQgRS2w2QgsSiSww?wSk 61' My Miglia M wwrgffzgnMSzsfzgmzfzzzmszmzzw Him, ,G ,:, Q M .M I 1 V0 A M4mw,1m,-.wimwwmw sw agmgsals gszsgggegmzfszzazaepasasgwzzazqaffl, Q55 My W,gimwgvmzizzsz:sagem::,a,:a:f:m,m:Qw:e:g: anew:-:ww-f :zzz 2625322024: 251 mmm R22 ztzifzw? Sf?3222253322QiiwsgfiabiiisliliiiSiffifikik511340 -1 iv522221Si:i5Q:is5s?5f.i:1z2,i-yzesfzpgsisazaVemu:i:','i:x2zs5ame2:zz:2 1125? ' 6-.WwgpSwwam.m3'sWa ,Q W L6 Q W ,gg W Wagga y mygsgv:fgQygggggg,3uggggggg, r 4533313 5,52 eg M531 421,53 , M az ,N 5 V wmmgwswmm Milam bw, Q ,,,LsM.,iWwm gk q U as 9 W PMQQQMWHMWWWwww'WMMWV,zsffgz f,wL.2' QQ.mw.wgM.,M,-f.wWWNMM, WWWQW!,WWQgamMWm.WwW. was Wwzmzs:awwwaswwsmszfm,mW,:z ps,QW:m,, r Q, .Q .4,M,,wWWmmWww M N ww-fam hawWwzfwzzwzmzze 45:31 S Pmziziszwwizwseia f52fz25W22Q2iseg:szgszamzzismzegzzgzzifsgzzrwz :mama smazgissf2xiii-MSilgdiiwiiiifiw ,,'5,,,M,,,.f3.g2f1w?gm,2g,g52,.s,W 35,3 hr, ,gg U ,X Mvqygaq AW foam, fmgygga f.54-.ggggggmv 5523335 seggjfggg33-QiggwggjghlyqiiitkigiiiiZwi0iiSf3!lQS2EwwA5w53g.1,fQzw5gQQw Mem 52assmsjgwzzgsazawaaeamazM11 w ie: f ww fi 1, 2, cazzwwsss WMM ggigfamggmggzzmfgzrwgszs fr:e2zsims:zazsrwezmzsazfsszaasass amz: Hiiggiewzigzi weimfam:fsawezezmaszxszmazazQ:1,g:gf.::w: mm ,szzsrsfsw-ffffia2Wmmmwiserswwmiwsf 'E' 'ffx:"vffym:P2sf:a5zf 21:21.12 mx' wfiwfiif 'wma A: 1 ,H ,L 2 ,f:,:4-1-swam,-MQQMM ,wwmm www Km-new U W af K at + vwwwweoiz 522, Zak-.53mZ55S'3i'5ZL'ifJ3502fZ2wSa21X,kEzeiji-wizwwwf was in A ' mi: Mme SRM., MLW, , tm, ww, ff..-ww mfmwf ww www-ww-fzw14 sw 11 3 gg gg Mg gg: sz: , gf Q ,mm :EQ was W we W em WWWQ W ww-M N .vp S. XgiggiifvassziismzihioQfzmzazaagzgsmigssea wzsa: :,:::Qmp is if:22:22aa:ar2z:2f22 af-QgFw2wsn1,f aggwgif wks: 5:1:Qamiga?zfff,f2:::1zisxi2zzas:: iam: i m4'g?0Evi:S5SSPa2zZ5EEzK 29ff2f42fyza'1zwf:2ss:.szziaziimzzszszf SEFSZWJJB A ,iff alfa fsrvwcx,2Sawazszzfssfzziiemzgwg S' 20355 is mmm :gm :: Qiffziglsiiivwgivz,-5s4?5,g 'iizfSzzrffwzzmziizizEzzmtimafzsmizs:Lx iz: Laws? i?iw2g21,9iz,g5gmg'55 mmf :img ,X widwiwaiwsigsipqaiyaawmdaW,f , gm-,M,,f.,11M.1..mV-whwspwwwaswwWwg-3Maggg45fgg,w::A,gs.m?, 255.15sam,,ftEzisvzziafls,m1,,Q:,,QSi..,QvE9QSwn..1,:Q,,?Q mm .::-:I ..:-.':2 ggog f afgggqgw bgggggvfgvgagw ggfgggffgg5g5gggggg,'g9fg?:Sg ffiiffii'giihi'Z3135?12'?TsiZiSilgpgifiswsahzaeivewhzfeqfsfawwqwww ww www we vs 1 bw as PQ H5wf12'g:f:?f: A 12521 :f. :f.":f2ff: 1- .. 3325523331 zE?2f'Z?2W3 ?TfiZ3.w2?5 nmfz gfafzwjzwf 2SQgs2wf21g2f2fQgfif' y at fa- an .:. 45- -: .:.:-. -:5 -. ,M-ag gsm, fs M ff I SQ M . git f ,sa f ga 4, Q my if -yawn ,J wsswgmswv K fwswww ww' i f sz gig s gg -gg, juli: g,fg5,:' 'SIZES' P55222 YY 522 Emily 211.332 E Ziiifiwmse Q U 72, fi A :!:5 E: EI-'I5':I sSWgw??s' igWg'igg,Fg3"fgVg2?A 'f 'wig VF' if L wg 313213 3221: Wifi? Z? if? 'Z Bi Siiiifiiifsidiiiwlihii Q f -qw 0 wi W f X W fy 'f 2 Q 1 M 'f V 1 W' Alf? IMT? 33222512 if 1212 32' Z2 Z -1f-s:-: f - Qmiiziisms? 55:21 2W?3152223226zifiimsfizehaisssssss: sm: 5:3575 :sw isview22222222SS1222QSviQS2SwSE'Si2'i 40 f L 2612212012: :- :-. .: .- w Miyagi si .WZ Z xi f airs my in .. kwin .gms xwwxszfgdwsgmsslswv an W A W '-5 wwf 11 Q 3 Wg' agE1Q'2Z?i','F3? QTUSSHLZE Z SEZ X255 235335.31 JZ Jw 535 521 WJEZM 5,25 Z U 1 ' sg, M mrfwggmwvfwefswspfngyip L6 Aw +954 wwwwvwagagwgwgaygggf gggg33,sg,g,,5z,K,,,mw,K, ,K t A 1 ,, we ss1,0fm.f.,7,-gwgwwmWmgwpwi ,ww ..:.:::5.E,:.:..5,: .- 5 Bmw ww? ww., www-N56-.Y fa.: glvgw f M as J,-x'Hf'WW' gf? ai saws' mwamm M mfmm,,,,,N 9, N 7 9 4 ,M f .W ,cw vm, ,Www Q1 WW M .M Z :2 2. Ms? GEM EPQQTQSQQWZQWW995353914425 52312 :ff Qian? has A Qgsifsggwf QYW ,fam we ww mgwa3ewgw:wwg2ffs,1wf A wr' Q ' W ":z- W2 SEQQZWSZFZSQ H wi if -2- 2-- ' - - we 'ss We I N if Q if H ' Q5 ai MfwwosfsswswwsrW W A fb aw fa 2'fzfmziwf-m'm:wzf:wzwszmzfsaszmaaass114m,,2'fzy:a.eLz:,:Q:,, :gm i z s msifwgegiimagw -EgiimiiiixigziasxQzmszszsazggwsigmzzwafJw f'ffm?mfzgg2,f fm: if . ., wie. egg Q gg?QE336 ig55gQ5EQQwmg,Pfggzfgf:zggwazzawfxgaszzamgzszs zsmggeazzzqgamggggqgm .1 Spingnag W .E 4, , m,W,,M ::'. .:.':I.2.:.'5I::.:.,gI,I- 'Ig Ig':2 ,.,. 'ms 559 H B ffm 392 0 'vwvwsfd 9, Egvggwmpn vdamw qdesimzsivi wwe ww vsp we , as fwavwsioawa ,yyoxww n as f, fy ww, w W Mwwewggwoepwgn M Ny 2 :s:. .... . .:.:.-..:. 2 S W W al, EH S W S S 5 2-W 5 Sys? www Q-as Wogiymmbwi wwwmw. gzypwwmwmgbysgwg59gga1mp,.ig3,bfzg05,fg3ggfg,ggegg,g gbggt .. ., gn, Q Ks Mmx S 4 'ixfmgxy QEQiQ,.Qsq,zw,z 4 ,W mmm ,W WwsE,gW,.aWg:vWWgpgggggsawgg. as mmm Smggmmm S ff-.-:f- s Q- -1 -1 sf NME 2. ag ge-QE mzwgifssizglipgsggzazzs ga,ua:fs:zz,ms2AassifzmzfsszzimagzssmzmdksswawagNmawwmq Mm m. , ,'-.-:::,. :ga:,:5:g:g:,sg,-:g.:5 djggggggggggiib 2.,Q,g .SYSQWJEQ ai gwfg,-my iswwwfiwz ss QQ 'ewgwwashwowswgg gwodewf wwwwwwvwf wfw-f2'vwwf0Mff?NgvSg gwggaggsgpggsggigg gzfgrggqmg, ww, W , , 330153 g ., ..., M, ..,. , . V 4 Q Q ,W I my WWW Q Wm, my ,,,Q,.W-.v,M W.mW mwm,.f.W Wmwfw ,Q M ,S 1 al F V ,, , M, , ,M N , V Q. , f vi :- -. ' gg .W Q. 'w2imf'k,,M Us af' Q-ifbgiwihiwa mgfiiffiwwgwa 6349 Q-ragga Q,-mwimw.wWf.w0,-fwwwaww Qggmgpgawmwyis pggggggsygggeggggggaggggggsgizagggg gggggggsgg 0 gig 4,,fWgg,gy, , sqm, U my new M. W W . 33,15 gr WWAAMfmgmiSif:ESEis522aszzz:as:Ezmese:afzfsaggwzeWgegmriesasaszzzas12gs22SzgaagizfsiggemawgsggggMmiwggfvgiggwzwwiwwwwsszrzmi:zimmaszfgz3:2221-,zzszsszssazifiezgwwwwwMy , ww 1: -I 2- 2- ' ' A wwwawwa fsswwwmz :ew 'www -v wsigfgfifffeiwfgw W1-fwfmm Q? QNX Q 'Q Bwiiaiir T40 52W550W5'Q-34SiSZQSWZWZWYESQZSQQZEQESMllwiimwwgws Q my wa waiswwsrwev if fwwswwce' Q fa WPFWZQ 'Z S22-'SLSZQZQZZWZZZS ww Q U my -. V -I -' Q Www" 'W'5'5f"fgWW5f'l'9W590f'aeW 9 Miaa' Z"59'WV'Zs3SbW?z' k5lY'SS?w5'ZJ+sam Yfwise 'vm-Jwilm aww Q swim-an Q Qswwwew M Ffa ww 0 ww m we 0 :mia ww x vwwwwmawff P520 W ig' Zhi PM 32553535 2, 'sa ,sm ww .ia swat Aifmw M ,UMM WN V. , , WQ'B''3''Zgfiimmiiiiiimiiifieiii53:28 lZTi2 5???Sl2iZSl amwigygiigiislfiiiigfZ215S5:Zff?ZISSZSESHSQEZSEESEEZZSZEE wa K 2f ':2 rar -:Q ggmyw Www in12sQi2S'm0552fip2Mi0QgwwmvfsewwzfgzgMfgwivsfsfzazzszagsszzsaszzzsfiiwzsigzsz 1's?S2f:211'fQf2f ffaggiiwgiz-3s4figf2 :Lz3fff: 2253522221 -:- aw? Y . W' MNW2 isrzizzzfzzzflfizgigziifi ,E w1'ESQ2.S?rQ.,amgmm mmwmsmwwa sw ww www wws'vgg,3 1 gygggzgszf 35 :B :iii whzwzz S, ,saw Bmwsqaxeawwgwy W Www-Ummm wwmwo wwwmog 4 , Q R A ,f Q- Mm,.,,w,R, Wi N www W W mawamwwwwwwwwww1gfg,gfg,,.,s :,,5,n,, W M W Q Y. .W W WW W me QM W, -Q0 mm M M W wg -WM aww w?,,,q.mw N1 W ,im , 5 mga V, If I - wiwaseizeiiiggigszsez zswizzazzzzzzzzgmimmwww2wwgkiggiggfaiiifkz,EEQaszzzzzsezgmizzeaszaazzaswzwzszir QSSSSSWSSMIQZMSEI of 2 'ff , mis: ? W1SWwmiwifwlzseiizszazaa:M?'?::2w:2'w::s:2 Szazaazzgsziszws mm V , Mw gg QQ :I ::. gy gag f I , mm lgvwvgwm awards:iggf0i:fg:Q1Saiiz.Z:2'3,22i SsZs:e3:2,s:?:2P32:2'3iSe:""5BSZ 2153522 px 22:23 H Q1 V :mis W M M wwgmi xlgwge , ' 1232252 355333 ' MW mwbsaizf vfsziffigbagz :Z mg 355053 ,- X ,dw WW Aw! wsmmw E. 3 4 Q ,W V MW .. , Wai ...W W ,. .. gg gov MW wi 2 asses: .,,., ,M Q, F. , ,. 5, WW -I-'-: N wink R23 1133523 .5.',:.:':I 25 Q WWW? wma Yguis 55 2332 52222 :user - ggggxg ima mea: awww? W ,I S5253 2:21252 Wagga? 2575235 mg gm f 6 sn ag? 5252223 :mm z 23:5 51:12:12 msg: 5:2311 ...:.:. ,Q QW ww MSW M W , w w: WW asf may w igs H1251 5523233 sam: b --f:'-E f:g'E- 522552 sem: 1 2: ram? :erase -:.-:2.' Ig. :. :I vwgf-1:3 www ?m:sf :mix mae: x iii? 55225 :W 64.1 sw W sam jwggigw gms: Wu mg? Q .fe sz- may :ml kgymiiiiii 335352252 fvifvwi fam: wgwgww 'ggagga 21 ww ew mam kk in 'wwf f Ng wwwwm 5 WE 1:2112 k Mig?-QS' gf 53 sw 544+ ifgggjlgig mask ,4.gw,. 29535 ' 51333.23 eggs: .aw ' 535252255 was zz gy? :mg L QQMWZEE 53555 r 22325 M54 535556 sim' swamp, We QW, 1 digg Q Qvggwfms Am. ww 53230 we-0.-za 113335 Wzwzw, , may :wo ,Z .,..: ,WM MMR bm W MW 3 Q M XSMMESS 'MLEQQMQQQW -M as Q 5: , , 562252 me i s " 5322212is2,sasas:Siam84QbygfgeQQzzgzizasifgmmggghazezzzzzsgfwwgiwii my :a-a.-:- WGS, wwsmw wwmzwiiagfw Q SZ an-aww rw ,W im Awwwwmw2rQm'327zQif5M2gwrfWM. . 022.33 55233sag:asgs:2egg:zeg::,wT?'1YfEZg?wzfzsQ:.s:3Q5iff223as3sszazsfzzeizzsazysmgiwSmasgemsa:1:mmw..w , 22 .mg vm awe ww 4 s. QZSSZW 0 :ms 7 Us :ff ,ff Z-Mm 'ww wwmw 0 wsazxsszmw fm www MM PHWQQMWQ Eisazamm ,W Yiwu ,samass:Ezsezseazzzsziziiggigiimbwgmwzizizw 1m,,,,. X X gigesx . 5522333zagzgggigygfsggggqiwgigizigiggsQggggwgiiziiiiggeyy fbfaziziiiiiszigfitrzzszz mssizzzszii wfwffgfiiazliaizgwm 4 1 - 215252 5 K 4 7 : ' 1 ' 9 KM., 1, HWS A lem 1, Ma , WK- qgsgswe, 529 l'3g0x5wyQ.wq5wm: fwvmvoa-iq,-,i?9?Sq,,fWa?W Dfwdvkw Wwwwsmswmm WQWWTS Tgpwwwzwawww , 1 HW'?'S'K'Qw ownsQwwmumnvidwvimfopmwf . ,ideal I: migggwqg gggfigggwgzsgmgi-wgWg,-wa is nggg,ggg,g,ww.w wawggfgiwi Qwmmzaww miaww waist gfzgggywwwf s1 ' M ww-v vm? Eiiiigfgw. ww Qwfgegs ZZZWSZZZQZSMQSQ M ss M wa swwaww mgw: W gwgggg W, W, M ml :v , 5 miwvmzffswoafmamaWSW2212?Zmwrmwfwfwiiiiiimwfewi wmsmzfmiz.gf11S,?msf1.'.4Qsw ww wwwws flgg sgzmm ,f waz Q if K K , gwwgsgggsiggggigea 95QfeQfpwRas3psaihwywdzgwawiigmggg 8 gmm ,Q wgmmbgwggogwgg, amwgggggfgm QQ W W mmm Awww,-so w,Wg.3s fgsbwgwmppm gain? zum: gwgggigagf sg, giwimww Q1 W ww ,MWTQW Wm .www my W ww 35335 M, W V .. . sg? , 3 E QQ5wgwg,sw2ai2wEf3Z'3ggggSwa,wwwiwiwv1?P?',-,MIZQMAQQ AwamimwwmwQQgigWmfswzaazzfzzaswffmww w awzzw ,MM NewQzgzzezezmzszgmzzzmzzzzzzzmm -mm N V - 1 X335 w.,,5,,.W,,m,,s Neggwgwtgnggggggfggigwsgr51 we QP P12iiiwwogwwwgmmgbgg ,pfggzazggsazgwgf aiwmlifi'siifsiiegifsiiewswsi QQ pw 332 22.23 lim Wm M wwwicm W Wag? Qfgifiwi fm, arhmww mm M: .W ,Q W.9wmgmwwegwggzstiit6512521 amwmgmf, .Lam M ,ww W 555 4, Q 48 431359 wgmwwwswwwsiiwiff Qagaggwsfgi Mwwwew m,,Wnmwgge,,,w,,,,,2m Q.-M-.WMI ,xr zgggowwawwmmmm Wm0.mW0w,w,,g,Sm0.ww is Wmswwsgfsaisfmgum. M.-Q mf K Q1 M WM we M W ffwsmwhw waz, Wxawm, ww om ww ww mm-smss Qmwwww .wwlggx ,M W Q1w:aw0fq.g,x.mW BW 4 s,,Wa,f W,-New www gs mwwwglu 'W MQWQQNM is M Awwisiziiiiw we W ww fi PM wwf ww 5122 M: .ws sm w www gg gy? 3:52.23 ,Wm smmwmb 1 -:ffffw"':""3',f 1251513211212525523U:wwwwwmdwwvmwwwvw x M Ziff awww wmmw- , my iggggqw . www has fs wg FM, wwwweawaww-.waawwomwaw ww M9 I W - 5 was wi W 'WW wg swsmw aw P fb We wwe wx s SME-,S Q 2 was a :M M , P- M32 5,51 sw we we rw ,, 2, P? F? Zwfiiww ew-1 se W wwww H D aww? ' 1f"'ZS"ZZZZ0 Q 5 Q indium iw me W was W wwwww W WMM? NM 'M wvws wwmsg Www ,W w vwwwwf wif Q WW 2-H v ggmm W vm, .g,,mg4mf6 Wm,,,.m,W,,,5W,,,,1 48 Mm ,Qi gs gwweww. Q , WN.-as Www, ., N.,Ww.gw.2f.4.1Q.w www mgwwmpgf' aww swam wwf an . 3, ,,,Mg,W,,.WQ .mm as as f- , Q- Mm wmvammmmawsswww 4 5- , 4 ,QM mm, mmm WMP my N W www wmwq ma M 1 ,W ,W ,Nw www we ww-.ww M ww-fvwsf W- 6 .ww ma we-Ja.f.,,.5:QSf! wvx-wewwspwwww Ewm-QM-..w wswwwwa ,- ,awe www ,Www www? was Wwwamwwawszgw S331 'fa WP 1"W""K" 11:2 WMM wif ww sw? by 232..wwQkwwwefawpwavsxiwim ,EHS .mm Www QM.-,gm my iogwwvkwwwwifo'-fwvlm P2 www QW, W 4 ,- W "WW M W ew W M New 'WWW SS 557 was gm 1mw,w,,P M 'W wwwqsswwwm ,mmm ag bwwmwwggwwwwwgqfswmm W Mb aww wwf as mm WWWEQQ efggwff MgMsWMrwQ2gm,ws00,m fm ww im, ,M N wdwwwwff ww We W mga ws, ,nexium si .W mmmww M we www was wawe Wm Www gg pf W , ,wt vw., . My M W wgpwggmw, W, W ,, ,Q A, aw M-.,,,3 W, W Wmgw QQESWGESQ s,,wm,,Ww , ,mge,w,,w , . ., mv w,S,.m,,g My W ,S gg QQy,,m,,F Q gm My Qqfwmamgw mgwm, M Ngwmmbw Q 4 ,m,wQ,,, ,.,.W,q0 aw-Mwwwm , JW W wg, ,, ,S Wim M ,kwgwqamw M-www www www ,Q W, W- wld-1 we sawwfmm mm-:sf aw',,,,Q, W1 W ,M Q, ,bn H, ,5 1 Q 1Mm.,,2,.g,W5gm, lm ,, ,M ,W as mm pw ., Wm Nw as , ,ZMWQ Wm Mg.,-ww W Massa wmmwa mums., -4 S W some mwgme , .,,W0 Www M4 mm.Q,.,.m ,N .12 9- M WW, W W W Wm may ,awww my mam .mn K WMM mm wmom wwww W - me wmgws , ,W M it 5 5 , Q L? M F: ,W Awww Awzgah 35,133 ,emhhwgwwss ng.-.Q ,Q W3 wwgm gn ww ,qw SM, Wm Wm,W, W,ggnw5.,.wemWQgeM we wfrlgw, gww ,M M M M so awk BEM 5m,w1www wwmw M News 1, 2,4 03 ,qw ,Wag ,Q ,iw Mmm M mm M mmwm gm ,,wwg,, ,Www wwmwm Maia, wwmwwwff Pwsgasfw P Wag mf .Y , szifzzaizfiwowsfsmslsweiwzq...m.,.sfwmfgggzzmmf?via!!wgewmgzgfgmmgmgawrmzzzswstwzzz:LM51:2:mm-5-55:2mm2?Mwww?2'ww:mitat:tsQazsizzmf.wwesfwz::2'Z:fwizzzsrzzrziwzf2mwsmizimfz'Yiwu'fmfswsmwzzzszia--me 1 5. WM ww mmm , 05:13 ww W,-fs,,,,v,g,5,fs wigs ,ga gzvmgz, mam Em wgQgag,,E,,i iw mgggggigmasgmwwmg ,wmzamfzisiwiiwzwzsizeliiwtgzizffiimw 'mwmg ,gggg1Tiwws.eQm.,mwwfWegiiaimaamwwwwwwwmvvwwaWwsLsQsSL2w'Lf1?wfwwwMmmywwwW2-2z1zzL6?s:?shww2w1 ww Q bm Mamma: fswaxqlgawsvsbfawexwggam bvpwggdyaizwwmsaiagngwa mm ,mm mm sw, , - Afwwswwwswwewwwwvwmiwwgm023,-5521,,-,W-pmzgmowxaawwwwwffwiw ZgwwmwwwsSsvw1fwwv'w'M1MQ-3g,,,,M,Wpw0wws1sffw+w www wwmmwm W is ,Mm ww QQ www-.wmmw me is ggw ,W ,mpwwwsfe www dw M www QQQ mm gwwmw ,Q 0,-.gig W N was www WWWF' M ,gm wwf New Wwmwm mwww aa Wm-.Q M Mm Mmfm,-as fa, Www wwwm mv ww Nw W www-.W mmnwwffw, fp nzwwwQaswwwz51"'te'U'W0wvvwaavwwwvhm six FW WWW M 'M "WNW 'ma si S,-aw WW ww as wg ws WW ,.WWa gas sw ww mga .M ww Q54 Qmvwqswwpwa wmwmm, , ,awww-mmfm W, wwwm0i..2MamQ.fmwm.wM magma! wwamw.m-.W W ww, .W Q1 ww wmmmmmm sw 44 we W W QW-weqmm.,.mwwwew M W mwvm mm, A ,wwga Wm me W ww Www, ,M,,,5 M ,mwww-.12 3:m3,m an .W MS' .s,af:a,,'sf:sQg,'2i::wfwg, lggwwwgilwPggzfwsiiimzwfm' M-Mmuowzmw,F,wwwwezewwwwgyWmwmwssmwwWWFmwmgezzizfzwmasqmmmmwMM93252522mmmMmwwgywgwgawmmxwmmigzzgzfwwmmsvwwgfw:1:22:22-rzwwwwizfztxaf wma we px-wgwvmpe www W1 ymgwawwams was mwmwagwaiwsb as .fiwig .mm gssymswmaww Wfifw wgwawwgwswzav W wffkaiis 2'sM"N- 0-Wlffwmwww H0 ww WWW aiiuw waz wweQwwwwpwwwwtwiiimis as we Swflw WMQZQP 'P' WW W5 www w is xi, vZi3WiM1"3"bwfLWe3E'W'F'fi Beam M M was W""w.w ww V , gs ., 9.-.0 Qwsgwwf. Homme , 0 Q Nw, M , 1 M Q awww M Q X 9ggwggfgggE59gggZQQQgm93gg3,5mmgg3m953.fQi.4ww.,W.vm..if,w1.wmQnggg,g,:aww:Wgggmzzmg.,wM.m2:,zzfzzamzamazzzazz5m.pW..f.wfpwggzqmwzcazezrszq.Qmm-mggmgz5:,2ga.smzzemzszwffwil'--NSWIHYimilwwiwwwwfzzszzszzzwmm: gs: - Nwmaawpaewg lasmw, vm New .fm-ai swpwwgwzwlmwwii ,B manila JSF Zzmriw mwzmw ww 'WZNSQMN .aw Qmwwfwiw MW W is ww ww if wwwiwgw WW VQQQZSJSQ 321331153323 www M ww P gammaQbwmwissigiw r 5NxwWW'WMQWWQ1"m"E0"fSmSSi2242ifz1wmfpwfwilikewi.: WM 6. Maw Qggwmgg yawwywww Q? Qwssewm my at .91 Q2 Q wwfwlw .www 4 Qmiwwffwgwgwfegmfw wffq-,Qag,fwww2f1fww90ff,,wzwawiaawww,-.Q ws Www www W Wiiam Qsbywgswmmaaqfsiis ull?Wfiw"'1'PFil'fW'Q?5Hm082225232516wws:WwP1e'?"'?3-733wwwswwx N wAa.,.f:ei'mSf5 if Nizgeggwwfs Wag wimiwlwgw ,Ei Qiawwwwwmaswg QSRZZQM ws Wwnm ,225 gifs S3 Zfifumsoegw 2? bg whsfww 'ifeii-mswmawwsmiwwwxwwwwQPWZig,,-.QM-wiPMwswwwwoQiiiapvE'EP0W"W'?P2'fPi"iQs1 ewwiwwwi WM Vain QSM-ffm? we Q Q - ggwxfww .mmm .1 M M 4 , , Mmm , , ,. ,w.bw.1-fe Q A . w wp N m.0.,,-.mgmm . , ,N W , , U, .Mmmwu , , , , W , .sm.wwww.L.w Q Q , W ,, N. mm M wmv MMM ...fws'bQs-fpmsmzrfzzizzit!':zi?.4hs:wm.3N,.gg:S+.M,.Ww...qi363www..1m.,.M.1Q.ag-ggggygggq:::41Lmigzgmzuwwwywmggggmggmggmgggzggmgxewwevw'50sfzzztzfsziiieztmAWmmgzezzssitmm W,,,,.m.,-fm wwzgw wwWW'593322wZfimsgQ'ff21WfgevgizfgzgftmiBsigsgzswaiiiiiiiissiizlzzili Qiwwmwwfmwigewwfvwfz 055122115251 02. .mp www sw M mx is bsgpasitgzizziziimi ssifswfwxii N21 f5f:J'efw25S?2fZZS4i1 we wwwffifsw mmmezziSpm0Qg-gs2QQ5:as2SSE32AQwQisQ5-gwwggwgwgg-gfggwwmsWwfvggwsg2iiafsiimssizsazzgzzzfssiizi51:semmgcwgggggggggggzgzzszggzzgzfggqwww wgggfgzzszssisiiiiieii .. mmemqqymwvwvt, Ja '22 wiwas wQ.fwmwa w aw ww: awww ' 9 pw MQ1QWSgaQ2QQ212is2:Q2eszrszziaziseiiizisiwWww: , ,,,,fmiw.3:5g5ggg5Eg5523g iiwgfwgigig fwenwri 'a is ,-.Ju Xi' wwmtmnm W wzzssfweezsf' 2"zMa1:, azaitifaw:Q-gv:,'5ss2Mfg2'v ,WHQ24wgggfi41mfgQrg:mw5f'ga2112325522322 HEESWQZQWEQQSH1::iLWWf3f'iS?2"z'WWZZELWZJZSA LZSdfiiwzfEITISWZZZSRWBEWZSEESZWZS1' +Ef1w?1f"'SL3 Wizizw my V mllipv fv'ZlTfx?i'1EZwz-wwikbww J-E ' fi.?iyrW 4fwtSfmtgig,2w:fgiVwg,,W.m2g,MwgwwkMif:M.wgw.af?sfM:3:f2 :JZ wiiaiw M 2b?QSQq"11wf2iQf'3?w2w'H.9wHfgviwiffswjpl H ,,151mL2Q3'5M: 'SS My 11.25711 ffwwzz' 'zaiffwfwwgasbifsk A 7 lfvfziiyfmggzwfggzsw:ei.,,!w'fgv N 'zzz AgiiwvqgzziWwillwlsm.'ef' wav. 'wk'WWMlillwgziwsggsmwg! sLww'LiwWZ2S5-f' .A MM wgim ggi ,ww ,ma.wg:z,.wjgw:,mf ,, M 'Ui:Q.Mf'2Q,.M-wxfww' wtfgwm' A ff LQMM'ZZw1mfw5:wwg,g.,if' N.:-wg L. M 1 'Ewg'Z5Ww3:,,Mwi,:,,1 Mimeggzwggggww .A-Liziwslzwww if1iiQw'L::igzLW5z I ffizgMg'-fllfswiiimz. llwezfalk mgg, figzxiivfdgztzziwgaiimwnfT uk, A ,i2E5z,zJf4S1m,5?w ggsiilwggzfwgifzzzz,fggwmfgggf ngzikwawizzaw fNM,:nZ:im.wg12wv QQ.Ufgiawfiiiaiiwfizwm W vfziiwgs' .1WE:2GZm'l'2S2gaML'i0kQ.b nigwqgi , QM?gsmggwgfggiswygUgS1Hgg,iiwggg71sw 3113939 21521 Mgz11iE?iE,:.J4i??alf?2iN ,.: 1:1 F75 if W1"W4i11,Lzfi4222gzuliikfwagziiliiii illlff A,Mm::N,.gg5wi,111wgI , fAH121WgmnwiggaWfwggg,, -wi, .'wg1tfwfIiZ1JfMi.1-f , Q'1,,:1wfgl,,,mM310 'NZi1QU,:gf.0gggT,,?135,. f 4:1 A 'gp ww,rwQ,MQggiW-pggMg,,,,Xmgw13g1n,pggggwhNfgggbm f Q. pzwzz. aa. K Hzaw , iwwizwfztwzww A,sieMim,nwffgmwfgiwwzzf wx Xwzwtzwfzwmi n Nfzpwwgiwf,ww,wwweWfgW06g.Mffgg,z4..qvmy f' wazsxzvgsfiwizil .slffmy tiimgzii gzifwzizzmztqzim' QlziqbfaetlxagzziI15:1Jffzz1:11725ziiizzazzzifiiziuwiv M14M5115XQgzfi5giiZ1ggE?ggw'?g::fifggziwgggzziwgsgzwalivf imma2zsQiw:1wfzil2Qg1S2?1ff, wgzfiml fefswzliazwgzimgzssfgzivvs' -w me A 513- 5Q'kiwi31MktwgziggmsggszggiivQGQWQQLQFSMZQZZZIZZ Mpg.2.Ms:...q5gp,.aLM.,.g::s H .bg-gjwwegzwwg, wywkg U LU.,, ,g,.W., gymdw ,Agn 'Nw ww MM:I5Mn17Mw.10ff,,L,,.mfZf,A Haw Q W'gMe,w-11-M gg 010, ' wma, fyghwfgggzmwm Q 1 2 ,wwsf'wf:gQwuQ Www ' mmwwwmsinwffw Hmvf'W:zw.N.M5 Www ,wwwww W H wuwl .,,w'i.M,.4Mwvzfwfw, 1' WWW 'Jw , ,W ,Q 1 2-va. 15- ,,1,,w1,,.Q.fgWf,. A lwxlibiiiwigfggsifwg- hzfzz, Lilwfggiimwqiziiwgziw WeWffTigMwggzswwsgiiiiiilmQzsiw-eftfwgg fgjvmyH:Wf1,.w Mwz,.wwm H qggzeiz.Nw,zwfqgziswgggwig,ymggiisggfweggwgggmgggggwmgfqW1 2 ' X 1 'V1'Uw:xi::1 Vg W1g,Qw,mwwwwwgwggiggggswf mi 121. M, 4 , ,,, W W 4g 512, sg,Maiziwriilimrizgl ,W MyDwgS.,WEm.iL,WW 373-M,Mf5gW.m,, mW.,wUt .Mya 45,9VbU11:g.wMMwgE.Hf.w,qmwggv nf gmUmgz.mwv,n yy fm ww, U H U fum ug,gmggmw,H ' D M 6rr1S2wf,122gzz2ig::fw21es22i sgnmyfWE1111W12sizfA3Eg:i22'fz:m2:sf 1LfZbeLQ215vwggaezilwiznzfzafezsainenz, 2 ,zz112:31156221225aziwffigiiigiifsiiaiiMwiiwisaffaw ,Y zzzVwgzzqgawfiiiqfsmfaigsmg: DHEWMW:wiiiiiesM333g,.wyg5iYy':32Q:zM qiiillbf1TSS'Emwvggiiifliegiiiizm222342035222 6 WW ' 'Q' 'G' 'Z 4 4" QXLWPEEZMVEQE f Q T z1153asVgwagigiegziiyggzimw mgqw M M Mwwgzfmf wgzitwgggwbff 'M W,,.vgswwgQW,wgggifggwggggm zwvmnq-vim 2:Nw,,MfM' aww Mmm siiiw-vg,gWu,,wg A L. W gw heir hi,zUwft3w,M W ,MW ,M ' My ,fm3wg,93:3 ,- X if MWWV' 4, ,-.. nliiisnggglgg,3.W5g5a,gg,5T::iQ23q1:M nm13:2Q2M11311134212QQQSQZQQQQLZEQQQLZZUzgtiili5:ia552422215255Uig:BaiP2f1:':,'SwfQifzsilmiwzzzmqigwq .Q , M new awww Pg"5.ww,4a,,,mw ,wwf D - .mmMww,,f.wfa wwe -w,v,35gP'uw0 ,Wm Mi wiv-fgwm - Www gifmfv- .awww ,mw,,,.,.wg,,w MW SW: wfgswmwwgwww' 'aww Mzswgzfwf ew WM fwsfd M2921 W 2 W W'L'7sw mwlzu 122EszslifimzzigsggzzaiimewemsafQim11ifzz5,23332:2225-xzsssggggazzizgzQsgggszaxizfszzmmfzyzszmg ,vwmpefs,:pygg:sfsq2w:iQ2grimy ,,,.,. -i'WJ5651e?2:1'Sfw5aLifzazlwiishwsziidw' 'asa2M41.:21Qwmfiwsgzswifztikafwgzi' Missa 1,1 ,wsibwl ,,zz95Q:5awg,g,pg:ZiwW :sl gm: XM 4 2 1 R Q ,M ,f , Ugg Q N .1 M NN E ' sw in we Q W' Q QW NWZ 4. X 6 Q as Q Q w:s1swzi2w,,z M 94451 1211212 ,gwwg Egxizxgf :Z-www? ,WL ,M 13522 in W 123115 M Yi? wi? ugwfz iii? anim-,iQ Maw Eawgm w,,zzMw wwwgf,.Ma::wwzE swsmwiebmggmmwiaW,,,gmmM,,W,WWWm Q02w4g,y,,m,,gDmW ,Www w1ggi3wg,g,'S1 'wgggfigvswgw55552111555hggakiw-Qfzfm gg"Q0:gg6fZ'52iSwggi1fv:,sZ4'5ZMgMZ?f5fiz?fs12'Qw1g,L Qiawvf-fzff?Wnffz222?E'PH227Qanrfmzifsgawwzsmiiisiwi Hs? Q waafzasifwwg Q , afsimswi W M22 smiiiww 1 gig W iwfaia W Wa -' Sw ,view 'fm V :fp WW: W: :sa 'S W H w 5 as Q 1 H 6,9 F S ,,isQsg8?aW5 ww HQ 221222222 ieiim 3236 1215.5 ggi 113221: Mmm 2251335135 52533 is 5133552 3323152 ' 151.453 Y lx Q J M in KM ,, A .wmwwzw , 21 Q M125 wiimqgggitfsi mil: QM gggitzmizh U A A lf Q 1.:g,-wfiiwwifwzi 4 Kwik Siiiaw A W .UL wwflpwil wiitflixwwvf, af A ' w'if3mMz:fivMfBwwW 2 if inQ1i1.wgg:N3g4g1ugs,.1M731-,11:gg,n 115, Uglggmggzgqiggggiwggqzzlllilkzi. gfglzwggiizhgg 2i':.Qg55Q5i, HIE,.w5werizmfitfviwzzvwmm11:1,QU wm.uz2maz':swQ::w awww mi ,W ,Swim Whz20w,2 wa Q 3 .9wQWw2.d.DWM 7 Umfvmmzmisw fa z X 'W we P 2 as WW awww" -Z3lpw2'ZE233q'zi'g bqgmhgssigligzgy, k .. , D U. Q Y: 11122 X1 wifi! fi Q fgwbwgw f iiiwiggw gyfggmwy , W W ' we Ns ezwswegiwgmsa H, , - fs rw? ' as we 12,5 'M ,MV Q A, ,Q ms, 2 Mmmqa' M weww ,WM . fig. , Wp1m,,. X, Nm be wvwmf M w1v1wm,QQ,1wQ'Hv'1 imma W 9 ' wgve13'fi3w3vM wwviggig wmmwwgyi ww amass? ww, qmiwww gi W 1 ,Q Q wmzfmmm K M ., .. 4 www? , W N 4 n Q if Aw ww amp :Mag ,Bmw ev EM, www ff. -4 5? -, W, 'ig ,www W A Q www ,551 as 9 'gg 0 ,w W S ,g ,Savvy f W v - Ywwwwm ,WM -1 1 :M WV B, Q W 53 329552 Siwfaiifsiw 2 Wf3i?i1sg55GgWEi3s01fW'fgfiia-731f115NS'llSS,wwW'5M'Wiwiiiiiisiwiiiw3261522235211xwixwswggwiggigiifwm iqigiwqmv, ,, a:r1,mXf1 aw zzamfizeziwag Paz, mgwmzawwifS1gsmW1f:Qmw:,xz,immmgmww,mamaW,,:,m,,4,fWQggm,,,,,M Wg,,,w,,,,,,w wiwwwmsw ww 'iwwgvv Q Efgm in Nwhiff15www,g.f1Qmmf12wwfww2Hw'WwMWzTf'12fa"'zw MMW1-QW 5141Qfswe21fwga1w:wwl14,.wmawg,g.mM,V gi 125g,Wiw wwwyi wwvggi Q wif H, gi:,,105wgw2P Awww wi ,,ggW,wMywmwgwmwwwwww12a,,w-Wawiwbslowfswvvw W:,.,,.,Wwfw saggwqwwgiawwsebfv , - ,,,,Wm51w,, 55,21 W? SFQMWEMSMMSWQ 'igewimshow mzfsmfmmw, Q ,V swWwmmwwmvwwg:xzrs,mwwwfm:,'1a,,mwM1fwwf WW,fsNmwwgmmmmww11mW.,,,,,. fw WNW '?e11wg:,i20ww1QP'w M Sm I4011wwWSm wzwwww'wiiiviswsmgmemwfsww' Avy,Mwwww1,gbliwgsamehvawwwWwwwW1wf,gm1m,wmwgq,,,m,,5.ms1N,gW., 1 353112151 Fi ag f111fg,,,,,,m3g1f1Ss' siweivix ,away .f11'1S,wiMwww11N M'MwmwmqmwwwwH32.,,:Q,,f,agfpfQw1wQfQ1,ffpfQ,, 1eg,Wappafgfszwavvgggswasiwpwgoqemzg,,5,w,,,mw -4,,,,,,mmf,w..ww1Wf ,W Q ggxxwiwigy ,,,m,gVgg,4:i.,ig11,,g 'flwgiw swm,.,,W.:mwmmmfzzphwfms wmmwmwqww,giWmmwf.M?gmg,W,5Q,W W0g:1ge,,mW,,W,,gmam,,mgWFQw?,mm,,,,QmWmg0gMM,3,,,,,. we 1 11 1 we siwwa 1 G1 Whsei11g2fv'9?SZfs Q w11wfwy1M1w rmgmazwMMffwf1m'f1w'1 W?mwW.,mf111wai,mmwm1mW',2mm1f1 mm Nui Qwmwmws-,g,,,, ,EMQEMNWQ 3,,N.,mwwEmwM., wg NWWEQ -if wg 4 9 's0mg1g,1z,, 323610, A haw.-MMS gwwwfw ww wwvmwwmWwmsm 1 ,,,,mmwm.m. ,, ,QawswamM.M, ,,,,,,,-wmgwww, 9, , kwmwmm ,E .mmmmwsmg dw mmm 3, QM MPNWM nf Wigs Msg, 1515 way 5 .vw WW 13221 Q,-MM? M Mmwfmw Q 5-wwmimmwwwww'Q'amemwmfmvwlmmvmwwaspwWmgmmzwm ww1w?w91m,5,ew,wpeagzwa w QMMWWM Pimmww.,,,-Sswwmmmww-1 ' 5 Q va, 115 M353 ww' gi M 02 ww, zmwmmmmwfrmmim W Wmwww,-mmwzim,wmmwwww1g,Wmwwwwmf,,W,9wwwwwwwmsmpmw1 w2w1,,W,m.,M.,swm1 ,,,.f.me-,ww Wfsiwmm v . my , W v W ,Q Q-wmiswe 4 M fag A a gf' S , W1 wewewwwewwwww ,P 1 M wewmw-ww?,1 ,Nu wwmwsmm., , , Q wwwmmfw. ., pwwwwmww., . li, ,,sWm www. . . ,wmwwwv , v -WJwwwsz1 , 1 ,sgww Q was w ash Www ew 1 1 11 wwwm' .Q 5 1 JS w.w1w1ww,, 1 wwrwmwm awww ,211 ,mmm-M1-1-v ,,,?,m,,mw1 1 an www-.Qwzw1a,,,, 1 Qwxgfawgplwow vw mmmwmsw, -, wamm, Q. Www, - i1N.2awx Q ,, Em, M, 635 gin g - www 2 H 5 MW Q531w1www1fwwsws21p- Mmmwmpmfa,,,,,,mWwmm ,.,,'mm,wwe1,,11,M WmmmW1..m,,, Q,,,m,wQmw. -Uwmwwmgww A, 1 M www 5,,W,M3 mm Q ,ew ,H N,,,,s,,,,,M.g.Mgsm,W sewffa 035333, We ,gvgfiilveawfggwgyi VE wiwdw W'WW'f'M3m"'1m'2WSWm25mnmww:1y,mw.wWww2QfsmzmmwfgwyzswieQ1wmpm1.0qsfw11m"W WQQZWQHMWSQSQQ 1smw.2mww1gQg5gw,3,0mwf,g,,,,ie.ss.x5wpwwwf1,Em mm-.Q we ,ggwdpdigggassww m1w,,,W sg FB 'Qi awww, 11 ziyyiimw wifwrwwww g1vWw1?gf2fw 1-1Mmammfw1Qswm ,WWSM1MWIWLWMwwww.Va mwmwmmowewg-,f1f1521m,,,m,w.wme1 11m,3,W.Mm1W0w.,1, Wwwwwaf iw,m1,x,.,,w,,Q,,,,mwWgmm pw .N W Www, QSBWN fgiiiwwg M wax 'SfwfiEgg,.,,,1s.gfw9vHg'gg,,,,Mg,g,,,,41,,,iQ, WQWWSQW wyisyw wgg,,W,a,,0aegwagggW,Z-swwg 1513315'flzwewsfwwwwgv lgwvswwewmvwvwsgaggf, 15, ,,,wQswG1s0gwg'2,? ,msqwwzwygwwg , wwmwwagi- m.2,1wwwwwwgQgXg ,,g,g,MwsswwM5 in Syn w , Q, 1, Hggwwpmw ' ' mf 29 MMM f A f Q, 1 ' 4 w S Am ova S W 1 r ' ,iw Mu '-1 WW 'ww ma ww W P0 , Www 4 11 Q w , Hwy-W , in ' ew W ,Aw 11 , Q, M, x view ww., W ,wap wwf- 46 W Q 'ww L v -, ,mea 11, mn . aw ,gvgmaaqbgas Maxam, VWHMWV, SJNSX wax,-.ifziwgwwHMfag?F"fmiVZf?57f12a'9w'2QZwwQewaww-,,,,'9,i,WwwM ,WmWwQw111w Q3Mimwws1M1f1ws1w wiiiigiaimmwwwamwf iifmmdmwwg' -hmmm,-MW NWw,,,,,Wm M549393,My,wwgwsggmm,wM.g,,,,R,.,,,mMm .sMN.52mw, W ,M 9 N QQ W pw -M vmiwww FFQFQQQQ-1432 55314gwwwewvivevifgmespwanviggbgg,weMwwwgwggigwemwwwwvMwwM,Wg,,h1mywgmwwswmvwm 4j,i5m.wsxmgv.f1gsgg w,,.,gmmw wwmmnwpw w5qg,6wW,,x,,2x,Q Qgwwwwmwagpwmuhm.1,,,,,,Q,,,,Q,,gQ,,,Wng2w:.sp,i,5g,,,2,ggsgkQW , 35955612 'Wf12i'ff2'2Sf2i2S2-M2156 .m....mmggz.z...'-we4119.5..W-mmes:1z.i2.-vw1'Waa1za1msQimi..mfaeMmwmf1"w'1ztSmm1M'gmzswi.wwwfggizmW-w'gmi::Qgi.M.W-wmgg.,.Wme'www---..M,,Q,Q,g:e..,. sg ,pxwsggz W 3,33 ,NME W gm MQWXg0Q222NiEe'lw.,Q,,wg'gf-.Ea aim? ww 25,4 awww vw- WEN W me M wwwwawwww fowmwpwgwaglgfgmws wf1fww1W33WWwmww wawllgw Nw W,mamvwwmaewgspvwgggsw ,1QQQ9QmagygggWggg.3glgq3gw?m,, ,www ,Wag SQ N, W wgsfgggvw WWWW 1m1PiegEwg1WP-,,,mm :1MNWfizwwmmmawwwsMQ,Newwg,,wwwWwwmmmwwmwQfwqgs,mow-.QW1-1Mgsgwwwnnwwwgssev. 00W,wwsmxw M,m,,,,,wQ ww. i,5,5M.WQgmu-161 , Ww,5,M,w lwwapwppqghwaap 81,1 wzwmw as 95 W Mww1W'msp M WP'Z9Z1sswwf1wfWizzWwwaxQwwwwP'1fg,,,,w5Qsm0W,1awwwwwwwaw9z1e:a,,,,,,WW-M aw-,vgwmawmavswsf2gP,,Wwwww1W-ww W.waQiewwg5g,,mm1w1wfw,,f1egr:,,,,,Q ,,g,g,,,3,45'gg11Wwzas,,sfwww: wgwwwk 519 is vw , Mid'wiiiwf...WWmamaQ:wwfwiVzzmbivm.Uwmwwwimfwww'ff'z'+,+h5ww'wevga,WyfwgMf"1'2tmZw.uwa'mfm1,-imgwwrw13hwg5,,LM,,Wwgag,-gsg,Q35,,f3wgg.,,Q kgggwwyowmgzawgigw away gum-.X ,wg - mwweWg:1,f:.,4wswQm01Ww1'5'g3gf-w.f1,xwxWwmmwmwwmwfzmmwgziiwwswyewvwgfggws fmmwvwfliziwfss swWmwwgwgggi,Mwwmmeb U Ewgwamwiwpgg Wmwm,Meng,M,Mgwwww2?ZwwWfWEi'S2 r gwmgi Bw ww, 1M,g,mwewvvgw,gggS,m MWW-.awMWmwewwwswwmawpffgggg ,mn m,W4,?WW,55iw,5w5Qwgi,1, ,,,m,gE,m,,,wsuvegmwsgmgwmvgwsgggzbggx,gwdwgygggggegmedwavqwgwpWQ5dmm,gM,M5gFii,wdW W , , fa '12 1ww.ww1 M M- P ' 1 V' ww w www we fu Q w 9 WHS 01 my , U, was 0 AW ,fa H ,Q 'mi an . , Q 1 we M N Q.. Q , ,ww Q9 wg Q54 my f- Mwxmsw fgfwia-f1 WW 1 My 1,,,mmmm.gW,f .ga1MEALmimigiiiiifimmgwwbwww wiM1-1wm2Wwm.wfwwwQ,1 Qg,,iWmi0ww1w1gg'z1,Www ggimww1w ,sgwpiawzwawasvnsW-.:r1v1wfWm.wW ge vw5,W H ,, , ,,,,,,,,,mwwwew - 1, 1 91 1,5,,,,,,,,mmQ wwwmmww ,Www,,4,m,,wmW.5fMfw.wM wm,,,,,m,g,wm .awwW,,w. ,j,W,W,.,W .,immw8wq,,,,,MawWWd,,g,, W WW ,f ff 'Nmamwwwwfw,1eziP Q1 1 MwmgWW-Jqwwefem.:NwwgwmwwwEwwMifM-ww,,.M.Ms0wwwwws1w , Xxwymwmg Afmuwwwwgg,awwwgwwgewmqwqwggwggwWMMQ ag MM Wag f1 , WMMfiizfstfiqfiyisgbZJsiiliesmswwwwwozfsWmf1mZlww1wewMzw'zM6LskiZ2Qz:,Z:,:1wmfmxw-111wW:sZf'iE5.Mmw,gdSwwz11111f4111'1i,g,gQ,wmfs,1..s.,a?S5Smdswmsmswww 'Q wwf Qiih 1 ni 5 M,6Wga5Q9iw12Q21wif:Ziii2imMyWQg:5a2w11z:1sii22ia1QmWM1SzsaqmwwfwaitzwzifgzswimmwQiiiiiww1ggm's 'wssgwagwwwwwa:ge3wwSwgf1wL'55 N 9822232 W wel W' Wf1,,,f'E5wi2.,wwss1wg1Z?EsmwgmwfewwfhwwiafvmfgwwfwwggsgziimgfgwnwwwwwfggggmwamfwsgwgswgggggmzqaggggwxmvggfQwggsiwww wg 11 Q4 mm Q Xe, 1 11-m,,.,wwww1,431Ww1,s,,m5,Wm.1mwwwwwwg ,mi mMw,,5,,,,,?,Mw:bfxQ3 , ,Wmwwa ,,,,,wfwq,,1M, 1Ni,WM,q. ,MQW 7h0QWmw,,,g eg 52151 WM' www ,WMW1 awww- Qmwwlvm,Mw1ww11w-B11 13 mpwWwmww.1w.m ,Wwe-.iw,,w.wf:. ,1B,g,,w,,h ,fmwmwa M1 W ,um K' Q gw swf ww M1P'f4..,.Ww24Q,,wWw2ww wwpwwwsvw?f1?P,32.2wwwmm gxvwfewwwqgwwa ww waswwQQ,,,,,,,,gg,wg1wQ.,g,,,,w0f1e1wgMu1 1 M3 152 NWS w2,: 011wvMf1w:,ffv wwf-W:15zi,JQWMQWMQQSWMSWQQQgwwwwuhwzqwpffd ew ,Mm8mg1s1gw,zzzw:fsWfW1: 211 W S2 5325? ''W5ffSEZSQSZSMJSEMQZSQEWXQHMwww,Wmafwvlswggiwwwawgsqwmggeg,eg,imwwswbwafgzwvsdsmwssipwmpiw gvgzjiiwii may 1112Wwwfwwwewmggggi?ggf373,351351353,as,WQffmfg,1:52,:QB,weQggiQ,gaQ1133gmMwmfzggwglgggqgggf fwwwg M sw siwmis a5Swmf011s11g,,,,,m,Me1gw.,Q :Meagm,,,,,X,114,ggg.yW,,.4Waasw-.Ami fs 3355. 151221 WWSE5 UmwmE'E,.5ewwwWf1 Wswaffw W-Wv2f1p,w44wwwg,, ,w:1wwwm,-awww V 'S ' Q 2 0 bkwglgw as x widafilfwgig- ' wwywl QQMW5 gum MQW,-.? Egwgwm p'.i4-mipmw zgggjgaiig 535 , , M 1 0,12 1 WA WW, 'wwu,w'1, Jliwm gsmm, ,-5 2, 5956 W, wi ,ww ww Awfwvdwwfsf mspiff A G1 ww ,W Wim MNM QM ,, , ,, Q Swim, ww, wiw, mm H- amiga mwwifb MSW 'ima WML Q rigmzrfm xiii? .1 page-1 mix: ybmxgwf fiwff M1210 Q wa gggw gf wma, ww ww, we f me was ww 3,24-gggzwg img M, ww. . W Q M, Um 1 .1 was ww s 1 W1 fi .Wm gin, 11:.:f1 532534 :Q ' 1,550 siggggbgiiat' 25121 53422: 5355155 . W99?iZ3 gggosifsgzw my ,Wg fgwwessf swim swam? ww 11112 ' gggszzw :am ' , any 191 iw? 4 ef :wax asm E533 Mad' Saw www W Swz 5, . wk, ,gm ,ww 11 wgslgw ww H1-1, M. Nw 1112 11, W2 aaa? ww f,y,:,,,,, :ww ww ww gm ff wow mmf ww Wm' vw.1,,-.6-.af ww. ,,, Hwy ,WM M1555 gmgzwgifs new K ws: 221291 MWWZQZJSGZ we 511111 magma :saw 1 mai :gm ,mmm ,mp :emi mm 5335-Qfzmziif was wif' is aim-1 111521: , ww ff gm Wm ,si ek www fwdw N ,WW 121 Pa, Mm Wwszf 1 :am 1eg,a,,,, , ggsik-me 4 MW aww - QEQQPGQ 'ww wwe: gm, 'wif zgw: 1 was 52:22 11 simgw Wm ,Wg ,am W 1 Q, ,S ,, W W Q 51' SEQ as ggggiiisgamwwge H bm ,ifgggg 5656235 5 ' K' wwwis ,, as aww V new :mi 4 Q ,ww 51. 4 - ,f 1, W, ,,, M Q ,Wm 4 W5gfg?EQEEE3E22E33i?iEiiE555eEiEi1zEag:.:mgw,,E :Zig gi-535555 2 fQiggm:mg:Qg2wg31Sfgggfsgigzaggzmggi Q , mai ! , 1 M, ,J ,f.0w-105151 1, N, pw A ,, ,gg M, ,L 59 w, M4 wmwgg, ,gf QQ F MW 4 2m,,g,,,,,,,VM 52225 ! 111 wmv was ww Mmiawii Qmimeegw he1mzm0.,W,. Www1M1a'sz'Qi,1mmswwswwM-1wz:2f.::Q,W,,, Mn 1,gksS:2,?11mm:Qaz gigwiegimezzggsaizsqzvzsgasiii5211111miamiW:52252532liisgwgiaagzgffszfsfzzzzaf:ms323:12wggsiziazzszasszzm,,W ggggagggi ,, , 2112esQQ,gigm3522322255332211iwmai222525223,gggl?11gg1gEQ2s:::g1:i::'zi12Qgisgifiwf5fiwm11111g:2az::z:am:a1:21gQsg1ww ,W ,amz new 5 ,, H ' hw me -1 11 P zyziasismmq za 41114-.mmfw 11 3 z,,:,.rs1 323233 1,MwiQ121:2s22mimi12221zigaszziggsssgiwiiiif?11ffigszwssgzmge553255115121gaining:zsmzsggeagzezsisas-g-m,w,,,,,, , E 2-1 ' 'MW 2'W"'m2fsQ mm ew wwwfwikiiflhiogmwqg hw: M 1 1 Ex-aa,5waw.w,,s1fwg11fw0M1 rw zf1z::Ssw2.Wm:gggwywgv, W M f 11111155 S M"M"M1f1w1111'Mf11mS10:'w21"'iMa111111f1111www:sawa'i11i2'M"MwwwwWWafz:'2S'2::1s4'z2mm-.MmNwwfi::zf::x12sa22L5as,.,,... iiplffli e 2 321351 ' A'Swfkmzfgi2Z,fs2S'2i22iS'11W5S'Sww11mzgisszzzifaztfimiimiwQ1swwggLgggggsgggggf:f,gg,g,,g7, V,,,,,Wg,m:wgmggggg,,,,,,Qg,WV WM V mm My Q11 Q Nm, 1smwspwdewwwyvfwzfwgi 4 msaemw11wws1fgw1w'Hg'k,,,,,Mf,5MmwM,yw111-1f1g':,1i,.,,,5.,,www-1wwfwPg,g,,,mw,0wMm qw 2,1 msg '-MW2zzarzmiaiasifiwfwowymx1gg:1ygz2,2'22:13Q2imwg11My10z,0gWfz:msmhsxwyfy111 .wwegggaatgmgivwwwaggfm, 1,2.m.,, E fa J ,Elin ' ' Ameff2ia2'ia:3.,?2 , 5-.QimamwW0wg40:,zfge,fzP SXSW'Uimgemawaiawgfggg-1fis,gQ:YMfa'2211wwwif:i:Z,f32,'gi:2m1m'3wf11H01hf1rg1q.,.M . 51232 as U , 3 Wgg W ww ""2'Z:'LiJsmwwwQwwgzgvggfgggsfzst,,swimwgwwgvgggggggnrwgMygmgwgghgggggg,ggggg5m,,5gmWM.,Q?mgg5gggg,1wQsg,ggwwwk V W vm ,wmv M -Qmwgmmswwww P , B qewawawwuy - 4-.avawpgaaa Wa Q 4 . N Q wiggosame, . V , , WW wb wqww.p,, , aggw was 'f 11w11fss2sS,zi2i1zs::s,2s,wM Sefmiiiszizzizzgwswiwfisrifmztfafizztimwfrfg,-J, af, Q21:mz,,.,,, 55515523 ' f,::smz:,mmmE: 1 aiisigvf W 1' D W W"wW?'W'wZY mf W1Mm1"WW"f"f7.MQ,F W.MW1fww111f1f:-3,211.m4mms.,mm ,mm is was s mm , A'"gimmewwwSWEWYZESSZiwwwsww.WawQQQEESSSWZQa0sQWwWWwwwQw' www wifi H? 1A1fzzazezzzzmwsseviQFwgawggwgzzgwmmmeNWwggggmmggqgg ,W :SWE sms aw -1Wwwzwgg1zfg,,1.1eg,,,,m1M1M11-ww-1Ms,fggqf,1,1g1zgg:.,.:m.,.M,,,m Wag W3 1 W mm ,, .14A:Awgzvfziiiiiiigasiwimgwwwggwfmggsgggeizz W www,11f1ff1:mzfs:.'w12,eaiaamgamx M221 1 f Mm f11W,wi,gZ,,5,Wwwmwwm-1mf Sum www ' A 3 SIN QSM? M gg Wg ' 'Sky ,mg 11 :liz me me as 3' 55593231 322559 552 ,gwgwbggs 1 2922? 22 2 P. ' , w 'K 225323525 1251122521 zgaigzazzs g 0 W we 1a,g2s,2i 1 252 1215: ,Wm 11223 alfw Y iam :ms T533 fa, m 122356 519,23 asm 15232 m 'FT' - , 41 iam gi Riga amz f 'WPS W. A 825' 'MWQWMN , Q Q ,FyMggWg.WWMW Q Mm 'MSM' 1--, ,MW Q ' geek? P Q 5565111 ' 0 we MW 9 9522? Q3 igfgizsissaiifg, dwg is we Y 1 2 5, 5 fWSf5i55?ii2f11s2 awe Q Q Q Wmuw N gf is N 9'51aM.QmggQ2X,bf5a Q W 2 N 'EQ w1Qf1"2Z4'Z'sz21Ef up Q w Q M Wmwwmw 3 ,b 1 , we my ,W , v fs,a.:W.m 0 ,gwgfgg 525 Zim agen ., 5 sw 355 saifffggigiggmi 33335 N may E"'Wgw,MN 1 gg WW 0 Sa 1 , ,mg 3? gg P 3 5156 6' S1 22,251,339 9 P wi. 5 6 5 5 9 ww Q , Qawww N wg M My Wa S my ' 'W'wfw1mu:z,,, 9 'L ' . :a52. ,. , '111 W 2, 4 -- W 0 1,-. gggagygg -f10i,,g,i,4m 5 GEM Q was gs . W' 1211-'i4ig:Ew1G1e,aii:g2g? E:f2Zs'f:.3E5i:f1E: M, an M ,sifzzffwwg , , -- 5 32511 ?f:?f1s:W,g,a:Wg 1 , ,, ,Wa Q ,,,,,g,,,:,,g,, M 111, 1 5 2 WE ,S ,S E4121aim,,igQ?2EgE3EggE21g,E:g,1wgam,W5 M M si QiWfM1W51if2iSgE2iEE?,EQ-12,1,WQ M www, ,Wage mwwgpuwgixrg 1 W " 'm31f1Q?52aaf:m:., ? gig 3gf 'f'f55 5:. fl ms., 1 W Ag Mi WEE M 3112 211 Einar: MM F a,,x,m,,M,. Q iw A 5 M2 W if MM 3 emi e Mgt Mg, ' daSi 3X 15szEm,:1zf1wsmss12w11 Q 1511 A .. J , , ,,W 1sm,s,,:ixmsM1fw wg Exwf 1 .MQW .-... Wm mgamymmgpwgugawiwwgis, 1 iq. iw My ik-v fdwggsgwwgviwwggvg 222 my 5 f XZQWEEQQgsiiagigs,-iw4i:1a,sQ:ag5g wiiagigigm , Qfsmesfaesgsmamgziiffgiaigwgiaasifvea , ,sw ,fe ,M if 111111 -ami mg 5 Qexwmasam W miami? Q 2 11 1 ,,m.a1'1s:?zsggm 4, M 4, 1 W1 wsmbsdgam ' 11 sez fa,'45SE5MW5E:1fz1fL:2m' ,, W 4 :iQ?5ii35iQ,gfgg:9ig2zEawz::: MM zsyggfmfsgiiifmzzmwizizsfswgisigzifeizge Q1 'ff 21,5525 ,sz Ez Nasa ,,mg,m,,,M,,,:P,,,, Mm 6, ,Q iwgafiiwzw2223ei:12S11szzafmzugiszaszsiiszws 1 E 8 D 223252225E23amiiiiiiiiiizfizazsizzsmziziw , od of Q., vwawgggagggigggiifgbigm , W wsgwa ww Pwfiiamswa 0. 9 1 if mg-rggiifsiiiiwgglaggggvggggzlimfaww ,mmm 11 ,wi 211f1n11w1z2:m1.z::f1ieww M W21m1f:1aszv,::e,,axg Q Wm Qnwwwgk M, P ' ami, iam 1' - ,Milf 23225 525:25 Mm zz: zz fam 221 21 Q gig Q M mai 553121 Q ag mm s:s:,,fz,s1,rz:'sa:,3,g,,,,,, ,ag ,, 1 ww: 1m:ff1:Jz1w,, mama, P ' QW , wf11wwaz25,::1azs:z,aWg, 1 2WW1f:,z,zm,fs:,:z:Q,W.,,. ' mg, "'Li'WW515:P:Wz?4i?z:"Zia.,.,, U EY' '11 2.1 1v1m:'LLe1::m., W. M' Awmygogszyzfgf:1z,gW,,,. " w1111w1111f:,f1f,yiz:m,,W. ' U Slilwffiwi Sziflill ,,, . W ' 'wH1wm,Y'1:eLZs2zi'3BiLawQ,,N. ., g,., mM,b,,,,wm,, W 'E' Q xaa W1 1w-:fs w5g.siZgWm 9 'WW ewan w2W?511ii2fzm W ' ' wiawwwn osgggg wash ' M, Wwe: M Q MA bawbffgjyggiwow 1111 12 1 'Rig E ' giwkgszzzzzeawm, W Qmzzzezxzzzmm W, mm Q f"i? mawwmsew. , ,, ,MQW mwmg mm. M, ., , , K ' ' 'ami'3'5BiiiMWw , , 1' 0Wf'1'11:fsf1::aMgg,, Q, M, 'M' "5S.fm-iw Swgfawwvwb b ww "m"'Qi121EMQ . f 1-1 wf1fW:4gMg.H5 Y 1 'Q1' Q ,WZ Z., 1 'fifywl .g,s,,w,,m3-MMM v M Q' 'ef 12 mm, fa: s1513mQ1?'i:'Z , M F F . i iv? x 'W 5592 '35 IB 'Q W M ' V EWM22fi1'?iB?5'1E'5'i:EE:Ezizzvamw 1 Ziiswv Q MV M, 2255.5 Qiggiaigigisiggiiigg an 6 1 liimw.. 'U qwfgiizeiizixzmaqgw f ,WNW ' + 9 5? we s we is MW, my M Q aseffw 0 M. 4, M1--M,-.Mz1az32.fs'5,i,m,M 1,,,,,fwz:':z:2,,:s,aN,,, Q w ,,,mfzzziiiizigitQzzmsm, 4 ,,,w1fzzw .W . .wad.kqezsiigtxzzaizgeiwm ,gztzfzzfazmggm . 3 , mm ESI? 2212 mug 1-1 me 3211? wwf 3 IEEE? Qiggzzzzzw " U . P g Swv? EMM . Us Q Wim fa, 111 M-1,,,,,s,,.,m1W 11 ww Q ww ma ,sammy , ., , Q www' ,mm .,Ww5gg1gw1f,g1g:,3a11Q::,Q .,.,,.M,wf.m:mg,mW 5 ' " Y' ""'Z7Z3wiQ-ILQEZ U qsapgauwawsig w if W X? Z Ziimlrz mahnwfawwwaamg, , g 9 M A awww Ln M' 3" liziiwlm- as ww M gmwgggggg 2135103 5 ,, gms Q A . W W Q ' iw Wiififtsiik wsivgzt 223532225351 v M 3 1 1 1 W :fs we :Wm 11 1 11: A M si W , wma 11 f1f1Q1:m,w. My hinmwwiixsg new ,,,,,,mMWm 'as 11.2122 :mas Q 2 img: V 'Q wif W" Wsfzii X13 11522.12 eww f5f12Wf111f1:1f::,,,,,,,z111ae:v: :waz Q mbiiw ww . zmsmzsmssvzwmzme E "Si?g5Yl"12?zET2EliT1sSiiZ.mw., sp immWwm,0,.,wMgg 1111215116:,m:m::m1a:fs,f, ,iiaifliykge 'ww M assays W Q, W 1WQW'5WZEZEfEiE5Sf2fiiiS355u55 wzz,:a1:,aa.,mm, 1, ,Q ,. .imawsiwwHw?Qv2ZZ:1siZsi'Smvsg .,,JaJ2'iai1i2'lif511?41fi2fzf1:z,f'11a52'25t ZMGMiiigiyfiimfiiswifyfivgglgggg 1 , M ww mgw ff ,155 Q M' ww, PF,-.6-.ww 11 fsimizvisszziifiiliiziszs 9 Q ww? ey wwrgi 'Wi Q 'X 125232293522.3Qsew?1iiQmz:zs1 ww ,gm mmm, 1' W W W ,rzzazzswy 533 mimi Q - ww ,, W ' W W W H Q msmomfs, New M 1 afgiix1isisisf1ww1e11,1w::::,w,ssWm1g111g1E:::p WagWQWEEEWQRQsazesaagazgggggiigzigz SSN giiyismwwiesww2s2Sfm::Qg1mi::Q2Si1:,,: 392281335:222isggs:izs::w1iwg,e1wziA2!zM:Qwgsim M1311 1i1:La1:J:11,,,,i4:Lm1:sfsmf?mS,5 wi aggggzaawsew SEESQZQSZZLQ5 iwwmwv WM ww ggjgw Wyfwggwi iwwfwwawddsai M Wwe ,zzflssiiliifiwggfgff 52323228 my 1Q2ES2if1'2'1151125?5121siaisveizizaems,wffzazaeisw 1 W' 06,-.ds S at awmvevas wi? ' ,, as 523154 W ' at sss11ii?2EE:EZQEQQEQEiazmsiwssziiigvgigggis:::aag,m,,,, Q W12111121W111f1mf:,:mmi,:e,,:1,:ifs,a2f12 ,,.,,,,.. , igmwmzmifeiw 1111wfw1mz5mssgwazfiszzaissxgwwiaimzwg:www11 1111111 :1 7 wiiw wfzaigmgsszwazimszszszwwmqgzzswffmggzefzazzs Q,MF9mfsaiazlasfszmzzgmu 1111552 vm: M, - 2 X AJ K? ' Q aiwwwfw M wwfwf Us wwf 11559356W?'0iMfww21wwwm.,:fzW,:a.ww , 111111 52,1 MW QegfihNwgfmiiiigigiw?f1wm21m51'fs2.im'mQEEwg,1ggg'3:, M.:1,f,'S,z,2m:aif, asvw:wzafamsfiizazzzaaazMM. 1 my gwmfsawggg N M Digg, gf12ggg1,g3:11y,,s,,ggg:3,2P pgsgawijaxaapsf wg 5,2931 wjssag Wg pg mygfyowg g aa, Q J...,:'?4r3S'QaSi.Wwwww1vfQ'553'i3,1m1f11 ,. my 5 ,, M L , , if Masai. , sgmgw Qomwsfo sifwqwwgsdgfvgwwglss wow Nw W 153,33-gggwe Www 2 wwe U Wm: 31515451550 wgz5gggga1gg,gg2,,,,pwwm mwm ww 1 ggejg ,5gg,,,,,M M W. ,U N ,, M Qi 1 , , , w M 11 ww MmmS1wwS31fw W S 131' am! my W,-.wr-, .Wswm W 1,WmMwwwme-MWW.m,m,224Q,,W Q, WM M W w11w,fgm.1Mm,Nf10'1P,,,4s1.1ow, Mmwn 1,1 5 5 ,W V. . W ww , waive 31111 HW1wwwMw1H Mya, 1Qsswm,:,:iwwg1g,,mwg1w0f1 wewwmgwfa.WWwwme.sqfmyzefsww.,wg5gw,m,Wqbggm, y,,,,wg5mQgg,MmQW, W MQ. 1 , mgmgfggggmwim 22152352 aw, iiiziimww fiimfzixiifigiiziiiisiwgiw, :Sim,zmmzimwm11g,2'i'ZEZi:'s'2,1.mwsxizirzmzwa110114111mwzfszzziliw1M1w:,z21i2.,W11 -1 9 2222A-M1111111111f1waa:.fzzzwz2,,,1 4 ww ,1::m,,.,.aW.,m.,,1.m awww sw, 410563 W-was X lwwfammzifmswww :1 wg fwfip ggi: WWQWZZEEQ W we gigggggggw ygipgw m5i2?.?s:MZ:Z,sww1f11 wgigi' fsg,1..mw1gg?'1'g,:g,img,.w .1 1 v ,sf :K 53023: ,M 0 s W Q 9 1 gmfggggzggi, , Q , U 1 gf, 1 ' ,fggggggg gy 0 yy Q1 am gay? 2212212142 ma efaiimiii assiQziz22i2fQEE:ggzss,zzi121QX1igz :,mm.,,,,.,,. ,D I ,sw:,,,,,.,,::z,z:,zg,,,z ' 2 'WP ' 1 121 W fa 8 Ji eiiwiiimtgizizvrzggggww Maxamwmff1ia'sQmff11215155521MQ,.,5WwM.M,,.,,,iWaxalwliriiiw1M1Hfmzzm:a21M11 samgwvwwgazizzzz ,Wfm v gg:1z:a,1,,mM1g ,mWzwW. ff M153 1' W 122 gs Q 1 1 wg weawwwwwfwsnam-111 ggjiygsqw,S-wvwfggiwgwswwgwgggqggfB11sggggaggiggiizigtggggggggaaowww-.UQww2aP3.ggE,'TZ?4'1wfanmzapwqggfgWien5ww555,122355meMQM5WEESEQZEWQEQWorgeSwwqmpqwwggyfgggigqggwzy ,Ww1a1g,vz2T2Zim,mL,,,,,,V D W 4 1 ,QMMQww5.wwM2pf10gygg3g 2293222 me?-wa: 32if:Ssmm'224zZ3iZmmmSwM?WgSzF'??Zsww2wsg52w552m11f2,1Qgmmgwgfqmfgmigfifmiwzfizzziilibiisom'fi11:zPz':g:1?3IMQ1g,11tarZizfaibsmfmg Uwzfiziiilziziiys531511221222 Szliiizzzzzmg :mmgfpmg,Qg15f wr? 1' mymfmgizamqwMgg,g,L,,mm gggfggggggggqggf,ggggggiswzMg, 33222221 22335515211 minkm:ii'f:2P5v't'2':SSSSU1Sv555"if:12vii?w'ziSs5uiwmiimmffffb.mzzziwez:am2ewsiutaiiitmiwvwtszr.dmvgmzifmiifsiPMiwism::,a.wwmimzmmrmiiaw w11gg,:,g:z12' wiiwgmfq '11z,,a:,,WwwmwmW,,mg 1:52231 mx 12an:mai11i:.EwE1siz2z:'e::s11:w?9s11'u11Qwzmzy-Jigsawf-m.z"2gSw:'w-.1mmw.mwg1fEiz2'wx.:siibmmzz'Sig.iE.m:a1smmmsimzsz'1.:g,..,.',1W1.::g1w5,m,g,111s,:szj.Pwruwm1w,gg11,1.'.,,,u1 ww 31. Q 6 , vawv X3 2 f. 1, 111 wa, , 1 mm m ms ,1 vm, F, , 11W QM, , , 1,,g,,4, wwwwswafzsz,vsfzshg ,,zm,Qm1w1 11 www, 1,1 1,56 ,W,1wff1, ,,g,g, ,, MWm J, ,W Y. ,gl gh mmm SM ,m,gMf,, Q, ,, ,wmW,,,,,,,,,,,W ,Q fwxwvff 12,223 11 12242221236-aiiinfi Saute? Q51 LQGQQQQHSBJQ' fiiww 01 M wWgfg22QwMw1 W1 W ww? igwva me mmm mmm 5, gmmmivm W M 111 Mweig m.W1waf3,fgz,gW, W wwmygg3:m..m,mQmgf5gz1 1m.mMWww3 gfxgawwwa Vwgwgggzgggigzm mggmm M M 54342, 912 23012323 11914 M M-w1W fiiwzi gmzgzzxamiiwiwqhmmwmwwaggwai , ,aE,i,,,s,.,MmWSWMpgggwogggggwigiwfgfiggggwqWwg4m,,wmwegyglayffzyiwqansikgqgsiwHggwfmggggfgg,,AwwwggggmggvygfmQg,ggz.w:,,,.Wmwg19 55,15 g,,2.m,m 5515gggg,jmg.m1w1ygg:,g,z,,.,Mdo,gawamagkWmm?,,m,,,m: .3-.,,5,:1mifgfwwfggggmwwg swws491ziwggw12MPS?W?g'i'Z"f w:,1:z:a.,m,2:,wsWsfwgwvisrzitizzgziz,wMww1zz4wwfggiifiwf1g111::mzmsamzi:z:zmmszmzzammgfifwwnew,mm11ww,,WFWef113m:z,,s,zmsfwigffgagzgfgz w1ggWg,:,,Q iw wz M., ,M,,,,m,0m ,gig www asa wwww 1" W2 aw im! ww .www w'i:11iiia?g,,?.sSQ,SfsQ'i .4 gsgwwygspwsw we W , W, aw ew , ,ww W in ,g,-.www .Wmmsgwsswsmpwmm W gwww. 3 ,MNQw.bwf1P3-gggwfwqyszww 1, W ,WS W Q iw W w5wm,,,c,,,,,.w31g ,e,,,M,,,w,,1 ,mm Mm M Vw W my my my wwwwwm-Q.f0Q wg ,eg,,,,,.9.Mwi1?f:,.,,, as-mm' for am- ww, ww efwvffh ,gyms swwwz ,ww ,ww ws Mminf' www M-wgm wma ww , Q wwe WM, ,ww WM, 4.,.,,, wx, wswgwwi wweWW,.QmwgaQq,w,nw1wEg9M M W Maggy , TW, www an , M WS Www www. Mid QWWWUM N. 52 MW Sw M,w,m,,.wQ ,Q ,,.w,N,M,,N,M M. WM, ,,4gM,,,M,,w,,.m el W wwmgqxgg at Shzipiziefsazfxsawziisi wff1.,0W4,gyfsigfwigiim 1ge,e,mza?2:2mMEzz11,s21fm.gm'::2mE1151f mzseifsiif mzzieizw1Mgggzzsarmrewimzmsz21212121112111e,Emz:g::::1zzfs,z::zwww 11 0 . Nw fs 1-MSW ffwflifii .:l1i2m"i2?:,f:s2,1?.20 24-a'?f 2'1" Lziziiixiw M swflwxeiv Mi? wi.,-.,-.W-1wgf51 mwmw vw: kdsems Salam gms ,np wggggggfiwii ww? my ggggmm M 3wg1g1gg1z wg M.gvwmggg:e,.,wmgjmgg 10 ,q gl gg Wmgsvmwmwia aah wowmimizgr mx mywgg5s2s:,:.igg5gggg3ffg, Mi M51 iirizhww Q11 mL3w,s,,,,,m 11,-11111112121 all2a2as2fs,,1,,2fi1wf1111szm'im1ff'Pgaszm,m,mwg,w1111faffszzzfz1'1:z:,r1::a2m.mmwM311W,,,,x,,,M1mf,1:i,zz, ,12,,,2mz,.,,W1g111g,a,W,,fw13fg,ggi,,,,,,z,,,,,W,,,.,,,m.,Wm,miimgiW,,m,mM.W Mgm t gates wiivitkiimiiizibfiiSiswiwfw153:zvam:e',2:f:2g:,,EsizistiiiaaymziiyiewmsismsmaM1W.,-MwggmlfwfffmWflfimwwvM?Zfgiwmwszfz9.:,,g,f.m.,i.fww1w1wWM16zsiQ,EaawW,, by ,1 ,WimWw,.wf:,ZZ,EsQ,ww1gz21 uf: ,,Wwm1p11wf 1:33131 gg 1fgPwf1w1,w11111f1w11w1wwwgszzm. ww fi .meffggzagi QM eg 3,1119 1132: 2 ',5.1s,v.m'w"m ii aww wwwioi Q-Jews we fswwd if Wg W 1 .ww ,Z-1 - M W ,gggwgmgswm Qmwwgma wwf, gggw anywffggg,,R,QgMmfsww11,1 :Mwwgggg,g,m,mWg wmggfwnafbg 9 pw ,www W wgwgmg ,mm i15g,gg,,,,,m W 233,115 2 ,Q 11 N' 'WWw"ww3 esiwwagwmm N ww , :Q ggi M 1-W 'izaswwfzyli ,ZZWMBM wwaggwww we ww ww H1f3:,gwQww, 5,W,,,? oizzmim wmwggfg,Q,,.mm M, 3335 WM Afmgwmglggmgaiff Mggmgiawaw M53 gggaamw 6.31 www, ,mgiw ' 'W wmzwggfgw Pyge Mwovegfagizgf' W Wm www aww 1 15M,mmwmwMwuf-wwwweww11ggg,gWWfg w11w'11H- P ,,m,-M1 w1w32f,WNw1w'1 -,xy .,,.:wQ.fs.,sQ,Wm.f,sm as ,gi-1 1 ,,.MWms,2,Ps1,,,,,,,,2.,QM0g7,,1g,, .Mm ,WW N M 5521? , "WW Y P 'W 1 1W11m"P 'Z wg pwwggxs is Q1 .W ,.,,,mw2 v W2'WWrl . ,,.,,,.,,wwegf122l1iE1' K M,-.MmM1g1 5. ww .fm1mw'2i W WW M: pmwL:Q.,s.,,0.,.,pM . ww W W rggg 1, .M wziz .M Qmwz: ,Www W WMwzimfgznwziifswsaimiififbw wwimd1f1w,1::::1::,2:zzz11g,afsi:wf: azz,,:mS11s1 11zm:,:,2g,i1,,, fwfggzzxiw Mwmzzzzsgzg,WWeWmammmm.w,Wwgg,g g,,,,,,Wfggg,g,.,,,mgm .,,,.,,w012zNig,'Q3.fA-.Mwsfweiwswapgggffigiiilyzwigmmmwhenwasmyv-,5'b,ss.mwwVm,W wwgzlizhsymam21212325,Ssmmfwe-.MmMmfmmwwwgwwwgggqgswspww 5115 gg,?,,m,4 wwg3qgw,Wi333 iam .W .Wwmwgegam,m1g,,,,,1Sw,m ,m,..,..MMWwefmf wig, ,M5w,mWW,,,.,wgm,,,U JM,,,.,,Mg3m,g,,,,,M,,m mw,33wi.Wm,,f,,,,,. .ZW m4,m5,,,,,gg ggwmwmw Ummm, U D mm M11 WWW' ' r 1 -1 MMM-1wf111111 Mw1fW 1151191111 MMWW? 1 , ,,,,,,,,,,,,mWW ,gf .W ,, gl m ,1,m,,,,,N.,,i m,Mw,, 11,,,ww1112, ,Wm ,w:1z11z11W,mm,,,,ww,,, W1 W ,Q W W ,mm,,,,, W, me e,m wg,,,m,,, ' S1 1w.1is1w,1saWml-,VM WQP11-we awww' , 'QQgmww,mw.Msf2w1 .Wim,m1w,wf2,:,m,.zQ W QwMQgwQgM,.fW fa as ,gym 4, ,FM Www Lwmaumwef w,m,,,..,9Qw Mgw, M, ,,,,,Q, :11f1f2gg,1g1ggz:11gg Lzzzziitmizmwmkj gegegizzaeszifggbgggg , M . ,, Q s Q WlB"3gZ'i3w5319?fi+sspmwP? ?g'2YiZ"ZZ35B3Jl5ww S H za' i?fS51iZZ3i,'QiiZ-151133-XE U U F U we vw 52352235635 M-.Mwg-12 5 552211 wwwy 135333 in EW Q ,,,WWwe1:weif-312E2:55s2:mi:a?a2i:s1QE22l1?311fi1 Sy We " Wf1wazfn,25:H,2Y1G44 SNfw'9':Lw55i'Spia,fQ ww 111 15223211 liiwwpsn w..,233g3Q MmmQSEXTBEEQQWSefwzawiiiiisaipspgwW-.pf1wf1m2i'mm7 'A D W 'W'21s21lswf1f1wf mfmzirfz wa: New 1, 342 bk Z ii 53 W M if gf if F, fl if Si M Z2 as M 5? Si E 21 gl EQ na EVE Y? WKSSVX viilmiw ...mm 425335 . ... mf N555 pw. 11. em WJ? Q., . I' :E f..'.: 'I 3, :Q-55225 35255 ii: .: . ii.. L.. .::-.... A ....,,., ...,K . ., . N -:- E . 2' ' ' ' 55- nk f Egg.. W ...... ...,mg gm I . 2. we .1 W. , W . ... I . Eg ::: S55 :.'2 mg..:.-.:.:..:.5:g :E-5:j:fi:5:' :g: -. .- E' -. .. .: :.: .: .: :. ::':?.:.,:, .,.., ..... , ., ., 5.5.5 5 fi: 5: :: 'g IQ.-3.2! i 2-2-235.5 .22 g?:'E2.2I '2I :f'-.g'f:f:gf 1" IE . .,... .. ....... . .........E... ,.,....,.,. z XQELM , 4: 3 .,.,..,.,. . .. .1 .- ....... .... . . ..... . H t W' 5 'Q ' 'lxfiw W5iNwfwWt31m IE E' . Nw3wwE?fsv55NWA W2 Emi Mmbiw x igww wf3m1QfMQi!"mi3fw58. 3f -EfIfE EIfE5.-. -. gm S I ' QV 5255533 NWS ? :I: :I':f 5E -ff 4555316535558 9N'f'WW' , y EI'.IE'IQ:.., VWTSWM S :5.E:" 'f2 .. -. ..-. . ...-.. ..-... ....-. . H . 2 In :-I .. Q. W .:'..a:.I ---- - ---- - - --- ' 2. . .f 4 f I-I- I.: ':'::..'.:g. 'we M 2. uf. Q. .-I '-"' - I--I-'I--'E'- --QI ------- 'E-gI.g-- -.-.- :--: ww. .S I 1 ' -"' - :.:':::w-I:I-----. I . 6'-, .. If 'Si SX 1. ig Wh Wei HW . as ww? ww ww W QRS W 32 J I .I ex ... .. .. I SKI Q mm 1 ....... wggm gs, ... , W. M.M,M 5 Iv gg I I5 MY I .. I 2. fm. . .......... 'fi Rm' igkhias Q . ., W V2'f5i,. .FMQNEE . wwww mm. Nflkifwmg s . . I QW fffqx Q. . WI Wm. Q 192 aaa. W .X S Vp WNW , :.... Img.. ...... mW..wg..ggggggq ,Swe.:ssss.?2s1::sss2:, YIIQSQQXQSQQQSQ Wzmzimsi 9255232:i...IIIgIiwwmmSQ3giggI My .g.iV ,gm,, ...,.g..g.....Newgggg-NIL. awww 3..?.5mmg...gb QSQBXQQSFQSQQQ ...,gi ww ,.,.5,.,.....,i3..3g:Q,.Qwg.,,,.w.E........g..g:.f.f..qSm.........X.,3....,,,,.W,., bi ARES.....Q555....,.g.......,....,,,.,.,.,,,ggg,,sv?....wg.w,5M5E ,...,...,,,.EiEg.3 .I.'7II" V W W SW-fbfifvv ,QT 'WIN pm' G, w H03 WWII S mw,"f,sf" I KI' SW " -WNW Mm 'n . S ' ,Q-.QSWI iI:'I3I,W4ilV 1: 'ww' Q' . 'Sj"i1.Q ISWMI ' 'Z A WI WI: I ' In ,,...w'w." Ur x ' 'RQZIIM ...E Nw' NWSIQIIWI . , H . ... . ... ..,. .Wm.xwi...wwwQ,,gQ .,..m...,.1 ..m.G wmgawwgqgwwm. ..iff?-3Qg:E...m.w.,,.mN35w.' 5 ... sz. fIz..g,zgsI .,,gggmy My I-ribs. ..v:1i?Z'IZYIINg. wgwwm... . .. ... ,.,wggl.gsfgf,,,I'I mf'gwI-M1gIIwmw.....,.nM ..:.WM :M .ggfhsxs ff-'ff ff' I fI253EIfffI?55SPffI3f'eif'TII.FQf1mmS ' TI fi? bmmu r 2 'II 553362 wi' ?fWTw? 1: 41 W g.. .A fg2:.,425:.,:sM ....g5.......m g.g.3gg.iggk we . was I .mmww ax Nwww Vw Iss.. .4 N1 ,, II aww.-...,W M. . 1 Q. .M . V . ...M .. ........ ... ... , wmiwgimiwv Hgmnmkfgfw M'S'Q'b'1Z'.'i3Ff'.S.,.II'31"'eL?"W2?i IIWI II sv .HQEEQEQW Ew?gg,5 ...,.eI5?jg53SEfS.W... 5. uv gug,g.,.. ,.,. -,-, w .5 . .:- ... .1 H -Ig : 5:.j:',:j:j-Fr: :':2:'I"' I 53 ,5Z551.:. :s: :Ea- I :' Qs-22 2222 42 III .:'I- :.:.-.s:'Es: Z " 33 ---- '::5...5:-5- .-... . v vu., 4. 1-rs L 5,95 W iii? IS I a Q' 1 inf. II. , vv 1 wfriik. ESM Ix... ...,... Q. wx vie W HY as J 3? mgfiwwgxi mv. w Q Ari I .3 S2538 PQ 2. .sm , .W W, 4' + ' W9 'gf ,L .4 44" he Mih axsa n su 31521 X I: 1-is 5. wa mm mmm ... ww mm: www wr ww. P ww aw Q www ww ez... ,m.m.1I.z2fI.x. II MI ... .wgm Assisi. ... F5 ww Ibwv'-fbi v .r .1 is .wwgs amiga? i W New Nm ,, N, aww w was ... .gg .Eg ... W N YN QSQWQQWS wb W qw. WSI. I W? Age 5 kv.: , WJ.. Q isis ES is ,YQ 8 'ggi 5532 mg Q xl 5 .. ,, +L, I W' 9' B2 KYQW vw S 'i,Ebs,v:f. SVR 1 ,, .... A W I ,an ...ga-mg, g Quai ww .ma W... mqgsm 'ws M mf may .-vw... .qw vga as wa. J Wwe 3 Q Q Q. Q. .Q N Q .. I If .IE MIK-' Q Kg-51523353 swgig wiigg aI Q 'ff 2 Q ex.. Q. j5?:?b553 fx X Igwxxx Q . . IIIRTI Q 3'j3'.'gex-gg . Ska. Q xx Q Q W .QI IWi2.f QI 135 fy x, 5.3 . a s mggg ... ,E Q.. mf? SENSE ag II Imfwszi E? SNJXSS f ... 3323 5112245 gg: . TE.: 4. . . Y A . ..... ..,. - . .3 'A .. HW .. 1.v.v.. 'i by vii WEQQBSE '1 'E -I I 1 I I we if IfIgIgS?g,., ,.,. T ....... .... . .......... . .G 'I 1 E we I ... I E? . ..:::. .... ..-.-.-. . f-EE. K. ,,, , sw 4+ N rt, .: aw-mm .-... ge + 'Q 59233 F m x fy.. Nl a rg. QQ - ...,.. ........ - - W KX F: Iv ..... .. .. ..... . ...- ,...,..: .:..:: W .:-. -. -: T381 . -I-.- . we ':':2: rf:.I.:I1?:' ' .W . ....... .,.,...,..,., ........... , ..,, .,.. . . ..,....., . .. A? I I::I:II-I-II .. ...... .:: X ik 5 v y . ..wg .... ..4.... ....g....:..:.: A .1 .4 ' MM .... . .. 5- 22.2. ':':I -:- ff " III . I 12221 : . EQITEI I ., .,. ,.,:,... , ,,,.. .... 9 .... ....,..,. , Q j:.,:E.2j,2g,gg,-52v'. 2fgE .:.5.-51:55 ..... 4 I " i'5:5-:EH ....f..EQ'.:'.E:E3i..Q:f Q- g: . -:E-.25 " ' I .I. 2.252252 'I :I:'I:' " ' 2 2:35 I '55-: .5:I .....2: A , .. :I :-.-'-22 ... ---:-:.- I ..... .. ..,. .. ..... Q - , 'EI'3 "" Z f'f2Eh"ffIfIf'ELfI.:IfEf ,. f2fZ2Q.EQf:QfQ2LQI IETEI 52:52 IE E2 25 EI .. 7 nnnln .egz-I-:::.x: I 6. .. .5 .: :.2..:I I:' :I :I: I 5 :::: mwfaxwgxx ,M MM ,fqwmwwa . M Wim .. ww .:.: -I wvgwwfvflm-1 M .,., . .,.,.5 2 is B M A f '53 :IIEI ::'-2: E: :5. ::..:-.i: 1 ... :Q3:.:.:g-:...g..., 5-.5 :.n-::.5: ::: xx . b .. ... .. .-.- .- .. .- 3531 - I . E13II3 ,, ..g'E'Iw.....s'i2k T . fs N 'Swim T . . my .... .- IEAFE 55 '5 5 52 ' ' QQ W 5.5 , . I I .,,. : .... ..: V - -If I' ""' ' " If -':'-::E :: E'.E:E ' '5'5':: 'E -'II I fi . . -.xiii .... 5 ::"g: .g I -Qg:'I:j ,.,, 5 . .. .... P5525 -E525 -- .... . . jf' . R -9900 Mkt' wwlvge E 5:3-.- IEE.. 51 5.5 .5 ....... . 5 q........ .:'-::. .s,s s.i..5:ze2g2e . Z: , .... ...zf -4 T' My , we m .414 if S2 N N gf is 'wif Q-asfa a E .I 4-.A-1 1 S ak 43 vw W. mm S s .... . ...., ... M I. 5 ,, , ..,. .. I. -21 .5-Q...E':-E :2' ig:. ff'-' 'Q' 'f ,, 1- ........ ..... ............ . - .-.--.-. . gg-3.5: g5:5:..:':15:5:j.g-,::. .3-::'-I-':g:j:g 3-:.g.::g I-'I'-I-'g:'g: ,gg-:g:?g:g:g:-:::.g?:..g.g.g ::: ... Q. J 'I ' 212: :ijigi ggi .... . .... .- -f.-.- I I:..-I:- :-:: :-:..: g .: :.:-: Q wi . ::. :..:.3. I-I-I'-4.-21.21-II-I -'--' ' -- :.: ::'-::':'I:-:I . EI...-1.5gs-g'.ez.I,,4?i::II:5:::,.::5:::."I.,E:. . .... . , I M W., .:' 1 I v iw A . :.a 5 .2 .:,.-.:.: :.:.. :-, 31 . .ij 5 . 21 .: A ,..-- Q, - 'W ' ' """ ' ' ' 2-EE.. 2.2: I' U ---- C "'x ,, , ..... , . , . .. N .....i..a... -. is 'xwwesx fp VK? Fd list' . ft 5? ...,.. . . .fi 2,12 :..:. :g , ::- v K W xi . :...'.r ' ' ' -::.eIE' 3 I-I-I"IIf :-:- 2: MZ . '5 I5 3 255'2' 'f Q ..... ..a W . .......... - 5.5 .-... ...,..-. ,..::-:-: ----- : - . Q. I: :-: -.:.: 52' 252 2: 5- 3. si? 'EE IQ 5.-I. . ... , ..: :.g: .: :.: .-.. Q: ,I I .....: ...... .... ' K K :?iE?q:II -I :- f- -255 ':, :E: E.2 I wwms.. .. .. ... N .... . , 1 s.':"::::--I .az-:.: .... - --'- . .. ag. ., ' awww . W Im .Quay fam W... f..Wnwg , NN :-'I ' -35-I If IS3WQ?55'?fIEW5IZ3?35I ' 2I:?I8S5gf5mfWQl'5,5k::?I?fB35 II TH 2 ,?l:sIf".J.'-v5?'zIIfw'k.I X 's.1.'II 14525122 5,35 Q .... I 51'Zf5'IEiQ I1 -sf f2Ir2r '5IM lh s. ' N E5gm7 Q IIM" M' 'iisfp 5f :::.::-2. 'X I .1If'WE? Zi . '- :. .z ..- lE-1fE 1 f- s:. ::. .-..- ' . .iii 2552 1213 SWAN? S ,.,,., +3 6 RW E I' f5s5 5 5'fi i5I2'EE':E ? E:5f5.: E'.s If f 'f .- 55.1 H if . I I 2 1 ---- - ---- ----- . - -- -- ... ...-.-.. ..........5:,..,:.:.,:.:g:,'..:,g:g .... ef .... :... -...,..,,.:5.,:5,..., wg.g,ggg1gnggx,.gg,-',...,..-I. ..--3:.:y5q:.-..: Mgr ., .... , 95 5,55 ,I-...iffy-5-55:-:-.gg 5.3,5-,545-55-55.:55f,.:.5-I'-If.1 ,....:.:.::.:.:.5.3.-55 ,-3 .5.5,-.59,.,.,,...,.....-:.... .gl -.,:,:g--g:- :EjEgIgj ,. -:g'5g5 5::gI - .:: :5f5g::.' .Q ::::::-I g gser '-' :I":E'5:.::- 25: 3. 55.5 5. :.,g. .ig :.5'5. .g.g.g.g.g.-3.5 5.5.5. 55 g5g I- H' .5 -5: , .,., -.-.- . IS.. -f gg. : ... -- -1----1 ,.,. 7,-. ,,,, -.5 ,,,, , .. .. V-.-E. - ...-.,-. .... ... ,,,, .... 1 -. as qf., .. . ... 25559 1,5 Q.. I .ig .1 h If ,L 5 . N , E vga. J T 4:3 ,Q .. Ii ...gee ... 5 . A , SQQHWII II ... W ... .... 3. .- . , .. K- 4 4- -I+ A A ,ff .ga I I " X,I ' ,.'."I2gEIf I .1 ' iIE. ' ,f'g4" W w i 3 .5521 ... , .Q .. . I-I ,. 5... .sf . - . .. III... .,:...f.. I wi . Qi HI.. .I .. I ,M fI W .I f 5 1., L fx Q 1 a. X c xr .3 Egg gelm E5 35 SI y gggsggge Sgymgg , Q? fail , 3 ewgh, ff? 2 . ,X I Q Q iq X I 4 M2355 gggv Zigi I5 2 3 s g 5 I I u 1 u- K 1 a x E .3512 . 2 .i w if QF ...g5s2g.fBI .... . 'W IIfEI2.3 e5 I, ff,QSZ,QQ 2 55151. QQ.. 5 .ivy I 'Ni' , M, 4' .50 55 I if Q p f 2"'x47x ww 'L 'K' QL' v. 1. 1' If Es! 'E ' at W . . .ei I ' 55 . 21, ' Q "5If,:.I. !34 5 3' 1'Q .? f .g X If ns ., if lg, I gg i ? . Xi ... .A W sI 5 3::: ': Ii. I g..-:.:'-... 1 . .... .. .:.:. :5:..: .':::.. .. . .. I - .sf - W " "" ....... I I .......... . ........ ,W .. ... - .-.- .:' .. -:I I-WEYW . . ...... 5 .... ' ...... ........ . 3,333 .3 . .. .,x1,.i'N'4'I4:g'ys .:' :,-6- : - . .. 5. .5 ..-.5. .x.4..W.g....g.,.. ,. . ................. W I . .. . .:3 ... ...:.... .'.: 2.952 .......... .... .... Q sg. Q . I w I 5 5, B5 ':...,:I5'..: s, i N -I-4. W i I is . .... ....... 5? I . is f. E5 xl V ..... , ,G , .:-gi Sw If' W, g ag 5? F5 5 :I. ..:: YN: . .,, - . .1 WWI' :E-::: 35- :f:- - .2:2: W I . . - .... .... 5 ...... ...... 3 . 5 Q. ........... 5 ... . .,.. .,.,.., . , .12-'FQ I as-Q52 .... : .A -, ...... I' I -: : :: Ii.: ::: ::. :.e.zesg:aC..':a I is .... . f ,, .... v. -s v, Uv v ,V MV Q 54 me Q X I k W 5.33 , X .. ,A . . .1 . 5+ . II gs- . 5 I Z., wa A ve- y 1 S2 ,gm -II---,:':,:g:5:g.j:,:j--gg,:g -- - I .j....:.'5.'j:.: -, I : fifiwm - I H 2. tg... A ..-.:L. ..g iI...":.:.:. " eg- -'. : E'..: f.I'f.x.. "'1, ,,": 333353 .. ' ' ' " " " as, '1"' .. -T. 5 .W ..... . . , ,QMQ gg I ..,...-...........--. - -. --.-. I -.-. . - .-- H: as N ... -3:13 jig- 122: :. .: I.: : .: 4 I ' 3:42-"-..-'.'-fr..".Z.-I Q jg- Z.,-'Q-i'.E',.'-2.-15 -'-.-Irfr'-2.' .. .::L.' 1':,g.I: .,,5. .5.5. ,.... , .... .... . Q II.. iw ---- ---- - 11. .. ,.Q,ih3BEE3i3gQg g1w ,,g. I9 K , Sis Zig. .. 2. :: .- SI.. .... 1 .- . --:::,,:.:-:...:-:.:.g...- ....... - I - - 561 QE av... -- : - .wx .... - .wh-..-L--. 53.35. E- -3 3 4" .5 5.5 -' 2: is 5 6 . +4 H., 2 : 4 .... . .- ...'...-:..,,.:: :, :.:: . 4, ...MQ Q ., , : .iss I . ... ......,..,... .. , . ' . Z.. .:' . 555:-. '. ': :- 35 I 1:I -: -I .2 .2 2. :. .:-I2 :- :: 3: . ng :::'-s : ..:: ' If :- ..: -I I J.. . 5. Q . ,. . Q.: .H 1: -5 . g .. 255 x ::: 4 . Ia. 2? 1 ff 35? nigga ...... .. -. -EEEE I 253 5 155 'Q ' '3 is is ,ii -If , 0 I .... . Q. If 0 ... . Q . M . ... ..... ..... .. , g5,.gg.5a.....Qv5mi Qmwgggjww Sgaggzgimizigggm Q2 , 2SiE.g,.3.,QEgM-IQ 1?-I lwgkigwgggg ww .gg ,N I -N. 2. .K " : " .:' JI "E ::": ."I'.s.": : .' I: f' " ff 5I'I " igflx ss ..,..., gg E'I:.2E'E: - !.V:::.:.5:: S I: :5E..f E :. .1 ... 5 .5 . ... .. ., . . .... ...,,..,.,.,.,..,,., ,. ,... I .... eqfgzawiqrsggigdgggzue z agyffigiwfi :..,....f2-..zQ.ggz:..,.:s::ezggfggzgwfpggiggwq :f s .. .., ,. .. .,,. -::g . .... 3 .W ..... . .5 Efifz ' .... :... H I5 ., .. I 2:2 .. I:::I:.':.:I I:': 1 .... .. :Z W5 5. 2 . l Y . g NK Z 2. W sfgigs ........ - .... . xx .QW .2 . Q. R. .. .... . 1 He? E .. , ...,...: .. K .... .... . .. ....... . .. .... lm MEI W? . .. . .... 5 sQ'W.-223.55 ig .... .Z ... . .... ., ... sg ----- . .:.:.. :,..:.:..:s::'..:...:.:-g.:.:.:-.2::g5:':g::g: :g,g, g',j,j,:g 353 33 wiE '2' :::::.E..i. :5: . .... X .... ,, .,.... , ......... . I : -. ... , .... . . ' if X-'56 Q 2E'i.E.I:: .... . I we N j:g:..:I-I-5-:- Ik. .FG ... , 5 IEQE IE. IQ :IEEE :I I W . ..,.. :, :. :.'..: g. :, :.. ..: .. g: :- ---I':j I g: I- 5 1 T.. K. . .-,. . .. ..., . ........ ., s -iv 'Q Wm? . . . S -' .fi fix.- K NN ai wxfig. .1 :Y I Z5Zg g::I:..:- ' M .. ---- News -'::.E"'f -53 iririri2I':i:E':E:..2E2:'2:.E2.:.: 'm i 'f::. -: :s:fs:, :s:,:.-::.-,-I-f -..- .-...:w-,IQIQ . 5 f 5 " pgs .ss 5 25325 . ---- 4 ,. . .,, . -1 . Ur: 4" -. - . .- .. ' W 'W . I g. - .5 -.: :.-.. ww. . .. .. .. 5 ...bi :I :If ""' ..... . . . ......... .... :g.gg.5g5'.: :5-.5f.: . ::..::. ::.:':. -'- we 353.52 ,NN ... I ig xg: E3 55 If M . -... ... 2: zz . ........ . .... . , 1. ............ .... .,.,.,. . . . ..... .... k 4 . . ' I' ' 2 2... .2.. .:.. ...:. .2.5 .. : ..s.: .. . .. :'. :' :. - ew :I I:I -I-2 :-.I1-2-I'- :RSE . .... .. .... :g-: 15 - -- ?a .. i .5 ' 5 02188 '- ...sg wwf-:.---x. . . ' .- :... ,:-: -:-'-: :--: 8 . ,.,. .. .. angsigmsrgssgzaiseiigiigsm g5w .......e .l,.:gf. iagas::sszzeIss:.5:e:,Iim::IW:gQ1wIi, g iggmszigx WQ II-11 1 - ' I11'jpgS.y'QIz-.QSWIWQIQ I I I. I i Q 5 Q If Q 3 Q vw f E fi. 3 Q JQSHSESFHEEEHELZEDE s eg? ' 5.2: :2.2-.:5 .2.:'. BESM i5E?E52I?'E -: 5E3:' E R . 22? .: .: ' ..s: :sE'-:: .gsm .... .... . gsftggiiwgmiississiw. IEi1:s52iS35gkEI'E??iiE51S'W 5:s:sIisf:iz:fz.ssE:m2:EE,E5 5I535g3?SZG?3535'S3?i53Z2S5553 ' I fsf112I::1'i:I:IL :' ...minggY.:g..i?QII.gs......,. . MQ... .., g.,....g.,............ ::: 5 4 mmm, QQ... ..m..w.... ,, K QI M If .Milli 615.523, .,.. .. xgiiigxywggmw n 3 5 . .:... .'- '-:V-.-Y-.I I ---' .1 ., Ek "- . :.+ .-5 'I L...-x...,..q...,. .... , 4 -. 353 F5 . ..... .,.. . 5 If 3 V as . 3324 Ea., ak 5553? M ,, . .. .... .. . . . . .. -.:- .:-'.' . . -::.. -.-:-.-:- -. . .. .. .. 4 ... ,, . . ."..f.i.s:I.:.':.:I..I..f-'l.' df 1 gs! 11. X ,M mv gs 'I Wwlgg ?i'I"MJ.. -xi.: .-Ia... If -2' 22 .I IT " I' 2..2" 2 . I' .E. 75: 55 EEIEIE :: 1: ... w .... QW , . . ,I as . ... 23 4 Q 2 1' 1 6. w ,N 3 ' 04 .4 ...,... gg-5,2 ,, , .... In -I f m. -i. I3 SQ Q. K2 .... Q:- ' ... ... R 5 I .... Iwwg? wx nf K .1 .f ... Q In 53525 H W" 5m i ..5?::I:.Laei5wII ,Ex ... M-. ww . Wg I" W ' Q31 vmigv R 1, ... Q w In " I 'I a W Q I j J- 'L y Q is , , su f W, ,ff W Q f . ? . 2.2 Q 'f I Q 2 f, 56 'QE :J E 5' as if in . 8 M ,IM I. , I I .:,.. .f:M- 25 . - - I 5.Ef'I .--Q I. ..... . .... W . 6. I 1.3 . .II .. .wif E ,... X. .. I I rf in 415 Q9 Ai I1 42 -ff- '52' 3.27353 2'?Z5"Sil . I- : ':: '.:' is' . , Q. :sw 'III-Ixgggggf .:..5?2?i2s5EE .fx iva : 1, 3 awe.: W I ww .. . WQMS. ., : 'w........- I ::' .:j:':g:,j-g: :g .,5:5, 5? ... .. AEI-I., , ,vwfww I- .p w mf .- :. I II ' I--:I-: : , .... . -' PV .. .. .wiiw is . wa., sf 2 .2s:,. ..:?I :Ig 'f'b'gf' I . . '-if:II--: -E? - is ls.. I ":E:f.ff.fE-'f.f:'Q' zzsaiii :f l :Q .E -I. I .5 ' .' - . Q .25 ' I I5 :Z 2" : if 'm sjfi Eiiwm i i n II ' gismzi . ISM. 1 ,IssgIII2.....?.,?g. dig . f, 'Ig Q .-.-.--.- ..?. fi Www 1 ... -.--- :gig .-.- Swjgfggi. W w'2IZI5f55i'?ZW?E5? E ifQg5f5fZI 5 ' I W ' 2 R.. , wg .. W ...gf 5 in it ygww , Eh ... ' ggI If f jM Q N ,Q A Ei ef g Q ,... W.. Q bg 45.55 Q .. wh , Q X ff. sw 4 ... . ..:.gs I-g. . ,NM -I-I - x5fS..5E:E:E:-":':' I ... ... . . . .1 ..z..m... . In .353 W EQ . . E:.IE225...E':'Q:E:Q:..Q?f5,. .... . -- -- I . I . IX Q Q Imam I swawgww -... ..... .. .... - Iifggq-55,3-. I .E . Ykiia me Z.. T ,Q gif IIII':Izz.:.Ia. .S-W Q. g . .QWSSQQYSSSEFSZsw5Q:5Qx5ws3-53'53gg.QEs W My , ssawi :.?I22....w : V e:2...:Ms2:,zr: .. .QEg..........if:1i?..,g:+:m:'Ik .:' ::. . was ., iii V i Q is mr . .. . - .... . .. .. Q . 'I' SJW . I .'fE.:E.5I5I " f -55' I1 E?8gg,..:Q5sQ .. . ze .M53H.... N . .... . .... M :g -. s ?J15'??' '2, ....Q:gE: ... gg... ... - gl N.: - .,. ....... .... ......... . . .... . .... .... ..: ..... 4 g , i? :.... :sf -4 gif- X: 52 ... :ff . Mk W III - .EE S M335 N Q. ww.. :z5.g2: ::.ggIIz2Zw W s.,Ii.3. -I3 am: . QI W 4: I II 5- ----- .- ...... ............ PEW.. : .:. .1 :.I:5. I: gI 5ggg....5...:,f , I . .... .. ..... gm27i..,..g.::a. :: ...:... . 1. A na, 4 ' '.... :i'z'zi:"IIIZtri.: I Wi II1Ef 'EE I'1-.' 1- ff - i.f21f5?2::.ff??f vrf:E3??SE:I. II .::: :A . s i 3? U ii M12 22? Q 3 ... .ff I 51.335 Zigggggwwigsggv 2' .... xg ,... Q.f. , :...-..: 'fn 4 3355 I M5 as Ewwnvxzsg .12 ...,M . 5 ci . BQ ' X 2232 ' M .. :: gf ,NEEEE Y . ,,, . , .. . , .... ,Z ,, .M ,S 8 me Q If 2 gmgm 3 SSW EMM Aw E gms Q XL Q Q ...,.... .gi ..::'I II gEgQgqm3i . ggi-LIW3 ' H I S1-'I HI ,N W ... sw W A. 'W .P f A ...SE WWQYW . fwsmwgg Mum, gp M ...amy 4. .... I,-. I I 1 gg QZESQ SQ IE g. I Q , .53 , 4 .. is saw. ' Z ':- ww. .. . 4. me. 1.32-.- 3 -I -' 'f f ' ff g f'-:-E H: ': 'I: . . i id ? , " I' 'iiiifgil I S EI 'II E I- -I ........ .... , .. ..... f' + r....:.:. ......... : f"II" 2fI5- , . II Q Q ' g . ....... ,I I E SESS ' .f2iH g3f: :, Mw : :--2'j , j- ex.: ?FEI:2 I:,f'E5"':5E '2 E .?'.,I':.:' I if 5 9 5..,,..,.W:...1..,.i..g:,Ei: -Q -7--:..E.... n w . .3 at A Q4 T .S RX f:.:fWmIfsg2..w In Q. .5 I II? Q' .Q 1 AIMIX? .5 e 5 if Q M -Mar I Fit? Q Q. I' 6' I gg ggk ' Q Q .sw 'ff gy' bg, . .II .II ...I . if M 511 .. I. I ef 'www if 'I I II 'I I .f -I .I ..... .. .... . ... Y s .... . f f,:E:I.: II'I my N 2 .... Qs I! " 'Q Z? sf: 1 :""" If.-'5I: I'f" .. 25,.:-j?5 g,gg . . , Q52 ,-.:.-.-...-,..: I .. :: .. ,... Q A:"" :Q . i. .: .: :. EIE .1-M. :I qw 3, 32 . r Y A Q igmg ... 1 555 .... .... ., .1 3 ...., .EIEI .... . 3 ""' I .?::: .. ':..: :: ,:+:':g-5:z,:Z: ,QL Q. M lg? e A .961 ,J Q I s wag. :,22' gi-.gig gig: IjI"I' ggf:ms'::::..g. I ' """"""' ... ..... .. . ..... . 235231 , .: .: g5gg.5g3g,'gg .32 gi Q III' II? :Ig .1 Q3 -... - 5 ugh im 9 I-1 1. Q a i.. 'Iii E .: gf . -I'-zzg: :ll K W 13.55, fj gz mwx ww Q img.: If .EI X? 5 si? W itrrr ' .- .... . . .. ,. . Ifz? Ia.. . ' .EEL 35 .va .- ... .:: :. :g: :.: ...R x M.. ..: 's ... -s .- wiv '-'- ' E SW ... .. . W-.WI ... .. - .. .......... .1 zg:g3.:...,. V 2 x . .... EEE I Y .... gg x .. EE w .5 ... 5- gg E. , sg .Q 55.5 ..E:.?.:: aw , 5 LX .ff .N SZ 5,31 ,, Z5 5. . , + ERE SQI .-.. 35 .I-.-.....::--E ...-. . ...,... . .:: ....: : .Q -M . . , ....... Bzg az.:-.: :I:, 'EQI- H33 gg? ---- I - I S 5 .I 3355 iff? E225 T' gi .f Is Is E E .... ...... may . 23 QW J... ..,. , ... ff vs fe .. .. .. .. ...... .... .. ki - .- .. " "F H ik .......,. 5 ....... II: ----- :-:- I:3fLS.!. IE.:':.Z5Ef.fI'fI:f ' "5 .,..,? .. 'S' Arm' M Y V' Q Q x 4 N 5 2' .... 1 .. .. fi .... 5 ig. . .... .- .... g...a.--3.-. .- -AJ... 0 .... . ....... . .... .... , . ...... if :EQ L. v 'if' s ,. I . .... ...,. . .-.,... ..?'.lE .... .,,.. . 1 '-5' 2.- 2 1-E5 ga, ': -I IEI ' " W a f I w ::'5:,,:IEff5' : .: .: :E :EI :gf . .... . .. .. ,. 5: .. S' 4 ::.: . mm H 25 A, S 1 nge ' N3 : 7 ,.r x E Q SS 'wa If. 'Z . E.. Q .,., . ...... . ,..... . Nw -...!.. .... - " 52.5.,55-5 :a'.:f '?-2.15 194 ... ... IE ' EI 22. .I.I. ::. '33 my -I5:2.5.5 ' ... .... . at 41a EI :?k5S. ..:.:gE..-5. Pix-1, Z W . .z .fa . 51- -2 f 3 - . 1 : :. A I F312 E--. -2. -:-ISL. :::: '... :':1 .3 N34 -s.f,5k4f?g1e.dil5?.v H 1 .... .. .. . -.f 1, gg wx ' Q ? , T X 'ifww wff AI. . N M ' 3365 ff: .gram If my Q Q' Q' A gig 15 lx 51 .0 4 PQ if f H kv Vx Q, I-.-1241.3 Q sk M ..... 1 Q.. .... ........ - . ............ .... . gr. fi.. if .. A 'T ...:.::-I: 1 I- 53 " -2 .. . .... M, , .... 3 .II .8 X4 4 AE H .. IQ..,.5...g..:..5::E- .-.. .3.,,'gL?HE,Ifi3. .9.:I..xs:f..f: I Q.. .,.,,,..,.WI ?'iwQ?gw55.Wwg.w ..... .. . ... . ,Ifbmf f, W , -I wmv :Z :.: 3 ww. .W 2 S . 3 , ws 5 Q vp Q i 3 Yi 53,232 if mr Q43 E . . Q I' Q QS' Q, . A K Q. 1 we QE . M H253 EL 'ZIP 3 1 3 I1I:Im2ssf.. - ...z1,.,iz:.Isx, "'h?.?5WE??1'?9E5Q ...ERN WESS5., was px Q. :- W I - I. b s .... ... ....... . M v sf .QM 5 , 2 . .. ... Y .ygwk . . ... iii' ig-5: ..:." V a 21 5 -- -- - -.5 -f. ' .. E? ,L ..... . . mm? m ....... 59555 , , rffEf'z QaQ'5'.:Ij, i E E .. . ...... , . .:E.EI.EEfEE3.2E Fiiii:-EIE3' I ' 11-' ,, .-.. .,?, Kd 3355 ,.::-.mga I. ,H .V w .,II g,.,IL22'5f"m' ZQ5,.aa':. .--. W - :II I ggggghgygg ..g,. .:..:..:, g.5.: j. .. ymeszsizrwzmwizsfsifgisii ' ' -.Q fx? X 5 Simi" w.i5.s'S.'iZ'ZZ 25 i3.i5S .: .... it Kiiiiiwgbq' 5: . g 151:5 1 I- I-55' EI .... ,.... ... 55322 5- .............. A I I ----- Ei I-, .f .. .. .. . , . 'E::fI.Ef.. ::: EIS: ...... : .. .. .. . .... .... . W .Qs ..... fi ,, E W . -4, w '-:-: In .. ,-, : 5E:,g3r:-xg.. .:'- :::: -. -. :: : z, x .. .hu EWEUIESEEWS E55 . qf5"3axYw?'V.2"""w I' f?"I':I:.:'.ZiE 'I iii: ,I QI. , 5,...f.. miss.. . fi aw:IwI .,, ... II ESIQEEEE: ... .. . . f ..... . . ' Q.. . ,, zarfff. 2 ... ,. M .1.... . .. . 1 33, iw if Q W T55 A2 : E ff-"" E... ..: .... .. I Q?-, KE ww Y,.1....'3?? ..: ...I . , .... I . :I - : I: :I.-':':. : . .,. Q.-.p...fb..... ,,.... 3. Q .... ' I.:.5. .5fI .f..:: ' X' " ' " EI .: :' I' I: I: :'- ..-w'ff?gx' if., 5+ ...... nm.:- EI:.Z::fi:1i:Z:I:':' -'-' as I - :.- .-gg.: :.: . .:.Zig .... Mk .g :.' .. .,1-. . Q,.,w, . . ....... -:s..:.:.:.:.: ..... : :E::::::.:g::' .... :::' .f.?..... 1.-.. .Q E3 51 2- di 4 Q ex in " L I 5 4, .5 .,...., ,K ..... . 4 '33 3 A wwf' AN. -.--..-- --..-. - -1.1,.. ' . 3 .K A i A .. . ,. .. .: it L E. If E V M 2 515 " Qm g . V - . :I I: .- :.-..:--:I m IW Y km' .wi .2 f I I N "-I .SS . af ., .... -... highway " :j:, :Q 25,355 W Nggiyggg . .S :.:.. 5235 an S li. w s . . fi EIII' Z . .,.,.,. , .... 5 5' wail? fa: .. . Z ggggggzwm- ..: g. as 55. .S 1 ..:...MII 55 fR?2?lFW Q' Q ' vibbpigggf ki y Haig., 4 ,. zz. ...,E I 3 Q x. Q .. .smI,,, I. 5 I .. Q I 53 R? fix gl if W 5 K X Q . . .. .I 4 . sr fx If ,. . A I 5? 5 I I' I In if . w a .I .wx E Q S. -. -. I II 4, E Q , L 5 .E ........ .Ig ,.,.,.., -,,..,.... .--. ' Q, Q Y EA ......... . F. Zlil In Q V --. :':::':.'."- .:::.:i.EE':.:.. . :: -:: ' I. ,I S EK .W .. 6 9 5. 3 .I 1 II f R ,. Eh Q I gm MU, .M , 5 3 xii i s . , I . Q. x i ,E G 9 133 3 , . 1- . I. Ii Ia ... I . mg I ' 3,4 i Seng s Q X T35 . . 21.1, KI gil. .428 E 5 . . - : 'ggi 5- 1: ggi - .1. ... 33 I Ei Y 5 I'gff.2i3!2 . ........... . . A .... .. 2 Q5 .Q Q ' N ,M .Eva L is I . . .....:- : 5:q.. -. 1.. . ........ .... . . , ....-. , .IIIHQIW ZE . I m rs? I . w s eggassf . . ...... 5: : Ivwggg f R fqidiggif' Eagwiw.. SI. 5. S lwiigvwgiffi-ESSEEE if X' 1' 1 E 2 Iwi? 5535 .W gi as-E.. :MS gi .gm ik H I2 vigil 95' G b I .M2:sg.x. ...... . - W M :- 2- 5 . :.:-E:wI::IIMIII iigvisirr sh , .ga 3 . 9154 H -Q4 W . . . . . .. wr' 'gggggif 112 5 ... . ..... . M wg-mg.m2.......f.g ,.x...:.sI if . I Q 5 g2zugwgQEQ46sQS ....1 M... 1 1 N W.. M... .aw WW? I. QI. W Www . . - wgs::Izggwfi5.13....m...g.2ms5ays..gggggi.: gXg3.f533gm:g..-ggggzi ' 3g?gQ55sE52I"ffg5gEggiIIEffE2ggggi sw M Q' .saw . - 3. . . .. ... . .. ... :. :: -'-'- .mf 1 wi gs Q is W -. - :.: .- ..: .:s:.: .: .4-. .- .- . .. - .. . w,,m . :....,,,,. ,, .,., m ga., N. 53515: :ws SWB? -. EEQESEYQSQSEQSQISQQWIS5 :azz Iss::s2IIgI :IK If ---32-- II: Im: gi . E'-EFI!-5" ' R 325 R534 12: 4 5 M? . . 3.. . . ..... . . L. Q ef. W IJ. A v . 5ev...e,.Z. ....... , K ,, ,IJ.'22'5'I: ... , H ... M QQMI ... . ' II . 1 seas, M, ,. ,...u...::z3r si:za5?5EQ5E::HE.E5?sEWi5:Esz:w Q-iiiffimifimaf . .. W.ge,,3gE,.. ,,,x . K 4 a..?...,...,... 1 EWQQQI .1 .ww H3324 -II I- -2ff If1. .ZE1.- 2-,:.5-1ag.sp.- Q.. I II 4 4 . . , ,, .mM.u..s W. izI2.Z3.:::Ig+w-ww-1. 72.2.92 Q .+.,...,.... ..52f9g.,,... ggm M W mi.. gi? M .fkI.IE-231-L.:-3 5,5 SMI' 'iff S . 2135 .gwge dgggpiggawigfgayizqhf fgmggw 35223.23 ,...:.....: ., ,..,.,a1s,z...,, , Q, ....w....,.,Zg . ...... .V I .,..:,...::....::.-:-:E: ::- Iigifwg SNAQSWEQEESIAQ f x.-I: if 1 E:.:E,f'EfE5E5 m fijjg rk'-2 ': :j:5g 'I 32312 ga s I ...,TM .... ..... .... ., ,emi Q A.z3mq.Wgi5, 41.25.25 II I-.- ?gg3Mg. gi52g2Q,..g.gg ,,,g,, WZSQTZS ZS., REA Sig .-.:I:i?eEf'fI:If I-355'-' HWMBESSN-.9 5591255 VS 252 Iizskgfamwqggwwvsys -.-. 22 2 35533353i"f5S235il?2'Z2g33S?:7:fiKf1gY22 I .. A .. 2.,..e?51?i3?5Hj5II?W va gig my if .2 Q Eii5fi2iSi555giESsIIE?E223 557' ' . ..35.i.., .,,..:,5..g5,3L g,.,Eg.,...,,Z,,,4,?F N5 .zu .Q . EI AH 2. G? ?'if iz.. ' wg... iw ffm Q. . ...S digg .FE Q MSI MII. M ,Q 2:Ims1I, .,5EEg55,5ggg.m.,.E....w.,a.g3.5:: .. ,. ...,5,.,.......g.,, W. ... ...... K.. ....... ... . Siiiffi' gzzfsm-QIS I w ...Ig Q H. .Elma y Q 5 .5 I W - 2 .- hz..-:-: .wgw wg v 23, iii I' ...sas .. 'az gm Sig Q. ... ww.. ww., Www .vtwagggw .- -f .- . .f25.z...Siy . wig. I S I ... -..... I 2 .. .. .. . " "' .83 WIS H 22125 2 25 153 :EEE 5.-....sE.F.. S Q 5 ga L X W : sig " Zg::E M i f ff. . Q ..,,.. .,.., . ., Wiiiyim 'szgfgy If Qgggi iwa z i ., Wa i? . . I W . ..... .... : ...., ...EE I ,....- . EE -: ,-,-,.,. . .,.,.,.... , , .....,.. . --- . , - . Qfy, 5: .. .5 52 ? QE -. .MWI : mu W.. vs. E Q .. .. .. .-.. 2I'E:I:I'E2 g5 .,..,.,. . ' :. ..... . .I.I: W .., ::,.,.::f9'g: :' -1... E Q .. . . .,., ,.... I' ..... . . . - ::: . -gr : ..: s:5?:',.: .... . ' 'I 55' " 5 2 .:. . gi 552225 I 1 2 v 5 vw ... - 2-533- . 5.25 I? I W '..: fe V 5 . is 5 ' iz X E ..,.,.,.,. . . ,.,. E3 ii I ...:.... 1 mf .... ------.-- -: -'. ::-::E E. 2 I . ........ . ...... P :2 : :2 I Lf. I- . .. mg. . 4 I 41 5 1 .L .... QI' + MII Ei. Qggzzagmmga ... . 5 mf, 3 E' .EY QEf2f'Ef ,2.:'f':- :- 2552 5: .,,. . if 2: X SEEEII . EE ..., ff . W gg? .. . 12-.I Is 52725 -: sIf:f f f5Qf55,5.I'ffI2 fi f i. . I5 E 1 E M . 3 .-.. g 2-2-if: I 5 .155 ..,......,..,: . .,..., , . KRW r.. 1 X s I. 2 1- -2:-Iw L '-" 4 E2 Q E 'I W Q -1.2 1 ig gg! it Q 5:- ...I 5 ,, gg . 'QQ E251 E I- ..:'IW' :::' : . .: I .f ., .... .9 .. NE' 2 ..... . E ... . .. 4, ' Z if Q. .... . 1 Q32 I 4, 4 ... .::. :.... ai. .... . -.. . .,... .... , ,.. . . a t E1 . .,s.. .IQ , - .. It E :i'.::::EE:E : ..,., I 32. .2 9 I I? a - .... .- . ..:if 'EI , E' 5'-.Ian X A M fa -eff .4 1 Q ' Sew N '35 M I I w E IIIM S. .2 5. 2. E22 I I 1 za gf. xg -. gi .... 5 . E I 1 . IN 2 , Ia J 8 2 2 N i H IE I M E 52 Il .5 55 . 4 . .... .. 5. .1 8 I Wm.. . ' - 5 ggi ..,. ..,. . ..., ,., . e5 SEI -"- -::I::":Q: """ .E.,E.'::',fE'Ef?QEE:.:: .I l .-.-.- . , 1 1 J Q ,M , 5 5 a ' 221 S iw X Q 'I is ,f J ... . . , gms .i j j II: 5 E I X.. E .1 K5 II 3: ....... -:::: xg - .:. :. . Rb gm. . . ..... . .... . I .,... .I 12 .f., Ea! it my ,, ... .,........, . -, ..,.. ... ..,, . .... . . .,., , i n 3 A .... ..,... .,.,,.,,,.,., , .. ,. . ..,..,. ..... R .............,...... . .... ....... , . .... Q L? f sg' +V 11 5' . .fs , .4 . .R gs m lr,-N L . Eg. . I. sf f . zmflkg 9 5 13 AIIVKSW fig, xx Q, :gil dl ,Q E X Il Ta ' . :U f ' 4? gi .: K 1 3? .Hp , HIE I ' M 1. ae? if E I I 3 .If 1 II ,UN Q ,L 3 . Q, . . s I ! E av, xii? as .ff BA . E . F? E k 'W I mp gi? M H I 1. Eu! as Q E ...Q a ., Lg! H f 2 ,A . 3, .4 , Ie.. xii . , af sag eg 53, .img lv. Qi. . . W g 35? ' IM. 5. 5 i ' E55 Xe Q X Q 3. 3 ggi fx 'ui affix 3 55 'il i i 4 '? I 2.-5 i. EJ : Ma I! Age " .I . z 2 5. 21 sz 5 ag age.. I- I I 2 WI 2. .. f. . g EE Reef 552 'xii X , S .. ., ...H 5:2 S I , Wm I ,Amir .- x. . .... .......... , .,.,. . I ....... .,..,., E 3. ..... :.. 5: ..: 4 5 Y' .za 5 I - -- :F I 9..- . :- swf: .. . A-z. ..-5 . .,.. W . .I-... .2 .1 . g:, 'aI . . ... ... gf ..., . . .iz ish .: ...... ..... .. .,i. .g.:,+ g: nf 22 I . .,,-,.. . ...x.,.,. .. . .- .-.. ... I . I :E5E5E5i2Es.s2a':a. In .,.,, EE ., ..:., 5 : :'. . :..::-.g f 1: 4 . ., 22" , Q., I I ' ISV QC! s. Q . 5 5- ? :v in 7 U . . .,... z' f I? 2 ....... NE A ,iv I in 5 .. X. 1 . I 1 2 ! 32 gsm Y Q2 if ..-ZE.Ef"ZE'fI:' "" """H" ' ' . FEM S 22.5 .... 5 .... I :I:.i: I f 3. - , ..... , 'qu ...I-z: ....... . .... - --V' L 'V . . .. .. .. F I ...:... er' is 2 1 . 'r ., :. '.::-::E.E. .':':": '-'- I --'- .3-,: .. .............. .W - asf.:-G-g:.:.QQ.. 1, ..:'.I: .. ...am .,., .. .. ,, ,,., , .... ....,.., . in - . e ., '5' 5" 5' - -- IE IE! EI.'If .fI. If':I'.IE' yin" xx .. --... ......,.... . :I .E:2:7.iTI'. .. .. I. .. . ..- - .., D ' SLQBKEHEWEE Iiiis ..:'..: I .51-::::a:5. ,.1..z. ,. I ' W " :. .- ..... . - -.'.- - 2, , Mm fs 1 as l 'Q S ag gm .1 gg . .. ...1 . . . at W: . .... .......,.. .. ..., 2 2,:.g2..g....s..- ggglgga 1 I' 4 3. gg... .... .... ..3.. ...gi z 7 wr 5 xi., . . .......... ... V:-5 is W fi-:fS:5EE5fI ::'.EEI:-s:.. .Q .5 ,..,..,. .-.. 5. ..... ....k ,........ ..... ,,. . bf .. .. .,...... Q N. Q Q Q As. Il . I 4.7 f I I . - "-- ' '-'-5:5 5EiE3E?ES:I:':I.:I'II:EIT!.I.E:I,E2Ef?4ii?E:'g5,Ig-fi5-,:555PifIQ 55275 I Q I . . 5' ....... - ww ....... Q- . ....... . . . . ..:... Im-i: :::. ..: I- -'-- I - -I 'I2:2 ::. .- -.-. I II ii fi: 3f" ': fl S . ... -...,. . .,..,.,. . . Wa vi W Y. 9 + E . , MK 5 . I' 5' ' 5 5 : iii . ...... .. .... 1 I 522. 52- -I.. I . IIEII 25952 .... .. ...... .... .: .. a:.: ""' gig I-f E Q . Y E I ij .. L .r I , If 5 2 E 'b 'Q .4 , E. ?5 s I if E e , Se v i '.If E , Qs V .,. ------- .... . in ,...., ..,..,.,. Q -ri .... .5IC:2:.Igg...Qx+5.":.:f5'2:I'2E2..EI . , , 12... .I 5 . ---- .:.. :.... ,. . sg 4 1 5 . E :EEE 4 .. .... . . ....... .... 2:5 .EF . ISE. . . i k Q X E fi ""' . I mi .. ...h. .:E:.: :?.:. 'EQ: .IIS ,ww N fi If ' ,,.. T IIT. , IFE .. gwcegi: gg 5 JI g , . y . zf I QQ! 1, .2 4 1 4 gb :IE J g sm is .. ff ... IGI' L wifi? If sw... 25? Qi. ii vi YS' w ie .... . 1. . 3 1 S i: 'E -gi 55'25 2i:If'f W.. . ., m-awww. 'ibn .. -:.:.::.::: ::. I 7 I , :,:i:' 5IQQ.Q.,I:.I:I . W V' J' 'I ::' EI .f ...,.,.,. . ,..,.. -. .... .. 1. ,P .I I:' E: gl .. Q. mxefswhi sw N ..... Qmwqmy W.: b 1255352525 ,:-,.-:Q-... ,gwgg gs E . .,.., Q.-Eg gs: WWI A 111191111 me M Y EA 1 , 1 Mmfzmf gg 1 11:4f:1wg.1fQ.12?:fQ111fgm11SQ-11 sw: 5:2111 ::s:2fQLggi::a253: , ,pqwwwifggigywwgggfgfg 11115111123 11 lgfzzwgofzfff:g111,1wzfS1w-m.g:,a1 1 A , mr:,Mf5g'P52mwgW 2.3wgf13g11g5'31vf5a1g w1g,:11z'f':11lw21a2 fSw:W21?f1W,1 , ,,, ,yzwwyxagms , 22,1 W1-wg 5 1 ' 1.,rfw'21w f.z'musM"'g-fbewsih1 W-avsxiim-fwmfv, Mwegzeasi-111115511512 12w:1ii'ff3g5i1wr1: 1125515 11112511131-E::1zM mm 11-yqwvzssilwkmfa 'a511Y:ww1s1isfs?:ZwWf51mx1iz:1Z23w::Qs111:21 -1 we 522s:11:1sfSWfx::ifSw1 W 33 . 1 , 5 . 1 , W 11.11. W2212:11152A1f22:1231f1g:.1w:31?1,1gf2S1weg13521-Wmftws113311112533Sbmziiiwfii-m2552111Aiiwffzii1MflwWQ:22w'v:5?2Sh1532+gc! 1 .wg 1'fifwimwffiismsemziw my :4:Qiw2:51?'S2i?1Q':m11w?S1yf: wiv-fwwgiismwz fv1tS12vwsiw1-va? sywfexxiiwsgifwrza 111121111132W1ff:3T,211M2iw-mi M M 1 -,1-wa .,,wi.:W :saw 1g::1w2'z1'11sff,1:2Q1w:141 MVWXWQM M2 ,bgnmeqww 151,111 a11wgww1,.,11w,..m.wg,,WSW s11wfwg,,,,?M 261,111 M1111 my ,MW,M my Wsfb,,.vWw,,m1m,,v,2.,w11f1f1M,, w e ,..v,,g.mf - ww, Q1 gm 11g1,1w,1ga,1111,,,v,,11111sefff:g1,Q 111 1 1, 1 U?10fsw2S'?1QwH33W? 2-YQSJM-Rf52newQSMWILW-K-fi--ffzgfmQMis-Ni!2-TM+511-wv::'Zwsw'r5A.Vw::.ffqiigwgwwfiffiwwgiifewsm-1fgg1k11Hq,,fi 3- Wgg1,1..1 - , gwggw M 1 MwP.5wg,,Afw agg,i1,R1fHg 1 11 1 1 mm-wsz::?S1'11i'Wsf-f'I15:3-1-Tgsxfmwzhffvdvfzrimf,+51:fiwsriwzwlwgrgpzlwggzs1,ygf'zf?f?w3:5!tmhfszwg.42111::'+::Zw1::1mm.1 mu ,,m25g wggp:1g5gzas2P1ggS, Wwggqzg 11ggm-21:11551:51525521111ggmzbgmggxsii11:121111,isa1gg:m1g1::w1mwwgiLt11x3m1w:'ls11:Msygzziia-Rwrawfg3:::.1fgu:m1:f:mg: - 13,-.1 3 1 . , ,. ,11 1 ..-. fggkmg A Mwinffmzuimtskdx-0:3151rziwmflwr1:,K1'u:i2wM:z5Swwf21swfivfbiiv'-1212--'N::'?1-usglbzrNW'.grssifMaszziiwzzfw-231-1wwe: ' w w ' wmwirzziwgfh115xiii?11f2wFaMYg5:S'iw:f:52SM252ws'111gimiZ?aiwe::2S'm1w::z1?wffm. ggiwuzii.Wxg1553211128551Me,:ggZs2Ui21fH1:z21- 1 H -1f1g-':"-r-'fP1-sf.f 1- 1 E!,-a::: - 1 1 :2fZ?lwzSqg wfsmwiwgqAf-'gwffyi1,5111mw1w.5vW:jMw:'g,g1xg:Lww3.swp-11Q2WQ1fgp:A11,111wiv?,:1awgHvkfy 1575.11Ljg,vgawggwaygdiwagqggggwgqgiM2gg55W3gggg,g,1.wf5ggMW-13,,,15gg2..fggwgg,,,m 11 1 1.- 11:-, .: - ,wx qk wgq g 1111?-3-, u gxgw ,3WQZ43ggfE11ygg9.fs0,31A,sQfg,gvqsigww S:f:VfWA1f,2'2 251wlimwmHf1f12Pf'5?iiZ3wWQ'5:w:LWtime:W15''iii-fvfiiwfzi'ziiimwigi wxlveffishfW:?2M2i3'fiwz':GK1fw1QZQVNTX1 Hgifzzaw1wv::'f'i+wm1'1xf'2fM21MfW?wE?w 1 :- I -1' gw iw gf -1v.11'.1: ' 1.- 31211: :Q:11.1 31v3 4:b+1Qs'.11-111212111 1 ij? w45,,,1Qmga,113H1w5Tq +'w"21mwm1H131111611 4'g?:'H3?QZ'111we2ww1e1.11114111f1wbf1:?w1.K.1gg: ?,..11Mg17::.A mfwiiiwf-1,wwwwffkzwsiwiwgzwmrgfwiH 13111qW:e:s,.xS4f2w:1Q-i1fR,s:'12f1gg111fvE:i11ggm11 - 221111 35211 we122111fgMwf2gi,113'3Sss,,E1,:11m wgzgmrw NWN-M2gg,:.1zg1ialikgxzfffmwziwzziwfzzii :wiv1fQf:11wf5:Sw::E:w zsrw gi' wisw.112311wywewwgwsiwfwfgszgqwggazifaggs22305: -.- - QXYS WQQQS 1:mmwwg,LYEgs1,:s1:Q11::31:bg:.:whsg:51SiSg1,ggfs31g:QqA3113111 1M1f31w1gwsg:,ww:1Jwmwwziqzsivwsmfffzswgigw:Hmifw W"1f':-:g:,:xQlwfrgggZ1w171, fsiwwcsgw ww .,.. iiifwiiiwwisrkiiigaiggwiiq M211 gfswsiswwsw E,141Xg213fe5g,g1SS11awQygg,,111v191wispw1bi,wg,gfs'5wggwQ,gqigwwfmyzfzq sgssfegqsffaisgggg:aww:g::A:2zsWgg:3i11grsz1g1511135211151.gm ,, 11fff2wse::22Kk1WQ 1 ex5 G 0?1 51152219153 31 1, ,mgMggasuiagggsssfiggizzi1s2sf::51f1:iHg1gsf2?411:Q2R1g1,w?,1::1f511 11 sa mi fs? 2121 131 ff: 1 1121411 1 251 - -1 " 55'E5 ?SS?igl'iEf5fSw E3E 23231151 1 1 'g'saf,-51-1 3 11 ly 1 imap 11 113241 ,,:::14.1:111::::? :mf1,:f11 3 gsfr 1 11 1 1-1: 2111 ' 1 '45 .: 11, Q 11 22 23355 -15 3 gs- 1.111 1-.111 :1 . 532233321311 1 S WS QQESWLQZE1 2:21221:2213'Iwzm13fs1wfgg1Q2s1r1vg QR, w2Wf'I.1m: Q54 Wwww? wffwvf-rT11ff,,wf:1: im-QW1 ww w M1 QP ' f ww-2 fi 1- W - 1,14 ,ww Fw y - - 1:-1 1, . mr 4 -4, ww M fy v - 53306 zwyw-wwvfwif-3,329 sw Qwwbiwwgkwafu' 1-wHS?2w:w.1 -M11w:PS11:1sG1::a11s11121115.11 1 51 , -1i'?, 1gf.f.. ,,1 w1,z::11g::x111,,1g2211:1?1ffgqmgiwzw-1Q,f:g22fw1g,:ffw11111 hffifsz W1 1 11 1: lffizgf 512:12 2 x ff 2fiEf2Q?ff?1:El:?g,gHEL:S2FS 5 :5 :f: iw " a::::--2222 522111 SKQKSSWSS SSSSEQSWSXE QQSQSSE Q 1-. :iii . 511:11 1 11 his 1 1:11 :11 1- - 1 - 1, 1, 332 5331922 1 13 - 5 .:f --1 1 1. wi21Q1gs:a::1f1111rf1 1 1- 1 1 me - 111155211 111211111 HS Wffw'1111:sm1H:s2f211 0. 5:0 - 3 1w wf 54fg25," 1:-. ' 21 -5 1: W zwwwgz Saw 2iSQw2S"sv?:a:iwvz:11n1 4 .. Q gwnwwzxmbwggdfhxaqgaf1wa2m1g2,4,111w1g:w1fg:111fff121T1 -4sgfg::wvg:11wfe:.:151211 wx :1 f QW??M1:1:1 .. ,G , wzs mas 2252325 25 1: M , 1, w s 3111155 H iwfw 'pwwzw - 1g 11mwm Mwgss Mffiywzxl ww 'H aQmwfWwzM11R3WAww-,,Q:,A1wf'ePSwf111f1 maxim' 1 111 Q .- ff .. 110 ,MN 1,11 4 , ,,., F 'qw Wm 11451 .,1.. mmf 1111m,1W1fwm21sww11,wiwzwwif' 1 W 1 1111111111111 ww 111wf1Q,111W.11 . 111311118 11 :- -: -.-- 1111:1:..1 -:-1 :1.. K M3 11 M1114 fifwv"gifthaw-1vw'mai1s-f1wZ"bww vbfzd U' 311 Mmemwfswmxxivwfyzvl121:11wZ1Ew2?qWfg:f'Awgstfgwawviww 11' N: - 1 - 1: . f s ::: : ':. 5:1:::'r 2-' "" wfmif ww-3111 1, M4 SSYSYXQSXSYQPA ywgi -f -1 Q wzxfwzqawza Q Q MQSQQEQfzisiflwewwwim ::-.s:-I--1 "Z21.. :1" --51 I-1 :11.: ..Ir 2-E-:: Q ms w15HMgws:3111wM2 1 11 Www , ...,. S.,-1-.1 -1,1w11.11S1,11gQzwg1Qz.mw-1, - M11, 2-rf-mieggzfmwwfg1:,mm112,1 -'Sm ' S m iivkigbimziw my 5555135211 f 2.2 1,1-1:5-Z',2.111g1: 'P --51". Z wwmi xwzfkyiiuhgmfw hf . ,:.1.:"5 -,, :Z ,:11,.:5:i:.:'2..-115Er:-S 14152111111-:ff g?'?ff12g:M11vswM.121m2'Z1150 52ws3"'E1w,:1ZQw,3fg? V ,, 1 a t1'1,.1-I-51-1-I 1-5.-I2 1-.113:::ZL5-1--1-912:551-4s1"f'-'g11g:1'?.-'-I -. 'G me wg rf '-51 :.,..5:2: .- swim WQwgQN62235N?Ng'i1 ' W 5 M 21. 12 3211 ff wwwfw wwisasfiff ---- - wwfgdfigwggrfsyiegiki 2,1 wewigimxbiwwigi aw:.XSf?Wu,m 1 - :RQ1111-11-wi., nw-Q E -: -f..-1-11 1 . - , 1 P,1w :f'?3xg11w' 1 MWlw:S1 1 1- 21 351352211wi:2iQ12s2T:?3:s1:1Wf?w5211Q2X.31.ffi.S.11f ::f',a1f,1 -' 3355: feazqscafgffgsiggiqgg3:5211 .: :1 :. . 1 1 H2 1 - ..: : 11. 1 31 -1 biggmg pwggigfgsshg 'a QAY QEESQ 15152253135 m:'sg1s?sf122'f52S522iQ:i2S12if .2 fi'-1 ?g:zSf1m::1SFwW WSW? "WSrw?1z2:?i11:f1::gz:a 5-1 1 21 1 1 :31. - 12 -H WZSSQHQFISSS Viggilifmi - - M fsegfwzi ffQ2wi:5Qxi1Q2wm22QS1i1 f- I1 Siiifsfwsiwfsw T235-wyigxgggiifgiiiiiy2w:Si221::11we: 2- a: .: 1:1 ff Q f-ff 1-.: - -2 23 1 12553112f1f:::5QHE:E'1WQfv21:s:22 3215 w gz zziffrfwsviwigwiwgisa z:1:wwg:a:'wfg,::2gg2.'?agQ 215?fgQ.1-QSSHQQEWWSFI wgggs 111322511 ':1 ,1.1:.:1': :- 111 w w- Sz2amg:1:11gggf,:2111f,1gaKwvW Jnaifwggs W ziigsgagfmvffmgf1Mn1Ea:,1W Saw 33,1 . ..W11 gswwgxmmw ww g w sdgg, .,.-1-6,1-.1f. QRNQQZEEMVQESQQEwgszsmssswggzwm Lfwggzw 112+:1:1Q11w11:.s-f1,: z-ag:-1 .W Q .: : 1EZfz21 ?,11 waz- 15Ea2g111s::1111zW ' z :. 11-14-1 --:1 111 11- 112315313133 111112211 ii Qwfffszfzgggfasxwgwzzsfwhg 1 :H g1fzQi2,1 11w wwzf g ge-1 f1r:15w,1s1111.S1vfg1,' . a1':':s'.a1f sa w -saw wmzsswwawggfwssiifi 535111152211:.111iw1mg2111:zaS1w::1f11, :www K -. - 1 V vm ,wily .. Q- ww 1 .1 ...-. 1 193 mmgwmw-we W:1'Wfw,11w35w:sw'i5 fwwfgfx wwsfdwzmww Q1W':1wmw:,.,ww, , 502 M GR? szifmwszzsfif ' " -. WWf ' 61 1 1 23511 61 11 ' K Q - -111' W W3 ' gwgbiiwiazsiswfsigsgifismiwve 5:12--:-.-:1:E': :::1:-.-.-- --'-:1.- 211 .1 1-I P5:2.-21-- -1 :-' 2.-I :' Miiishr N SQHY' E 2- 'l il-1"- Zigffiiwfgfw, M2'?'3wMs Sign gwfifg gfgifiialggf 'V "" 'QE 1E,:v:.:,3-31:15- 1 :'. r :1x.,g ..-5-.1 , 11. , ibfmzfiikw w 1 - '1 1 2:22 -WSm'5gmif3'Qm:' 331525252 2 M Sv is ' 5f34'i3?v1 ' XW s m1Yf1"f'a-ffw ag , Q-K xifm h f1f2:2?51wii wwhx 1 QQ 1: 2513 N Q X Uwfliiwggggzvfw V fw f-M-vg.zim: m-11:11 ..., 11x111 1111,..- 1 1.1- :IM - ww? -i.:. ---- - 1 .-- 1 .. --1f:,v: -at?1P1-.15-. L wigzw. W 15511341 www 1 ww , 5SMgW?f :g . QE41w i3g?QR gZ3S'3?2m3 ,P ----- 1 1:1 ----- ' - 5 11 Qz wggmQwg- 21 11 91.3 1- :. 1 211 gi .1 R 52 21- 131 1' 11 :1:: - -,zz i 1- -1 211-1-: 1,1::.g-12: 21 . 2-f' r':- H 2, .1 13 - '1'f11Sffg5:2125 s1111ff-111211221 ---- g f2 1fE5i2221z2:i3?es Qggzwfkziwsiww wmmwvwwifgig - 1,1 Haiiwf f WQ ww 1 1:1 1 11 ,QR 531113111553 vg,,,,,1.,,..wm,vg,eg1 YQ .. . --51 1: 11. .-1.:1E,.15,.,.,.1.1.- wg, ,,,. . '.,.,:,:?.,1 ,. Qggegwfxgk-,1,fg1,Z.w31g5g,,1Wmh:,, Qwgmgh, 1: --aff: - - Hswgwask 03312-gmQs1WgHW?2S I- 11- 21 1: :1::r.- 1 2-'Ir -1-11'.1-'1g:-1: H3321 Qiffiigmifx ::.:::-f-"1- ':"f"'.21 1-11 .: 11121-.1 -1 1 ':.: 1:-51:if:r Q, USMQRS?-15:'lifiiiigvsviifigzgmiigzaww117 fi - gg , W2g E W ggfwiwxkgsfgzifgfaasigz 5512 g53gg1g,,?i3- ?ggz11Q1,12gxgS11z,1g155ss351 1 111, '1 K 3 15 P B WW-sgd,,1.i2fS'21:w?SXf11sf :w w X::2:21?Nxw1sm:Efwg2R1?4g:1:22Tfxia15221141fi-14,:12?:s2:2Q21:sf122:7: :hg 2111ii1s2111iw:a:s211gz1"1?-35-21: w w -r :1v.::::.r --1--1 111 1 1121223552252 H W1 s:aw1g15a2if:1::11gff 1. 1w1:w1:1i11::1- 11-eff1f111a:s11:s:H1K11::'.11 1:52251::fgw::lfs2P::5SGwW..1 -1.- :1-- 2121211-':...:'1: :11i:1:r2f154:f w?gE5g8XgSm2i22ifsfi2m f be 311512331551aiiwfziigms3w::,K1f521:1zf:ZsSg:kw,5fZ1-1 535:211:1:f2Q,g:zf11gf1:1:'21wgsitsvsp 11113531 11fv::zwg:1':1.1f11:s,1:if ' - 1 , -1.1. 1 , ,Eg151f1:,, 13151 1,1: g1,,1::a: - 51 :1 221 w as ' 1- 1 -1 , 112112331555 zwH::2 ,w1g:'a'w?2?ma2m:1 311123 g1::S:1M3::,g1Mg:s.,1Ggqrg:.11ffm-5.1.11,fy 111s:1f7gmswgg1g1. 'A Ib?wNZ5isxfN"1w"L ' ':'.. w 1, Vwu mwf "W .er-5 I-: -fm: --:::1:12Mw-1:-::12:s- -. '- M111:29-1M:.'2wWS-wgbkiihwgilfwfrffpiwwzzfu1-v:'zi'Z1'MMi2161wfS3w+-:SXJMM 73111-111:2N-wmwH:':,H5,'U Qigwgzsw-w f ' 5 ---- Wfgzsm fz 1:1 11111:-:r -R5 31-1-.1 1-1,-u1. .1:-..1v? ---- : -21 -- ---- 11:1-: --.-. ww Tn, wie?-we:bf:3i'::ZMf:1:W5Qmf:215w N W 1:Xff:-122.2111111515111'2S2wwnMm'wzti12X: ln:-+5211 12S5f1:i5'iw-L1 S E Q If - '- 'yrirf if '11 WS: N141 S11 M- 1 -:- -:.'2Z--1- 11'-2:-1 ,g,2W1,:a11w-Dfw :si - m i 115:?11gf1:X211w1::i21fg,gQ5:wgs?Q211-x 1 13 ' :Q br 11 1. ---- iiS?53'v ' ,1 K gig fm:f1f:w22?'1szi:Q111if1:fsf+1f sf? Q UWA: S sam ::'22w1g:3:fQ:1zm211iwW1Qwweri41g::m::s15s::sw:zm1: ,5-'gigliiliz'-I-3If?-'3I:f,-':1'.EI'a-. -52313112 -.-I , " ,': ""' ' 52.-'---F-'g , QU 'N 32-,I:'QZ-Ii :-'- I., if -1 -'-g"'.Z"1E-1ii!5"5-IH , 1,111512:31'S32fe1FAgZ'11N-wiwflfiw fff , , -' ASQ. iw WE .-ZvUW23i5ffwlWVXSve'55ZZ'1 W2'i22Wf'S55H013SSWSSSNS"SlS12',.wP1gZjSmNZf,wg f ig 15353 M M SM V 11 fbiwawm 11 Wwxzw-7:1swg:4.11::rmw ' K-A 115' 11 11 1.11115:1UW+3:Mf111f1e1M1g11W11w:11VMg11113231111sg,pwwwwmwz:.fM. ' 1 -""" W vi m-M wgwiiqsw' 1,-. .... ,hw 135531211 www '1 14 : 1 - 1 -1 www-1111. ff? 1 wgxw-g1i1M.,W. www.-1f1 'Z. :aww ,WQ:Qtzgwgiiwsgvggii21wHw?1Nw:w.1,1xfgi3www 1 SsP,,1m11:ww'-",gI1.wm,,,,11 gmwfg. .. Pkiuwggwgagxgqggigg wmu gw ,,1 1s. .,wvgrw 13 wwgmp k ,w1g,,M1gN1-X 1 ,wsggezwv ,1.zQ,wwmMag'fQ3Q g:g,We:,,,1 gw5m fg,wf ,Wag 11 Qwwy 1. wif .- 1 1- - - 41 1 1' ww vm 4 9 M K , .1-1-a'::.1-. M -.15 .- ,, K i - we- s igfgzz g z .' 113511115211 :2ifMsz'61s:1:wf55gs1 fzgswww fwgwiggwiwvm 1 N11-W - . ' f'lw 1g:555QK m2gfb1:::if1s1111f' 11'- ' a':1:1,-1 K Q,, w " 1 HQHIQQQX , fp wiv-ffggnsblwap2-fgzzziwiafssblqigegziigsslwswfw zz Q ' 513 15 3 ,wxf i fy zff fwiiwfisiwqggiiwism111125511-Q5g?1,.Mf1fx :S:!3:,::f..-- --'- ,,?11-ggsgw. 11M.1.1f1g1f,S,1,11mgg,,m 5317:-1, .-5:1 11 'M , ,qm gqg : : ,V-., Wmg,'1g.wg,,1wggg,,1 wgg w ,F : 1.. . 5: -:1.1 ...- ,.. gkM,z.fig,g1W5egg,M9f1,,.,wvi ,mg EwzsiisstfwmgN??vg:'w E ' X211 .Ng W-gf:i1ffgz.S.1w5kX1-fmzrfpm wizzimg .... 1 wb , :aww Maw ...1:- fr-. y15S1gge:J+1gg5:W e .-. , K N 1 11 jf, -aim 1351 ,1Q5zg1,,y1q1w2wm::11 1.1 ' - i3fW"' 1: 2' 1 was-fmW3wQ22Q'::g:Q'fm'311519115311-1,g:311SSsw Abvsgxglifiwg 1 -,1g1-1.:11:+ - 5: ::5 2--, - 2 2: 1 ,,122ii1g:,i1g 9.':2 -" ,.-1-g1 : :'r 1:g- -1 . 1 -: H-5- ':: f,T.31gz:ig3,gg5:1zQ2gg::z1 115133 all 'A 1 Qin g:f13wm2'2'3Eg'b2aSwHm2 gisw-Y's -',-'.r w , 2Q1,sw11z111:?sm fw : - g,g wq1M:WS1 11. h w g1q1:ai5gas2"fP::11f11-- 11:52:11-vzzbiftlff-3:-1 A PP , ikffzwiwiz fA::iLM+.12?wf1':L3Si152512121 : Iv X X Wigiw-M 5 - -:-12-1 .: 1- 1 ,1 wfgff ,-,Y-1 11 H 3,15 5-11. -11112511-gg1x111gw:sw7g'::,1w'Sf:gM ga g5g1111g1g1gW.13g,:111Eq1gQ V 521 wb ,fwfr?PPV!wwfkwf""iD3w'vi"x"'-w'-wma N ----- : 1 N ' A-9. - wi 1 Fife' 5:-2 2-.'--I,,. -. .2 ?--.-X--:-'I:':.-:--1 I: 'P'-' Q '31 :", .-.1- w wflfrgwwfi .7-tkuxw I.: H5 G ,xv MK 1-wmwwllxm' ""I1,w- -Wear-ffi41f+?.2gs -ff FPS" f f?w1f'21MwNmZs1w QSSVHG-A Q 1 1.211 A 1 izflfiaiiwiisslisfffwizsf' W . 1' 11 1 1-wfwf Q 2 1:f 1'f::SSfZi51:fff:1-1 f::f1n::12Sf5zLsf1 f 111'+ 4-2 . ,1111151211:f12111iz55?1::if11i1ffQS::1f1s1 S11 ' -1 M1 511 W ,..:1 11 E , -141.15111y:tQ1sf111,1ag1,,1M.f11j::2Qzffxfifvii . 1mQff11:fs?S1m"n , , :sax 1215.2 1 11:92 11:LuSg::iQ1ws.2?1m:5mai ww . 1 ww?-w ig 351 -,::'. ---1 . 1 ww1351-1-fgH'f1M5SwviSi1wfMQwlf 1511, 11:31-'H 1' 1 ,: 1 w.-he-fmxfapwb '51,Mlziwfvsimvf2faffrgew-11.7Mfs31wM3Si2ZH:4f'vfimlffszimz M Wim W - ssw m w w M, 11- .:,g, ..11- ..-. -1, 4- ,11.'.44 ,-..-.- wx- gwxzzw-w:1,.w,z.m+1f1s:xM,1f:'3wfm 11,1 , 91,1 .gfmp ,Q +11-ffbf,.,.fig:m1gP11.,11f1gk, 1q,y1.-g5.,11 U1 wg,.41w5,M 3131, w5,,,,m, 1 i :1 :yr ' g1f1 .-'.'::f1f 1 1E1E1 1 - Qlwiffissz fm' 5' QiS5i.1i S2555 111 A 55-1 1:1 Q1 5" -: vg xl ,- 1, .. 5.1-5 g ".,I"Z?'1-' lj 'I V11 isfivm uv -jf fmgjbw QQH51 Z H iv. 1- v s ' Qq ,Ag.wgM2,.' 6 -111 5 I xiii xgkfgjyijiwggf,EQwgggL,nig'ggM5gQS1S 11 21: gglgifyjiu fiv v? 1 1... ngiigwi lguwwggfiiwsgl 'bfQ,g31,:Qq.,1Hye,- 31 MV SS 11 1- : Sy x'?Zw4i2', 1wgs,2QN 41 Riyvgii wf 2w g,f1,Wf1::'!2 w - Q-we if-Egmf5?5ig f::Rm:1:1gi3M11 Q. -51511 g1.113gsMggg:1Q:NggQ5,i gg, , 1, ,.. :..,- w xsifgzssfivgiww Nw, :ESA szz yg e-ww A 1. g 1 1f 5'f2?S :.:i Swv.: -1 1 552115135133 ,gs :HSwzsviswm:1S1gg515:'gg1zF11ff:::a ffwg ,gpg111xx11g5gg g111fgz. f '- 11, Wmemwfts w:1f,:TsSiM:f?ib.1 Wsiiiflwlffi wiv2F1aiiiwwizwfwsriiwizhU1212535122Misiw M Q QZQWWSSQ :1-1' - .::'- L-wa W , 21-::11H'1y2Y2gg11z2fi1'mSHgB3s11w2Q2swgQ:.iWf1:g':LE135Qsmg:Qmw Z: 1 551151151194:5111ffqlliggsgfsmggziwQgsmmsb1115 -ff -11 up gm.W:gg1.:1Qgq1z.,:i:ggQ,,f ,we 55.5 :S1 f,,N35v' r' f ar' aw 5.5. 12Aw1g3f5zSgwZSi5Qgfzgiwsrigg-331,55111 5:5-A 'Q " 'lgxqigxsZg'gg553g:xNswy?'5U:2f5ggzwgggfggbggzivf Qewggzgg ::::, .I . - ,-QQ: -1. :-: I v,,.,.fUqgwM3g:,fi:,a1qgR M153 fx 115 . 2 -1-11 - ww , 11:1 Y 41 1, 1 11 ww 1 1 ww-wa w1,mw1111 Ggvwgwfiwwigw Fwy., 113. 51111111 1, -N f f- 11111.-. -131 .-. ,1g514':f.a1mH:MMa,y2wS a111wgg1hfgg:swgg1aM e ..., -. ?111gv-111155 11 :M -11. 11-1g1,1Qf1,, 1 X1m51g1,..1g111,1,1a. ,M Q Fipwtiiwlziwznsiifg112191-fi:5gygg:?z,1:wwgQ25:11M2u2a2Hg1 -5-123 .1-41? H Swv Niww:ispg1,'Sw2m:S?115M:,11S1 QS?Ewf1s.2'Swgg2a1wg:1w1: 1 11 21-P 1:Q:g1 'W la- ' wig W-wh'i1w3Q:EXS1wabf-qggl wfgwwfg1W5g:i:A11qggp:-- ww- 1,111 1227511 'f ,f ' w,,gX:1mzf'2wfif1:,1 Mm-11-1:1 ww-11122 wggwfw: sw 1'1m:i,1,2 5,121,251 ,113 wmkv-wg W Qwglz. M ff :rim --11.-.,.1..11.. -' 1 . 21 -, 1, , 511- ,,,,.11w-mg w1g:fsfv1:11:M31s11-g, .ffy.w4::,..11,wgm11111, 'SZ 1 Xxyfiwgfziwsgsiim f,:Q:1L1wqk13f451:F-11Qzisfikgffsgv515' 'Q ngf:?z,1f'xQii1QW:,:Y2xfm..' :liM1 :.2 f,.: 131:51 Ziiiivxigkwww i1EE??fgfuiFiNfg?2wfS ,'.f2zP.1'-5. P 1-sw' 1 SM .f1p,'v1. 1-11.11wii11'S'w:::s3wg2511 ,q 2113131 'g:I111e1:::fQgg2a:1Q,1 19351113 5S12fy1Sssw,:wsS 19 V gLfZ11gfENwEJ1w,.M H ' w:,1,fww:Emw'qsJsf'v1, wgwgiwfwlsiaxwg-sfkim way ggi!-A211113 Sf: f Awirfw':.ww:3,1r1w:Xi YW'M1 fi wf 1wiv1MF:2fg2g:"s1HQggg?'5QW ,,,1wg1, 111,11 -ew - QQ: A bewawewg wgm'.111:,1smQ1'g2w51ggI,f5f Wxggxw ..-. Q V ssvwbffgmgyiwvzwxmxiiw 1. . ,U,.w1w,gbg1, wsQ,11,, M--1 ,.1Qg,f4W:gf11,1 g-11 1 511,11?g,,,,Myg3gmi 11igg.1W,,1 135 R 5sa1,ixgm?Tf1g,gf:g:1?14ig,,:1i1,gge11-Hgaimvgzu. 11 x JsSfzws1., ,a 111..1 my .... - f a v I 11 Q -1 ymfwiw mfs. 11gzf3wff:1111w11::1215?:'?w M : -1 , , 1:11 S 1 gs.yy:11aWg1g:g1v1ggQ io' - -1' -1 : w f4?.1w:fN.M, 1 ir, 11111113 . WS assi! M :,..:- f1-- 1151 AMN: ..., 4 .'1,' 1 . 1 g.,1. ,,-,.5 1.. 11,111 jf,1151'iSw1::g.Qq5:z,X11.1-35111,5 -, 1 11,11 , W ,ga Q a q Q H?g1k1iQ3Ew ,QQ Q W1 mf ziwfgkwwwxfxz?-1 K 3 ?w'fsmw::53+f'ff-ihsvxihw 1 wg1,kg5 - --,-::' 1,1,-.- 1 . -4 1,-12 5 13 ,wffigflefsfi , S??Me31"xw?'W'f ,' P www, 1wwg::2?Q:1gg1li'i1g 4 f 1-3,31 fgxzzwffwiw 1 3.22: Q- PM1M:E4WW3i2P1?Q?w5v? .-2' :- W MMf: ' 16 1 4 .if--" ' z5511:2l191m1 41 was- M U' A 5- .4'- 5 """ w'1Wi55fJS'L3k3F P:?EqQ5igQ,gm,,iNQwg2QAgwwww'-511 .3115 Mmm -1: -' 41 -112:11 5 :Vi , ww 111:asw1g::12 WgkggfQ,5a1,.w 11-31. Nz? X 11,gM'1 fmZf1f1JLk2i11fs1?G :ir -fb .' M "wzvifwv2:f1frgQ2f1,::iw f.gi:::.w gu ff1m'wsa2 Swaziniwx' fe,11Qw2fs2,12e?l?f: w'S1.?W"' -r i..-1 2:14 fm 1 1 gg!KMiS,w ---- +1 wbiwuw 1 ,1119 1+ 1?-.T 1 - - Wfgggmifm, 41. ww,11r1z,111,z,111.Qg5,ww 1, 1Ewi,,v1f?afg 13 X-qrlfsiiig 11,1211.11111:ffr1?mNQ1i:s1S'iQ:2Se'111g 11 11? , U q w v - 1 1 'iz f 111 f ,wzzfilwaawX:-awww11 sgwsg w 2211421115415 Y' Mew switizmg11'1X:w32'g1g,zax?vf wg: M N 21 'Lwff11:2fg1 w x 111 5115 23 W w.zQmw12:msMsi?wgwmiiaw MX 4 wi wzkixglikg :2' wwQ ----- 1 ,,1M3Q.,.1 giwfwww 1-- -. f fi 1 -1 ,, f,,,,,M,,111:g..11g,1 111 0 q w , 1 11,1114 ,ggwwggswmw'W31wgmv1,i1W-ggi 11',:12S: .1Wg3,.fPSM,,1H saw 1,21 -wfggw .. ,Wg 102Z'.:f:E',15fa - .. .. . a f.-ws '21f -w s 1 .- .11-mgf151JlxM'rg.1, .- vwx ps -,1.1 .f M5111-ng,,.,,gv naw -1 Wwwvgziwgf 111125 www 1. -:g1!,..,,..- mm ggggfivgwm ss ,, W1,,W,,wvg,,Mws1v - .- -1-5, :aw w I .MW 1,,1 yf'f'ai1+ .- 111' , Q 11 gi w1,q:2wg,554Q 1 QS2wg:,z1111wfg,g1??1-ffgsgigiwww ,W .... . , ww 1,1 19:1 g:,4Q.11113:,1,1fQf:vgf1,,fQMvg 11, 152 11111ww2211-1111251121-wztilfgeziffhesfi x 2:1-1 Q Wig wisiwfixwsrgiwfx is - sf? ?'ifw1:?3W'A'Hw , , 2M 1 1 12 wgsafww ,1rQP.1g'f:1111:zw.1f?:x1:1:111gs'f,1mQef4w 2 Q ---- - fH3f3H3H1'fis1:aaF?S5'SEiSSgg wH:Q1 11:..w ' 22Nw,gws 5xg,2iag Wf'N Sf U gh- 'W wfwwziq isgiawmkiffxz N. . 1 A ,bWE,N.,iM,W.3gW11, 5, ,wg .gm zimwxn M .mi W W ww .1 ,, .. W1 . ., .1.1.1. I . 1, 1,1 Qggw, 1111 -...M , . f1 vgK1,,1Q, qE,gW. ,5g,131 ,,W,,,,.,w-5,?m1g 1,1.ff1 fx' 1 wmwez wizwazffwfwzgm11-Nzswffw-mf wwwm:ewhqtliigvibefff-?hM'EwXg11fQf' 4 Rgiwgiw w ..- Q - :,1. -- 13111 f2EQg2 f3gH'2:m Q1-- 1 Z Wkiivm 11vZ2WsSw:ggs:,m5,mggA 1w1fz .1 . Q-111kvvm?zwsfi11-fg::'2111f11a3w11:f1:5ifs,1rf111s::Xas2e'E1mrf11 asdggwwwu Q ,gg ---- ,12X:r,'g1,1gf1e,s 1EM1 f1,:f2Q1fg1,-111g,1,1 1 Dim 'ww vipl f 1 +s:IzP1hf1gs:a21w:E'1?1w,f1'wQ5- ' -:sf :- 1:5 :2212-2--1-,m:.:?f"p1311'i.I--I Q1.-y1.1,,1gw: , Mg, '4 Mm 321111:sw1m1:iS12h:?S2aS21'1T5i:21iZeEf5 - if 1 .w 1,1 1522511 , w flu f 52n1g,1-g1a1SA::z1w1,g ,: H 21 5'32 Rf,"'s112+Qi?Q'f , 1 31535i1, ' "fi g-' 11 S ixif'2215j, L,11 ' :' rf , :.1,1wg'xwg'i 18' 1 1-'- -. - ..- 1 .1 :-- 1 JA- w kwfwl' -Wsiwvifw i:- - 1 - :--: 1' :-.a-5-11:'r.: r-'s: 1 Rf 1225, 1.1 Em 1 1:1-,-11,Q.,w-,.,,-,aw 111- : 1-M1 3-+11-fz111.1'111:11 f , 5,,1g,gUgEg1gu1-.1gg,:g1,1 ---,,,:.g1,-21,-.,,:- .. ,, ,, 1 1 .1 3.51, NS' Q , -'L'-H 1 W .-.1 .1 1-136.2 ' -' --g-:-:, -: .- ':I:-:1-v1F'-- 1. :1Mv H -1- g.f:: '1,1, ..g::,-:,: .-.- '-'- :'f -' Swfcwk, Ywviff- 15 ----- --'- ' ..1. f..'- gui: -I :-.1 W g11g,.1w k ff -. 22? w 15. 'Z f 1 . 1 11 11 22 5 5: - 1-' .:1.5.s: :2 Sw -1 111 'r' ., '--2 I-f-1.:":: 1.:,:.g:' 2rj2.'-1 5 113553955523 -1g:: .s :: '1 :1: '1':::" ff- K g E1Q '::: 2:2Q 1' E31::1g:s 1 .. 2 ---- nf wu '1f+' 2'f Q'f' 11 f1111,3.S1z 111 f',-? :ii ifQf'1eg2+QY - S-W is ., -'Q gf! - ' fi'-H' :51j':",'1-I55.. -gf ....- .f?fg.:I.2-I- --':'g : ,I1 -52-.,:2-I4.1o35g2:I-'::'g"?"I,'i- jfgll' ' 59 -- 5-5:53222 -.-.. : - j,,5.'.,. -1 1 Q' - 55153-2525WI:95:l:':'g':f,'.ig'f--,figki -1:35 ,.-:: g' -r,yEgf:f1,-1:::-:5.5',51,' I :.--'g-"fill: ..... 1 -.:-5:i-E::g..-.::c:.-:- ,M -M1 215111 1 111 -.-.- ...1. ,. :1 4 -. ---. - ------- - :M 1 V 112111 -1 1 .1.. 1- .... .... - 1 x 1 wig'- -. -. M fam - ---- 1 1 --.- .1.1 -.E A QS 1.1. ----- ..1. , v -f Qwf nv ..-.- .- 11 4 w -:'. --1- .- '1.1 K -.:...:- --.-- - 1 - -- - .1' -'1:- -.---- . --11.,1111 ..-.-:i-1-.1 ww .11- 1.11 11 13 wfvbgwvw gf vw wg K 1 - .... .. .-.- vw f,,E11gy1fa.wsg3 A 1 ,S -.-. 1 1 .1f:1.:: ---- 1 Q ':.1'1111 -- :, ..-. 1a1:::1:Z-521: 5,11 - sf -:-::1:::-: -.-- :' ,fr -: :1-1":'..r:- 1-- ---- 'wx-1::r--:1-1-:::::1'' 11:12 2951. 1 ww wiifqmw mf 2111 1525231 11 fb' -1 -.-1 1.1 -.Q121:-.1-.:.,w:1.'w.'.- - 1.1. -- - -+::,.-.-:-:-.g:-.1 -1-1-f1..-11:1-:- 11.1,-1111-311111. .H ,W 2 ,., ,, M 1 , wg 1: 1 -an gig .. wg.. V .- mm ..-. ---- - ---- - ---- 1 5 -gm 4 19 1 11 ., .1... 11.1 11.1 ., mwbwwwmmmm V M N .. , gf M " 1 '22?'Q 2'1T .::5 2 -E-E:2'1-1E12:?r.1 11-1'.7':?,'212r1E-E':',:.:EE 'fat -1-af-: 1-- W? I-fl i:.. 1'2 M25-m y 'Ii-:1:,:1' ,, g,:g1' r: ,- ,1 .... 1 .- ,,., ---- . -.-- .. .... -. ., .,.. W . N .X 1 , 1 -, .,.. ,.,.,, 1 .... - .- 11, ,, ,, ,.,., . ,. , ,. 1 '--' , - 4 .Mv355'g,grg - . W 1 1 1,1 31 1 -.-- 1 QW M 1 Sia m' . 5 1,12-v '- 1 - mfg ,... - - , X1 .. 22 ,5 .. -- , 11 """ I 'H 11 1 1 1 - 1 1 1 255551212512 gb 1 1 55 ,., .'2215"- I.g:." ' 51f 11.105 5 T53 :,:g:2'::Z23'5-E-11-11:93 3'-HW 22 155-5-Qiiw' 'Ii ' 2!k:E'f-:I. -E v X5 -EE':2" "" if-'EI -" 2,1 M mffimw 1' -:g -1 :Swv dw 1: lawmmmm ..... - :-i-.-: :-.1.,. -1 ::.-41--'1-.-:.:1:1-1 --'- ' Q5 HE :- -.2 1:-:..1-11-N "'- wwf 'wmyqwow'-M51 W1 - g,.,,1:f-13,1:..- -, 11w x,,11. wgw fs 11 Q1 ,Qwwlegf g.,..,. -5 g,,,.,.1f-:g- E-,1,1.'1 1-: ..,.e1:- wf 01311 1. ---- :1 -.-- M1-'N '-.-1,241 1 ---- 11, 3'Zef2,3wzf39:.f af UP' 84 53 1 WQFQYYGPYQ 11 2112 .:1 ..... - ZW, ---- 1 211110115 Ef t ---- 1 My .11 MH 5 :-':-.' Vw , N' W. , 'WH :.-:2::-1 V :412--.1 ---- '::g:. :-.-':1:f1-:-f- g:.'1.-1-1g"':E-,.1 -.-. ---- Wi-i f A .W iii, " ----- : 9. ----- sfisvfi 1.1xg,,:5g , , - w xgg 5gQ,sg1g:s5 M251 we --.- .. -ww ejbgiiwwff ' Qi5211.m1gg0f 3-Swag ,51Y1,1 .1 1:-,:,: :, 2a. 1 gg,g-Q g,'s1f-033533 'Swag ,:'.:,.1e:g:f:1zs M- 1. 5 1 .1 g1vw,,g,,, ..-. - . 1-1 Y :mgfgf25,,,Q 1,,:1,1,,.. -1 Ii-21-:-- I -1- -::.. ::":1f1--If--1 -' vi V5 151341 'fgbgli ---- 1-1 -1:51-1 -1-1 ::. .-1-f1:22?:: - - 'w.:r1--uw 'B I-S'-:v w M :1 :': Q2 1iw' f.-11 -' ' - --Hg :: : -: . gg H25 'SKS 1 - ------- -. :- :.:1 . . ..... - WNM 1 igww-'f55'1.1: ---- '- w, , :1::a- .:' -:- ,. ,Wm ,W:Z'2E w5e15s:2gi,g - , 'SMA , 93 51111532 M Migggw .... .:.-1, ..-. wg -.-:-1:K':,: ... --.- , 1- .11 1-f1,., - A, M-c ,q.wWgg1-+:5'u1.1.1 ff- 5-5-H1 . . 25311, :1 ..:..-.-1?g 5- as Q35 - ,Q 11 :,.--1-:SE -.-.511-ag-1:gm-1-1:11. ,,.1, , ,,., ..... , 1, -. Ymfsjg ww ,M 11 gggrggkiayh H is - ----- ,.,, 1 -fm A ' H'-WE 0 ...... 3 - W ---- W5 - ' my-fm 93"3W3w? 1 W -1 -'-' . - - M - ,. ...,. ---- maxi -- - -"-" 111-11-ff. ---- :: r1 r-2211:- 'MQW3 1, f ' -112 25: -121. 1--121:.' --.-' r 21122113332 Q -'-' - ' gpg fgwigww F1 fwwffd 11 Jw .1.1 .- 'Q .- -z::'1:4'.:1::,-1:.... :1::1.1'1. . --:-'.11 .2I-A-':':-k-::,1111-':2:1::.2:-1:1'-1-1--1': .- f.- 122.1-21 1:12 -Rv -1:-f1 :1'.:- w,.,1-fm V vfffiw 1::1f:'-1-- ,Q -,-1:1 1.1, - - .1 --.- -1-2 www L M gi ,Wigs -'-'- - 'f Qi- 1 1, Wgiggwiygw H if W .- '- ---- ' A 1 fVEWW3 P0kfVmiEQN4X1wFaW 3fs'f5wMmWQs 'iw 15 f l -: .- 163-2.-efai:1' 2.r1: ---- 1- :',:.- -14-12:1 -www' ' g Wff'f"?1?3f5 25" igbwfwiwnaafwaiv' ., -.11:-WSH-1g ' ' 2' 1 .... 1 53 1 51 153 .. ez' Mk? 'wif Swim 11311, 11 ' S2 .-.- ----- - -.-- -. 11 -1-1,.,,,1,?5g W ,,,, N .1 gmtmewwm My -f111f'ff,,,f,,11ggfg.ff111w-ni,f,,,q,, ,Wi1,,1,1 1,,3Qh,, , . A Wfm?i1Ww'5fND-'Wm Qi QTYAWV ggwiiffrzw '1rs14g.g?f,wPmwv3S,,ffiWiA3gf1mZ ex ----- . ,. , .. ,mM-11WmmW 1wg??gqg,g,,1qfv,wwg1vwR -1 1-11-1 ,111 - ww WWQWQ ,,,M1iSggW Nxyfmgmwwmw -.-- 1 9 9 11- 1 wg,1:,e11fwg,eW..fAffQ2-v 3,1 ,-.-,1:.11, , 4 Ls? vwfa 1 :g:..-.--11 - -' ---- --'- - SMH? was: Nz., 1 M'-, , ..,.., Wgwzebffw fzaw .1115 gg: ,,., . ....-1----My:-,.- -1--11 A ww' QW ---- if 1f11:'1?4'- :::-:-:1--:1f- 1, ...,. - :1'1..?1-,111--:: .. S'??mff-,fzmiiw ..2 -1-H-1::-. :.: 12. fiEQ9"wW Jfiiv? :-.:, -.--1-1:-111: :.. --: 11' -::?,- Uswfwilf? WM! -1 jgmffbxmaww ?g, W .... :g 3: 9- 2 f1,5,6..,1 ff 2 .:1.--2-,:1 - 1:-,. ..,. - MESA W .,. 2 M,wa1i'21:f QW .-:1 g,g.,. -11 - .1-1- 1 , ww f .,.. . Q1 W, Y,WN,,,1gw M W ,,l,, 1 ..... i , .wfxziezgdwsw wa v Q A , H Wdmiigw 5,251 .. ..-- 1 Wgggm, -- mw?:w.,.1f2.11 .1 - 131,1g1:1.. ,gif W" M awiwsvs wa 11- wg 1:., w5,g-241,14 1f.v?.5:".-f-5:12 ?--1'- : r.1-+ 1 -1:- 1- ::: -1--r- ..., , ,.,.1 :.- -' -11 : wif? W 12:31-1:1-'::-f1-1-1 W .-..: 1-11- 1--I- ' :' 1..5 .2..1:1- '- :1'.2:.1, ----1 -. -?2-,:f-,.- 1 X frwvfif-V ' M "W 1.1 1. 1 ww 'iff LM! ! .1-s: .:.--1 " M' "" Q1-fmwa',,J5?J ' wwzw , 1 -Wmmzifag , B-y1g6,W1.:, :.g1v'- WM'-fm' ,ww wwfgvl - ,E :W ,. liiwqgfih '-1 . zf.:1,M1gFQ,,1 M V 1.4,-3 QA H H MW, WM 15 + 1 MN - 2. ss Na 11' -1 . b gfiwwm ,..,.,1 ....,.. . W, .... ..,. if Q "' 5 mug. maxima :Q W : 5 Y M 9 b g' .QFW ? gggffgi rr 4 5 eggs 1, .. z -... : ..... . . - 1 - - , .. 5 25V .3 i s ,igsskiii g E S5213 xg szggsg Z S 1 'Z ga H " 135 K . W , 15 H, ga .-..g -:5 .:2-g:,::2a-awe... " 'g Y' RMQEESEES Ni 5-gm Eg: S. ' N mm Q is : iw M SW T W W psf zwzskggi Q4 is ' .:E2E :'::' 2:5-E :-5' 533 , . 5 sggggwgb wa .. ., Q WSW! R -:sb -:E.:: :-E35 e gg fiiqiia 2333: QE -Q:--:-::.: 89,3 ww 8512323 mm ws ?55i g as 55 sf Ri' ?,igEg5 M was B EKZQSSQE gmm gsgwiimig 'M' msvssg mg 5 5555 555: .Higgs Q Q 55 Q K in Q. W H s g fig:-SSW? Q. -wiiiigsb M F9552 E ..: we MM? QXWQEESWQ :Wei MW 29 8. Q X"f'gb'3Q"g-'P by fy ggi asa 33 4:3332 gm.-if-55:5 Qs W x WW ,Nw mm 'qw '-Qs-we 335 W . ggi :E 5156 Q55 'S Q . M :ia w .R E S2222 35 ' gg?wkl :megs QQ: If Q Q, :g-:Q ' ., 5,n., 4 x wg' . gmgggwg 325 S .... f ,Q S, R, 3, .gk gk? .lm gmwgx am 23 Q1 x 9532 , gngfm sgg -W .gfj al f .. . I 54 59 . 3 -:::':: ' -2-f Q. :I-: -5 ' -.:2.2.I:5:E:.E2.5:.5:j' 'E'E . :' : - :- .r...r::2a2:',.2' ::j.j:., as 'mfg 'Sf'-: Q ---- I -:-figf aw -I- 51-: :-5 :33255 :::--::f: 7 .2..2:.:::Er:5:::: .,.:: 2:'.:E.:E::::.::.:5-:,:-:,-5:-.g:gs:.::...:g ': '-.::'E::3, 5gg:, 5: -.-. 5 .:E. ,.,.- ,, '-""-' .F :' ,:: :' 2 ' "" : Jw W g r 'PMS' V 'fm , ewfl 1. .3 1 52 5 255 5 . 2154 : EP :a i I WW? fslfiewiiiib uf 221 52:1-f' , .-i-f:5':Q?5-"'55Y'I-'Iii Z "" 5:,: '5 52 2-I-TI ' 1 Ab, 'mlv , wb. 13: ---- :-:. ,.,. . :...E,:,.,..,.,. , b,. .,,., ,.,:,.,.,..,,.:,:,.. .:.g,: .5 ,gf ,S Qi . sM.:.:.M,m ,N .Q 35 W -I :f:2-Q-:-:E':2E'E2I':' :::':E22EE5f:5' .:..5:,I:IE -.I.I: :: - REB V WM'i'Siww.w " -:- :E E.: :. 3 ,,:.-: earl: viii. :: '- :.: f K, ,,? V WSSWQSZQW , J zififiiw if-2f'22521 fifii iif:--fiaff iff' E2 22 we ' sw :w..wN'i":' iwfxffkiwgw :g-::'- MW .,., , :g:j:g : :-:ii::,:.':,-,-'-5.2',:3-.g:.5'H5'55:1.3':':'.fP!.::':.. .e.-,. .:.-::,.::..g.E:.:i:': 5'E gf. , ' flzigf' ::..:::?-55:5--5 : :-:521.55.5-2:s:"-2i'::'l.:: Q-E:FI2:29-":::?kE'.::..-2235: ::.::.!5::5:.'E.:..5: 5'-5: 4 :5E.iE:-:f 5 '- if-22" ': " 'K M QWG5 WZ, :g ggggia 'g: f,g:..g :,::: :'- 5: W Mfgwww-Kwik mwwzw -:-:: 552: R ':'-:"' w1J?ii?Q?fA5iw.M'mf5?Qgm3f?521f2ffZ?:3MWgw-s2x:Hggmww 2:12 2:2.2'2:2::E'2:- :':-:E'::. -------- Qbfggmg s m Wggw ' wxiaewsieib?-'-'1., g2'm'i:.1 Q55 w5i2'vS:S?" . '-'-'- ,, yg .f,:g:-: Q' : :: 1 .1 5-i,:,E2' 1 E5 :g25.:-2 .- :. :g i ::.: .j: .5:-:: f?s2 a:,::g :.g:,,::g:- 3: . 23532 -52 sf If 55221 .. f2'- 's2f2f 1- : - : -V :1 -5 is ,- 9.5321 E:-2:2 55:2 :Fa-..5l -Li .: .W W my g:'2':::: f 1 .::.'-':-E,:: 2 VQniwsmggiv,QQQESBBXSQESSQLQQMQMAMWZWW M' ' :f:3Q1f: :' ,E 2-'13' 2?fSi2 i2:?f52f'ifS av ..: .... H.: ..-.- .. ,.... My ...... ,. Q gm fwaw .M W. W 32?-nw W W .'5xs,,3":,5:"Mgf:w1-gsQ..:Qf.iSE Wa. :,:.:g-:2g:,':'::-,:'::.:,.1:': :'-:.: '-" . '.::':,: .: - T95 4-.5-,:-g,5::3:j--.-,Rm me-. , gwwg gix gn Qfwziigwfggpwg fiwggggg-5?f" is W' N - 1 ----- 2- .- emma Hmmsr.-.a::::::::r::1f::x?iM ga.-msazsrtmp-faves. - - is S : i:. ..:,Q-: E ,j mj wsixi? M '-f.1g ,E :'::'::.".:.::E E':' ff2..:: ---- 1 -5225151 2,5-,2. .3: :3-.-2-gij: M x ggjzkagmWsgfzfgfw:wsmgggggggligwgggzywqggggiw Q: - -s -.f s .. . .: :img 1 .- : .....:.:r:.,,..:a:w: YE Mfg I: I...E -1 :5- .EE 32" 2s1 11 Q'- :fr i mf: WSW :Q Qgmmgigfisrxs wwmhgbaw Q' W UQ 5 K Q ml W.. V " '-W a l: " ' N w w if A :Q M :Wiz- -SS 5 QSM Q g :awWfsg:Qfss Q.gg:smima::.:f::::f:3a::s::.f:mz.:::?f'::.:.a::wigWg:E:sAs::3E53:?gSgSS1f12::gswgpsjgggfg pgsgisgawsggaggm 5:wMm:'g,m:X.s:fx:siszafswiwsszsvzsmsxszizfzefz:::f:2:f::':::zfm.i:.,zv:.S:fa:s:sQ::wwMM W am' :W mv W .. was ?"'?TM"VP-N'W"bx 5 Q z:gswsNsEig:.,ggsQsg ssgs 2:f:':sQ msegifgk 2 K 4 Q W R Q35 Q, :Qmggm gmvrggmk BM . ..::Q 15.51 :.: IP? . xi?-T 2, X W .m g ,wig N5 Eg? .1 .M Q 5.55 .f ggi: 555 wg i .:, fi i ,..mgjglE:Q'.Qg?gQEs:::EQ 4 :, 3 ,5 gmgQQ0.g:......,, .fsmgliigfia , , ,T ,..w1mwmQ.,,g ,..wi::?Qz:2:v',:uQ..... Mkwwwww W .lm M1 ' Zw? aFm'aQ ' A Sp U MM wk, . Z1GZaSZ2mM,"b',?j'? HWQWM5'AH3 H J' WM ' X' Qwwwxwwsr 'rv e wwQi-55w.f5l12Hi?"Z3'i?W'wwehvwmw W W' ' Y 'W E Q. :asm 2 Q " bg 51 qmvw ' wwzwgumvszmg , ., 'E 1, sy gm K Y: N If M 5 . Q ff h w 'Q .- v .-.. J ' ' '- , - A z Kim Zak H 4: 1 .... ..-.L .4.. .x . A . , , , 4 his Qwnwwm ff, am. wig M.. , .. .M M wmim.,.....,,:m...s.....,zM...mJ-1 , ,WM......m.g...., . .. Mgggss : . ..-. 5:...g , :.:::.: 5.,:g::. ,s'f:5 .Q-r ..-:Q M X, 5 ,E 61555533 1Bfi:3:.:Q,?g?,g5::5 2 , G V: 4 11 gg, wsmgmwqwieipaii, '2'2ZxE..'5CS.:a2g :::: : -K ,she , .. Q. gsm s:fzf::x:..f:.:s:sas..:Mea.kiszmfssa'::s::fs:::a?2W?f25-Q52bimmfcssmzs W : . 'sw "'2'S::M.:m:a::,: ws Ga .: -E: :-5: -1 3:Ef:i:5f:Lf - 5:-3: B5 K E : 5: i ':T' :gmbg E532 mmm? gas... 1-':' f Ef i:1'1 2 Haabaa' b m'35W?'e ::-:.'- ..: m a j , qgrggqgggwggq M :f2EL1Li.fZ:l'IQ..Lf:. .... R I ---- ---- : L:-J: ,. ...... . ..., .... : :.:E:.: .,,,Q., .,., ,.., . ' "" . ..... -. .' 3:?-fi-3-7: ::: ., .," .:g5:5:,5 ,.,.:...,.:5:g.,: -' I' -jEg:, .. g:g ,E:.: ': :5-:,.,,.j:- :E::g:2,:5 ,, . ..-.- W 5 . .. ::- Wai: '-':' :5 ::5E: 5 .,.,.,. , ..... . :: :--' 9 ,. - ::-:5: Q 4' 'W' 5. ggi m:f:ig:. N Q . ff: Q. -s-::': ': ..:.-:- 'S J' f 'uwzfg .. ..,.. Q lex.: i xgu. N iff ,,.,.. :M A .. I' -:-:- :- 1.-.leaf .-:-, is-::::.,:5:::-.: .. .... .., ..... ... . ,. ..... , .... Q - Wy gy : ...: : :Q 22 E eff ? as 5 Ei K . .- .- 1 s 15 6 V-uf-: :----:---- , 9::: .a:r ...-., 3 : ....., .- :.- v i :E V , . 331:23 5E f PEP : E 5 fi ..QE1ig5,E S5S W gg i sisi gii 4 A Q 5 is f 5 S22 2 : .'vg . ... W! fir: 5 2:55 v s fz' 2 9 . S 4 5' , 9 ..'.: :Zi- : .EE Mig gwm fig EM E55 -:,: bf 3 '. ,,., : W . E 5 :E:,5gggg . 2?i.Eg: Ew ggigeiggj igi g gs 9.5 , ei 2? gg ' ff -2-2 W X :W-: --:- :-:-- : f :-.: ':if: .: .::.:: 155 szi: mf rf- ::.:t '-'- 5-g:::, :':g,:5 .,... :,::':'.:.. .: M -::- :- QE H , ...-. ..... . 5 ..... : --'-: img H2 .., . .:..,., .,.:..,.. . M .. .... A - 1-aa Q, 2? 1523 321512.25 12 s ,jfigggiaii EE xiii 1251-515 1E E, 2, lfxggg ,, si 11- 3 s. -ff ff 11 1 .... .4 A 21 .... . 111- 1 22. ,1 31 ,15-.-...:-5 , 1 , , 5 , F 1 14 L .,.Q,...1qs., N, .,,... ...,.,,: 'Q ' I 2 M A we 11 Jr., ....... . K nkotz i iq wil? zswsfw-M-img:-f1--1e,1:v111-1ass:1a1f11cs1:-wwe--'15:1:f11-was 51:51-'W ---'-hw r w -111 -- 1112-121.11f?:::f3wws-31 ww. iw, Wm 1 1-. ------ 1 .... ..., 1 E E E553 gs 5552 5 S'?'E?'3gfwiimfffm13F,?fS1vaW254b-w?'?5gGaa1,g-W .Q ::'::'.:Qs'?:111:q-2.Iiiwwm-:1:. 11-115-1-1: ,SW ff -121 1111. 1 P3 R1pE'1bA11 gk:111.Wi352Mm' Qs gy 155' Hb we-:SNFSEN :-1.- 1: ' .:f: ----- S1 :- 1 '1.2:':' :QQ-:::-:-:1-:-1 -Q1-. 2 N 11 H gg MW' 51 N 5:3152 'E N55 5,5 552235 ,111-5 E 1 -'!E2::- 4 I 1 1 11-W E ii 1 - 1 K W, 9 .,.. 1 11: -M - ifwm 'ik W 'S W 5 --,. I " QW 3152: -121:1 2 ig-1.1.3-11-1 .-E' -g 15.:.5.r- J ::"-1:- 1.. .r1 1-1-: :.: ,- 1:-.,-Q, -.-.- 1 -g -:1:1-13.513 ..... 1 :...,:11.1:- ---- ..... : 451 1-311x111 .112g4sf.,1-' 23,2 511,-Q ..... W my .-., ------ V ------- ------- I 2.1I:Q.2-1 " ' .- ..,... ...5.. .,,.,. , 11- 63"-f aww 'YW M1 Q, uw ,K EYWSM ,mg ' ff ' W' ' .-.:Q:-'g-- -' W 4 -.,1 .,.... 'I:.Z:I'. -' 12.12I'.,If.iI,,IQ.,.Ig,-35 1,212 --'-4 .1 2 . f:I-"- -1 1 "" , G :i-ff.. " ' '-"'- - '-22 :I::Vff- 1'12.2?!'.In" 91.1.--H?E5'5:':'1 :---'J-11:1-1 EVEEQ1.. -E'Z.5:' . . 1 1 :- -- ..Z 11 '. - 118.141--11111-11 15 2:11 if ..... 2 5 " 11s,,' 3: ga g 1+ 'Q 11 Xa sw W + -1 1 1 5121 at . 1 M' a :1-.: f r-1- . i i i 2- Ei' - - :f-5 E':5-1'.' -122.225 25' 5:53'-2ff1:?5'5E1: .:E' 355: ' ' wk X 1 Q ,w 1 Q 1 um?x1 ,sS , S ge . Eb 1 1 2 1-1 +R-9 is X 5 .555 5 1 as . -5 5- 53-E ml . '3I'Z'.'IE :YiQE2,.If1EQEf:'-5--5:55w1E'IiII:ZI--I-5:-'.::I:iI.IfIf'.f"Z? """'2' -:':5: if 4. :,.:.. .,. .g,.g. 5 5 ig 5 3311, 5 9 Q 1355 X2 11:3 1 P g Zig 5 1 -f Q 53 21223 1 11 1 1 fqiixfg ff A Eggs? ,'?1-:rw Egg? vi ik 5 f 1 M .I 5535 555-+ 1 .,,.,... N. 1, .,., . Wi K 1 ax? 'S E' .... wwe- .- 1. 1, ,... .g:,,- :g 3 fag gf Q X9 ,11.11111... 9.1 w S za .we ax 1 553235 --:- 12 .,,.. 1 5 553- sg 1 , X E' 5551 as if if vii - K I2 - ., , 2: -.21 13 1 1. I " ., f 44'-' 1 5 -. .-- -, 1 g. ,z 5gg1M g::a .1-11 3:-1,151g ,g . 1g'g: 1-.1 S11 1: 5 g- 1 1 - "" 5g:e:2?3X-?J::53:sw5P22'i-2252555311125215511115Riisffzgyig-1'-133,1 gg- 1:-.:.:1:1 1 .:-..:- W 111 1,-1:..::. .v 12-22.2- .:.2 - 1-1-11 .:'.r- - -f-ff'4s? -'-'- wx 11'-11521 1-1-1.gs 1:,:g .-.1.-.21- 1z'1 1 1- 1 ,,- 11 11 1 J 2'2 -'11-.--1. - M: '- ' gg WI'-'.'1-1 - " -' ww . -3i 'i'- 535555 in 59" ' W '53 'K ESW M 1 -'-25 5 - -125 .5 :- 11 .:5 E 1: .QI :s ': 5' - 1 .if1m1.111a2Zmff:-zwi:12.?S:?'-'11 1- 1 'llsiwf-fgamraz QafvvgviixfiilsmiiilgfWigw34Xfi?'rD'Yz5v?i312fQiZs-55353915 if 1 .. : - R: 215 5 512:-:f?S32fS:-:Q 12: 1: isa - '- A M. 111 - -1 argzgwWA-:ggg-1.11..,11z::2:1:11,:sgwf1111,1agp-11111121323Qg1.1fi::a.s:ggQmQg11.,11,1gg+1:g 1 ,Q M f M K ,QQ w -im. i9522W:Wl15?5i:1z:'-- Q- W-2 Wiisil -I a "" - " a n 2: :'.E1E- --1 2E.2 .2: Exfs1f5K2S5:sfFilwiifazswifiar xii?1if54':g:gg1s:-zizgikf R255-iglwSETifQ5?RS1 wfl2S5? V W '1-- Q ---- - N .1 Q ,M 1 W 1 1 11 - . pggliwe, ,Q -H 2 1 - 1111y,rH,g421-1.1 N 1 11 1 8 2-5 um- W -1 11 -1 :-.--1.5. A 131- - Q' . -Ag :'-1-53-.jv-.j.1..:1.'.:.j.-g.::..' QE! Q H: -. - , QW ,W -: U yw 3 151 1 ff' : 12 1" ?1- ' f- 1 N f 1: 12 ' . - - 1' 1- 1 11 151.---1M1N1.1-.-1 -111-'-.-111m--H1 .... Q, 1 11 11, - 31 1 1,95 135355111 151,15 51311 - K-':21-'tWf1:-- 11-' 1 -' l f 2 - - 1 f1S:ss5w1z: gwsswfwsfm sszrg M2251 W1 - - 1 - H - 45f iQ1"'2'f'I'- 5-5 11 7 3121 ' 2 1 1 H .V..... , . .... 1 .. ..,i-ffzbwwm., 4+1Hvw?wwwmX123-PM1.11i:gww1w.mM.11i?1S351V piggy , 1 xp .11,.1.x-A QL., .... 1 11.11, 33 W Q5 ,www-frfifiififszsrpiiirswfbhsf15fswsffwiiiwwfBk1ES,::2mwfQg:,?w115QSB Pgggbsgxgw-+ 11' , :.1.:' :1.-.-1311-1 Q ,- 1 RK A 11 " "9'1:Yw i Q,,gw-b1"?f 1 My .. , .. -qw 1 11 .1 1' A If , 111 . :A -fb'-5' - 11W-'mvg ms r l liiif -W ':':"-: 1 1. 1-1:1 --1 :2114-1 mwbawiws WM: w.13Z1lQi1- --V?'2'1-gwwwgifs' 21-Fsfigkw Zfiifl- Q:-1 1- : E' 11 :':l-.'Z .xm as :1 , I J' 21? 'ig M1 '.-. 3 1 -'::ze-5: -. Q11 . - M --' - E55-3 X -1 1 E i f fg sll sgf :Mg 1 11,135 11, W, 1. -55115155213-fgg2iA,:g1,,M1g.f,E ,tyzgr X13 A, .... , .- g 1 1 rf? 11 . 1 1 5 5 V 1-1g 2 11, Z., 1 . , I 3- 13-11- 3 1 H S 4 '- "2 'fig :Z f5:w1m1v11:x1::1ww1,1 1- flfisrfwhvi Q., fi z sb-aw1, v ::' -'s-w, ?xFa-vfs-311114111 335531: M1 1 :f w S1 iyifwwvwsigsfgg-f?"12S2?iZ,: ffi?i?ff951J'-:Sky-1?e1l5w:M12I3,.1,.'iww1B"Z Q "JF "Q'1'1:'2r--"f'-1:1.:. --:222:-:' -. 11 5 1. :':m:-:- . ..:,:,: .- ., 5 : 1 1. 1 1. E- :gr gk , ij--11 - - '5 5 -1. ai v i 3. E. E EE 1.155513 1- 5 ,, .- as -f " E, 5 5 wi Sis ' 3 .- 11 13s- f,1 .:zzf12 2f-.112 11 1 .45111 1 -"f'E1-525 ,- .1 Q? 7.2 5: - 'Y I mmm . gb V mu, Q 'xg . 0W,1S,3 W nfl. Q'-fr? 'VKSQQQ-1 fe .9 W 1 , V ' 4. jffvwl- - -1- 1' I, 5:I"-155111.52 '. , I' 52, -: 1-. :S 'fs-, -5 Zf5f.,,If?-31-54-2 :i.:I',I,'.gIgEg -:--I-I1I.:I',::f'-2Egg? 3 :'::'-:-5u:- iii'-aw1132223-QGfi31?YXSS'4'g5fg'?-failing-A l'5Sg'5b4v'5S?33'S1gPgQj5?l:f45w? 1 fm .::::-19? -...ffizzfzfaz-. 355213225281 WSW'-Efswm "Ei2111,'-1 5 5- -Q y'11iamgm?Qf1Tf-335 5-Qlffgiiw 1-I-2"' - :- -12 ---1f :r :.2::,-2 "-- - . 2-'IiT',1,1w-MM' ..a.1:f:- 1..-.. -'-' - 5,1 1 wqimwx 5? 5 ,M P1,m1 , s12 11 11 ,, W , we ,:.-.-- 1-1 -111 :::1::'::a,:' 1 ,:,:, ,,gg-vm -1115: 1.1.1 5531.11 we 1111.3 is . , 1 - --1- :1-zr fE:.2:1-i12'1E 15 -11- .115- - 11f.f -1 .21.21'.1"11f-1:1-11:2 g3D'7'?52?W :- :: 1111.. 1 1-.1 11 -I- af-I M.,-111, WW 11111211 .4111 11, M .M W111,,.Ai1,,11,, 1 Wm s111,1,fM1.Ww. 211111319 11 13.1 M .. W m y 1, ,332 was -1 - - 1 "" at- '1:.2a:.1::--112-if--1-:fi fl:-:am1F535:ev-1?Z2i1,1:f'W'2-f1ffafsJ-1-2-V - .2-1-1- 1 -- 111 -1? ' wtf.. 1 w2Q211f1,.1: 9'??m,w11f1-S2 , H -- 11 11. 1 .11-91:1 1,4-zxfzff-M1221-11011111421252-Mw,.f::25 w 1152-.:,:'i11f2"i'a,1,N1-113111 2? Mswim:'-fwmqwfmzwwwwqnuwmgsswa 6211 Lv. -:5g15X?1f::S355fffm5521-1211-z:s?1zif-Q21--12's21"sf2f.:-:Qz:::::T?Wfi?::-A5512-2-122-5:13-1955--2: 5155- ,WQEQH-2-Gflmw-ggwfawmgkwaw "" I r1:f:1fi- -.r1.1:-- - 1 f- -""'-"- -"-'- """ -' 2 - 1 ' as-is szm .11 1- 1 1 1 , 11. 11- - - - 1. ,: .-af t ' if 51 Q" ?"' 2 W 51331, Q-ww W Q111'1"JZm.1m -..1F.v-""- -'5- Q11 mg? . 'W V EW, 2- 11:1 -S-1!..4.-,-- -G-'W1-1--f-.-,:1:,:-:'g-1-1--.--1--1 -if:.:.:- .. .sa 11:11 - 1g1w?,11f55g5EgfQ,?3,gg 1g -, -11-1 15:1 1561 35: . H 1 .f111- 3- .5 1:- I .,.,.,. 3 " M " ' 'W .. -'f . -:-1:1-1 0 1 -1r.1r11.-..:-1 .- .. M -.:-.-::-:- .. 1........-::.:-:1-:-::-.1 -1 .. fs?-M1 302 1:1-1121115111 'X wwksif mf :-g. .1.1 - ,,1 -:-:-1 1- 1123"f 1b 1,-?EgS:wf1sQifX'ggfmy?:5fKwik Hmfwyf W g' - :f:--1-11-fi f'.-.-.1--1:1 -ff W'- f15wfww1,fmv""5yfmgw Jw 1113 XQWMHZ sf 5225520-2551 ,za p 1 " - . 1' 'WE 1 N f vf :'1.-1 :5.1:.. ::::.:'-'.:1 ... , - .1 1. :.,5.,..--621112-11:11:1.151:-:.,.:iw 1-1-511-?1:1,1g12. 5 1 1 - - Nga .- 2 1 M- , 353S35g1f."1iz'WfW-M., 35 ff " 1:j.5rz2:2.:',21f1 1-5'11:2:11,1:fxh ,5., , - i n f'-'21 a b dg 111.11 114 zwmg ,Q , i 1 1.1 W a11w1w111.1Q.1L1.,-1, Wmzme -:Qi ' A-f1-f1.1V1,11:z...1g::aQWgg-affa 2f+e2:Wg1S2::gf7r,:1g?:iei2ii1f' 551ie j :Q2'sffa2sw M2fH1W13G2:,f:3:gk- ., ,,,.. 1g11Z- .1.,.gQ11- 11p.1- - -M61 35' fQ? ???xg5?R -I-- .- -1 ...,.. -151-t .,..1 .111 -- 1,2 2-WM 1 25' "" - bf 2- GE 2-WlififliiiiiifzefgfQEEEZQAF5-Sisgiiis+1551221:555ElfgwgigiWwggggygggsgsgggggigggqggilfi . ? W x11w:vFQw53WSEY 5355111011111 1, :'2Wi:5gm-1411111 3565411 11,5 Q: gm' 31? 51 W3 1 Agfqw-w1wm.1311'N'5,2d'SWV V 'Q' -.1 10 -..:.:.,:1:-1-1:---1-.-.-Q..-:f1?,-11---if..-1.11: ---- 22 few , 111531 551 1.1 Wvwgw 0,1 Q, we , QQ F fn Sw 'V 4 1 1,w'1"f:'w'-1.1 1 , V 1:0112 1. 1' vw -- wa .. .-1-:P-1--1...1..1: :-s: w--W11M212W11w11112fQ2s-S1 5--2-9w1f wfkfwfm wiswwesgev ,W.?221,w1ff2gw'22 zwevwmsp 5 ,55 11121-0111W11m1.2v-W1?1f-'W' W -,Je www! 11-SW"-13?1111f.s1,gLffe1f1 12 26112151124-1111101-'Z -Agg,?m1sS4.sW' Q E A WQSTR-Wfd-fMM.aZ'??'gV?a253.31551WigsGN2v5gM1w?i?25.Ns1wm:?W3w'11Q.:'-ff,,f'-'wiQS-'vfH"2Si?-flQ'Zf'?q,"M'w'3,2?,a1 H ,..,. -, z111,.11i,'3?SB?waX11 g1fMmfSg'3x:fFm glvsgwiiti? wvwzisgswgg 3-fkwopeifs? 1551 .1-1- 1 1 --1-: WMWV rrv w v -1.-1 -Qggwfsww-51559 Q21 wgw-19 .ig-"j'f 'WH wwf, 'W-9252" W 'W-fm wi 'P' M 1 Q .11.:,:g-1 1 fm' Q5 www:-f3mR?H S'5fWffisi2:fig1sz gaaifffsimggwfw zfvf-fm-ff-1 11.1 1 1 'Bw' L1-'rgaaggpf "" gfv 1- its ? 11151 22 EEE -3 2 -1 112 V--E2 2? 52 Q f J ig i Ei EV! 5 53 i is iii ai? in f-Q. H ia - ii E 33 1 - 25 L if is, ' iii sf-X153 si X gg E Sig H :- we .N .. .Z :k1gi1E' IL: viif' l 1. 'I, 111 11 W 115' W 11.1 QW 1. fe i w 5 .1 ' 1: gggf gag 1 -Q 1.. v. Qi gf vigil m kgwuiamglg, Q5-'N GEQQXSX Sf Rig 1 5515 1 .11.e..,, ,1,:, I: I ..II Ek! 11? .5 .111 .... , . 3 '1- E ,.,.. E 3-1 fa. S .1151 . QS? 1: g Qi 5 in f 3 2 4 Q 2 3 -2553 1524 gig ig Q Q5 ? 113 , giis 5 Xi E! 11- i f mi? JUNIOI? OPENING Glen Dahl, Nancy Benham, and Dan Overlon were elecled lo serve lhe junior class as presidenl, secrelary- lreasurer, and vice presidenl, respeclively. Juniors Clmo Towards The Top! "Sluck in lhe middle!" was whal sever- al juniors replied when lhe Pacemaker Slaff asked lhem how lhey fell aboul being neilher sophomores nor seniors. The juniors slarlea' lhe year by elecling as ofHcers.' Glen Dahl. Dresidenl: Dan Overlon, vice presiden l,' and Nancy Ben- ham, secrelary-lreasurer. These slu- denls' dulies included collecling lhe money from magazine sales and selling up commillees lo plan lhe Junior-Senior Prom. During lhe school year, such aclivilies as selling magazines, promoling school spiril, and planning lhe 1980 Prom kepl lhe juniors on lhe go. American lileralure and U. S. hislory were jusl lwo of lhe required courses lhal kepl mosl juniors laden wilh home- work lhroughoul lhe nine monlhs of school. January broughl added malh- emalics sludies lo juniors in preparalion for lhe annual malh exam. By lhe end of May, lhe middle class was ready nol only for summer vacalion. bul also lo Hnally be "ON TOP!" .NNW xx kk Tammy Winkler and Teddy do some independenl sludy during a free period on "lillle kids' day" during Homecom- ing Spiril Days. 2 My 'wr ' as ,W .. . art? . 4 X Q 1 R: tv Q its af -eff f 49 2 Y ' 2 'K th , 55 " 1 2 X I ic u is in s , Tk 'ny f 2,122 2 Q- uai? 'X l A sgif AE r 23,1 Af Ja Elva Acosta Lesie Adair Vincent Alberta David Altenbern Mary Anderson Paula Arguello Dianne Atwood Jeff A yres Sheri Balken Monica Bass Theresa Bauer Jo Baughman Terri Belhasen Monte Bellis Nancy Benham Tammy Bertline Jina Bishop Sherilynn Bollacke lohn Bragg Stephen Broczko Jerry Buchanan Timothy Carpenter Teresa Cavaleri Ronald Chandler Davina Chappell Layton Clark Nm Clark Susan Clutter Sean Colgan Carol Contreras Lydia Contreras Craig Cook Gary Covelli Howard Crandall Debbie Cyprian I' Glen Dahl Roberf Davis Shari Davis Ricky DeFries Lydia D'Efiorre Bradley Dilli Cynfhia Dominauez Susan Doolin Brian Downing Curiis Drew Peggy Dunning Jusfin Eisenach Jerry Ekberg Eliseo Faz Jane Fehringer Paul Ferguson Richard Ferguson Douglas Fillingham Gary Fisher VWlliam Fries Barry Geisf Clinfon Geist Donald Geist Chrisfopher Gibson Roberf Gill Anfhony Gomez Reina Gomez Andrea Goodman Tad Green Michelle Grifhfh Gemme Grooms Jesse Gufierrez Lora Hall Tamera Hamilton Teresa Happel JUNIORS . fm - ' . , ,, 7 , rw,-fl-,ll is :wylQWeX?VfEQQQFMiW Mrfrwwwas+,eWW we Vw Yf"W"'7 f G Wlsl n I f , Q ff 'ug Ar, f F , f y 4 gg y f 4 f f M W Za , r f A f f sz 5 Z 1 'HQ fi f W! X? rf f Mi l S s f f if 2 ' ia, ' W 'v ,A ,fe e," ,,- is f eegngggg gg A WY . ,,,,,5, ,,,,,,,,,A,W,, , ., .bmw-rw f gp' ',,f,+ :ggggsgyffffg ffliiiwmfi,'l52r,2fffg:Wi5S viz!! f , M - ,-'ff zu-1"-' Vw-' 1f'ff'1"f-fri, if ' ff lrfe si'rss -'iz ,U J 1 AJ ,f ' ' 2 f if HW? 1, , ,, 2 A I B 1 A , , J, 2, 1 ig 2 92" l AZ" ex' if gp , f 'Um 27' Q f ' M 6 'ijg-'I : . 3 wmv , 'sv-Ea, uw- F F35 WW 9 , K if X Sw .,-. 1 .gf ..: f u l, I 1 E .fr ' W2 jk 14 ye f f-"rf -, ff,, ,,., W 1 A W ,- We V ef ' , , K ik .. M N4 72-" w K X i', g , immffi , mem! if M.. '?. i 5 yy? E A Vg W .,f, 1 rff, I ! f! , W I E M Q X 2 7 x R I N - N 1:2 ' i,, ,,, , ,,,, 2 lhsll Q... .ff -A gohn Bragg and "Cinderfella" Uohn Spofisj in "her" oofball cleafs enjoy a fasf dance during fhe Home- fcoming pep assembly, Juniors Ring Their Bell "We 're Number One!" was fhe juniors' chanf fhaf could be heard fhroughoui the halls following fhe Homecoming pep assembly. They had good reason fo be proud - - fhey were lhe Hrsi class io win The new Spiril Bell. To be awarded fhis prize, The juniors dressed in buffons and bows on one day and as lilfle kids fhe nexf. They also pul on a modern version of "Cinderella," and had The loudesf moufhs during lhe Home- coming pep assembly. Spirif Club purchased fhe casl alumi- num bell, which cosl 615000, in an af- fempf fo sfarf a new fradiiion af FMHS. ll was Hrsl awarded fo fhe juniors for accu- mulafing fhe mosf poinfs during spiril days. Af every pep assembly following Homecoming, lhe Spirif Bell was awarded fo fhe class who was fhe ro wdiesf during The assembly. The class who possessed fhe bell on the day of a home game was in charge of gefiing if fo lhe game and ringing if when fhe Musiangs scored. The Class of '81 will be disfinguished as The class fhaf sfarfed the Spirii Bell iradi- fion af FMHS. Am y Harris Deborah Harris Donna Harris Marvin Heisel Tammy Heizer Scoff Hendershof l?ufh Henson Kelly Herbsf Rodney Hergenrefer John Herrin Michael Herr Anne He Hobbs Daniel Hoffman David Hoffman JUNIORS A WA IPD Krishna Hoffman Maflhew Hoffman Danni Hoibeck Gregory Holguin Tammy Hoy K Kiass Huberf Shaji Jacob Eric Jensen Lee Jensen Frank Jimenez Amy Johnson Becky Johnson Jonalhan Karas Susan K eirnes JUNIOI? MAGAZINE SALES Junior class presidenf, Glen Dahl, receives his class- mafes' magazine orders and pufs his arilhme fic skills lo use. JUNIORS KNOCK ON DOORS This year's juniors knocked on lois of doors selling records, rapes, and maga- zine subscriplions fo earn enough money for Their prom. The lop seller was John Herrin who sold 8247. 75 worfh of ilems. Don Kembel was second high and Kaye Yearous, Greg Holguin, and Barry Geisl, followed re- specfively. The juniors sold 84596.50 worfh of ifems which surpassed lasl year's lolal of 84585.91 The class was able lo keep 4035 of their folal, which amounled fo S 4838. 60. Mr. Blachly and Mr. Harden were spon- sors for fhe sales fhis year and were in charge of disfribufing prizes. When asked how he fhoughf lhe sales wenf, Mr. Harden answered: "l was very disappoinfed fhe Hrsf week. We had probably fhe besl iinal furn-in day lhan in recenf years." He also said he would like To see more parliclpafion in a class pro- jecl like lhis. fn Z ,?.-. x, N x X Y Q 1- 'l , 3 N3 X gs r N-...J D 1: 1 0- fs fb ,.-f Q L if D x 1 xl- 1 ' KX! 6' , . K I' ii., E ,, J . g, I .ri an , 5 L A ff' . z L D K f g X 1 2 A .. New is X K I 52. .-.41 'Q L S s o 3 . W gg ! 5, Y 2 , . Q i . L K 15' ,xqfix D D si? E . , 1 sei? Ms N Q L L hm S 4 is .rf 'V' " Q x , 'Z' 131 he Karen Keller Don Kembel Sharon Kinfner Shannon Klindi Harry Knaub Kristina Knapp Vicfor Koehler Billie Krehmeyer Van Krening Tamera Kruger Cheryl Lebsock Thomas Lee David Lefever Jana Liifljohann Lori Lilflejohn Tamela Loose Chrisfopher Luiz Diane Mallory Andrea Mandes Mark Marick John Marlin Theresa Martin Maffhew Marfinez Vernon Mauzy Diane Mavis Mike McBride Donald McCarfney Shawn McConkey Laurence McFarland Krisfi Meece Angela Meininger Scarf Melloff Sfephanie Mese Jami Messenger Jusfin Miller JUNIORS Tami Moeller RoseAnn Morales Randy Morgan Janine Morris John Morris Larinda Myers Russell Mylander Jody Naberhuis Judy Nukaya Gloria Nunez Toni Nunez Terri Nuff Daniel Overfon Debbie Pankow Mike Pesall Lori Petersen Bradley Peferson Laura Peffls Carl Pifman Susan Polacek Kelley Porfer Gregory Preston Teri Price Rodney Probasco Allan Rader Thomas Reagan Dean Reed Graciela Riojas Sam Rockwell Fernando Rodriquez Richard Rodriauez Kay Rolh l-lelen Samuels Rodney Sassaman Bradley Schaefer JUNIORS A R . 'K A. asv-. ' ' 5 is S A2 l' 'i,.....r Nw., rs R' M x i E xi . if - , 5 t ' .1,' Q ..,.,.. 2, X rs ' " "f' Y E. . i X ' E1 Lori Wilson smirks af Mrs. Keenan 's mix-ups in 'Ameri- can llferafure class. Juniors Arreno' R eaulrea' Classes The fwo mosf unforgeffable classes for ,, fhe 4979-80 school year, from lhe juniors' in poinf of view, were Mrs. Keenan's gg S' W, 'American liferafure class and Mr. ,,,j?Q'qsl Pfeifer's 'U.S. hlslory class. All juniors fake 'V F 2 gg 1. 'jggjsgx QTL Qi fifdi -QEQSQQSY Q35 a U.S. hisfory class of some son' and mosf lake an American liferafure class. One of fhe mosl hilarious momenls in Mrs. Keenan 's fourlh hour liferafure class was an incidenf concerning Mrs. Keen- an 's mix-up of "Buffy and Barfy" wllh "Buffy and Jody" and "Chip and Dio" wllh "Chip and Dale. " Playing farmer was an unforgeflable momenl ln Mr. Pfeifer's 'U.S. hisfory class. Sfuden ls chose whelher fo planl crops or buy liveslock lo make a living. A few slu- denfs wenf broke, a few ofhers sfruck if . rich. Mosl sludenfs lhoughf if a welcome change from fhe monolony of hislory. Even lhough fhere was a lol of home- work fo do, 'American lllerafure and 'U. S. hlsfory classes pro ved fo have some memorable momenls. fl sg is ,Q E X xiii aw U' M f' is Noi Picfured: Class Sponsors: Sirena Nichols Mrs. Keenan fheadj Mary Rodarle Mr. Hochanaael Jesse Sanchez Mr. Hollz Mrs. Llndell Mrs. McGraw Mr. Powell Ronald Schaefer Michael Schmidt Glenn Schriener Rochelle Schriener Tammy Sch wlndf Sherri Scoh' Krisfi Sears Mike Se wald Michelle Shivers Dan Silz Glenn Skinner Candace Smith Jeffery Smith Susan M, Smilh JUNlOl? CLASSES Susan l?. Smifh John Spoffs Holly Sfarr Justin Sfone Chris Sfro yek Lisa Tee fers David Temple Linda Temple Bobby Thompson Maffhew Thompson Garreff Tibbeffs Roger Tibbeffs Sheila Tiff Susan Timpe JUNIOI? MA TH TES T h 5 V 1 if J S ' if a j A 1. is jx- L J ,E ha :am , sg! . sg-1 -:'- - Xwsw-. K. 3 lg fi T W W if-k"' .3- .f - 51,- Jenifer Warren prepares for fhe required mafh- emafics exam. Juniors Fear Morh Exam For years, juniors have dreaded fhe re- quired mafhemafics examinafion. There is reason for fear-over half fhe class usu- ally fails, which means fhey musf fhen fake a mafh class fheir senior year. The communify feels fhaf FMHS gradu- afes should be able fo calculafe every- day problems such as fhe in feresf rafe of a car. As a resulf, mosf juniors fook fhe required mafhemafics exam in January. The exam was lengfhy - 400 ques- fions fo be complefed in 55 minufes. Mr, Harold Lee, head counselor, said fhaf many sfudenfs fail because fhe y haven 'f faken a mafh course since eighfh or ninfh grades. The mafh deparfmenf offers re- view sessions preceding fhe fesf buf mosf juniors don 'f realize how liffle fhey know and don'f fake advanfage of fhis. Mr. Lee indicafed fhaf fhe fesf could be revised in fhe fufure, buf unfil fhen, juniors will have somefhing fo fear. EX' Xb sf!! "QA li 'I ' x I if W is 33 is Q , . f X A is x Q, fl 5 me MX ' will I K Y, E fix, X V 4X 1' ix vs ' i K , x .. ,I -.r 5 - B , we Elks. R . Bryan Traxler Gina Uhrig Howard Underwood Diane Uresfe Raquel Vasquez Kevin Vaughan Karen Viefh Russell Vondy Rhonda Wahlerf Shala Walker Sfeven Walker John Warfelli Jenifer Warren Donald Waterman Lynne Weber Carrie Weimer Keri Wendell Glen Wesfhoff Monfi While Susan While Donna Wickham Valerie Widener Debra Williams Leslie Williams Lorefia Wilson Tamara Winkler Jennifer Winter Bryan Wulf Kaye Yearous Mark Yearous Linda Young Mark Young Tammy Zambo Debra Ziegler Brenda Z welzig SOPHOMOIQE OPENING T T T 1 Troy Bohm, Amy Helmberger and Brian Rosener are The sfudenfs who were elecfed by The sophomore class as Their secreTary-Treasurer, vice presidenf, and presidenf, respecfively. Sophomores Move ln! For The Class of 1982, The arrival of regisTraTion day came all Too soon. MosT sophomores had mixed feelings of The TransiTion from ColTs To MusTangs. Regisfrafion aT The high school was found To be differenT from The junior high. For one Thing, fees were much higher Than The years aT FMJH. Fees for sophomore sfuden Ts usually ranged from 330. 00 To over 550.00 for Those who Took driver's ed. Junior and senior members of STudenT Council held a Sophomore Pop ParTy in The afTernoon of regis- TraTion day. AlThough The aTTen- dance was low, The sTudenTs who parTicipaTed had a good Time. They had guided Tours of Forf Mor- gan High and were informed abouT The clubs and organiZaTions of- fered here. The Tradifional week of iniTiaTion followed regisTraTion. The Sopho- more Welcome Dance and Kan- garoo CourT hebed The sophs gef seTTled inTo The roufine of FM!-IS. wswxr- ,,,M.f-N,.,, Cindy Blachly receives her punishmenf during Kangaroo Courf as parT of Sophomore lnifiafion. Q ft n-X Q' '1 Msg, I .' w z 'D if Q' 'Q woe . Berfho Acosla Mike Adams William Alben' Lori Aldrich Ronde! Alles Theresa Alfenbern Roberl Alvarado l?oberf Amen Tomera A fwood Michael Bollew Craig Boss Shelly Baumgarlner Rex Beurskens C ynfhia Blachly Jeffery Blecho Audrey Blelch Erika Boafrighl Herberf Boehm Troy Bohm Deborah Boroughs Kevin Bolhwell Arvine Bowen Barry Bowen Brenda Bowles Donna Brown Jill Brunkhardf Mark Bryoni Roberf Buchanan Lisa Buell Jesse Calderon Sondra Conneld Leslie Carson Robin Corfer Gregory Corwin Sandro Chapman SOPHOMOPES Brice Cochran Eddie Colgan Tammy Comer Diana Confreras 'vi , 1' g W , M. Lorna Christensen , . if Ceee 1 3' , L, X if . X Joseph Confreras Penny Craig Timofh y Crandall Lisa Cranford Michael Curfis Mary Cusfer Shawn Deal Terri Delfries l?ay Delgadlllo Sylvia Dennis Xi! Nicholas Donez Glenn Dofy V' Chris Harman compefes wifh herself in a banana eafing confesf during Kangaroo Courf as senior Donna Duvall, sophomores Joe Con freras and Bruce Vaughan, and senior Lance l-lochanadel look on. SOPHOMOPE lNl7'lA TlON iqvgi ss x.'.,,. - if5if'3Yflt3ikZ. '1f.M-X: ,B 5+ ., 4 l P lviiiaiion Begins Year For Sophs "Toga! Toga! Toga!" "Buffon Sophi" and "50 push ups!" were among many sayings upperclassmen repealed fo fhe ne wcoming sophomores during fhe week of sophomore inifiafion. lnifiafion wenf fhrough fhe nrsr week of school and consisied of Wesf Poinf Day on Monday, Toga and Slave Day on Tuesday, Sweaf Sock and Exercise Day on Wednesday, inside-ouf Day on Thurs- day, and Maroon and Black or Favorife Spori Day on Friday, all accompanied by appropriafe sayings for fhe Class of '82i Following inifiafion was fhe fradifional Kangaroo Courf, punishing fhose sopho- mores who did noi pariicipafe in iniiiafion and commending fhose who dia? also, a Sophomore Welcome Dance was held fo make sophs feel more af home in FMHS. Of fhe 400 sophomores surveyed by fhe Pacemaker Sfaff on iniiiafion, 68 fhoughf "if was all in fun", 27 said "noi enough people parficijoafed, buf i can 'f waif for nexf year fo inifiafe sophs. " Elev- en sfudenfs had no commenf. V, 1,-if ,I 4, ,,.. W X W, , , 4 4 . , P' X ,W f ,f 5 ,Wu .jimi 1 T' 1' r" r W ,1 ,qs f , W? 4 ,. F 'sf ! get M l Wx 4 ,,.5,,, ,1, ,sfrflfdi K f rf ' . r 'Y it QQ is J f ,,- 6 JZ, li? x Ml , 4 ' ,,,. , l K V fs" ' X i 5 . W :L L3 1 M., i .f "' .vu 4 Debra Duran Michael Edwards Sheila' Edwards Nmoth y Egan David Eisenach Robert Eldred Jeffery Erickson James Fanning Tom Folios Annabelle Faz Michelle Finch Carlotta Fischer Shelby Foley Chris Fonseca Tracy Foster Lori Franco Jacob Frick Katherine Fritzler Brett Geist Steve Gerdes Lori Gertge Curtis Gibson Connie Gill Eva Godo Rosie Gonzales Elizabeth Good Lisa Goodman Danial Green Troy Griffith David Guerrero Dino Guerrero Joan Haas Peter Hall Matthew Hansen Michael Hanson S OPH OM ORE S Teresa Hanson Granl Harden Crysfal Harman Dean Harned Guy Hass Mary Hays Terry Heafon Mllchell Heisei Amy Helmberger Kennefh Henderson Donna Hendrickson David Hernandez Kevin Hiefbrink Susan Hobbs Dana Hoff Allen Hoffman John Hoffman Kim Homer Tamle Hood Arfhur Hoy Kimberly Hudson Robe-rf Hughes Lori Hughle y Chris Hunfer Jonnie Hunter Barbara lrey Roberf lre y Joe Jimenez Michelle Johns Tim Jones David Jorgensen l?obln Kalous Donald Keene Scoff Keirnes Pafrlcla Keifhiine SOPHOMOIPES 1 if ,.,, , Z E MW ! K J 4 is A , 9 J' f as .7 'W iiii D iii,yysuo f ff f if ,X ,,,,,, V f i P 2 , 4 , ,Q f Q Q f ' 9 X X , T' 'V T' 4159 4 V , 1 24" 1 K, ,Mf f iiA'iQ?5fff1 i 5 s V,,i of 'D pd D uisuuiii uirll K K i s T ry , , K, S3155 ww X K X V. 5 T Q NX :Tix Q X N Qs as X vi, W . Jeff Maffhe ws and Craig Bass order class rings from a represen- fafive from the Balfour Ring Company. An lvvesimeni lv The Fuiure Wilh lhe price of gold fopping fhe S400 an ounce mark, fhe price of gold jewelry wenf wifh if. This included fhe price of class rings. They were up an average of fen dollars per ring. The mosf expensive ring was 3448. ln spife of fhe cosf. many sophomores sfill boughf rings. Several of fhe upper- classmen also boughf lhem. Mosf of The sfudenfs choosing nof fo purchase one were influenced by fhe price. There were many new sfyles fo choose from which were slimmer, lighfer weighf, and more recfangular. Wifh fhe large seleclion of color. size, and shape fo choose from, and lhe resfraining ele- menf of high cosfs, if was difficulf fo make Thai popular inveslmenf in fhe fu- lure, .. . ,Ls 1' 4' V ff, . 'I - 7, I . Brian Kembel Ellen Kishimofo Cheryl Kifferman Keifh Kline O'Jay Knufson Debra Kraff Tim Kroskob Blair Lampe Janef Lane L ' Karie Lane l I KB David Lauck Lisa Lebsock Diane Lee L Mary Leissler Michelle Maag SOPHOMOPE CLASS RING ORDERS l?yan Henderson demonsfrafes fo second hour speech class how Speech - A Class To Remember Many sophomores shared fheir per- sonal experiences fhrough speech classes. Mosf embarassing momenfs, diseases, and currenf fopics such as nu- clear planfs and fhe price of gas and cars were discussed. Hobbies were shared fhrough fhe sfudenfs' demon- sfrafion speeches. Mrs. Sumner, FMHS speech insfrucior, had many good Things fo say abouf her speech classes fhis year. "Only one boy puf his hands in his panfs, no one gof Their hands sfuck in a mixer, and no ani- mals leff freasures. " Mrs. Sumner's philosophy, "Suffering is good for your soul, " was iransferred io her sfudenfs in speech classes and as a resulf, her sfudenfs learned how fo speak in fronf of large groups of people in spife of fhemselves. Sherrie Madsen C ynfhia Mai Julie Mashek Jeffery Maffhews Dallas Mavis Joan Mayfield Kyle McCormick Cheryl McCracken Michael McFarland Rose McFarland Eileen McMorrow Julie Melloff Jesse Mendoza Pafricia Mendoza Paul Mendoza fo clean moforcycle brakes. SOPHOMORE SPEECH CLASSES ' Wi ff. .S . T w . f E .. .X if .'-' , yi. . X ,M 1, f M 5 f! 'Q f A 52 R F Ssgf, "Q ,f ' if , --fg. ,,g ' is l iii A - M X' is L ' Vid 'P ff? VPV: ,'s Y 'f Z W ' " 1,31 - " I5 " Q , :rf 'Q Wifi' 1 "' 1 'Y I Z' k ' , J' X, : ,V N ' . '. X xxx if ' f l lgy I 'ff ,. 7 we iff 4. 1. Q -we H, A5?, R ,M f .cf 5 My ,LV ,xEg,L, .W V Y ti x H if il Erin Mercer C ynfhia Mese Kimberly Mese Nancy Meyer James Miller Yolanda Morales Maryann Moyer C ynfhia Ne wlon Janell Nicklas Joyce Nukaya Sheila Null Denise Oslwald Vicforia Owl Tina Pankow Louis Perkins Krislie Pefer Paul Pelersen Richard Pickens Holly Pickner Sara Pilcher Roberf Pine Krisfin Polanchek Cecilia Ponce Lynda Price Lori Prinfz Maureen Reagan Bradlee Reed Diana Reed Bradley Reichert Diana Robinson Sie ven Robison Chrislina Rodriauez Felix Rodriauez Frank Rodriauez Brian Rosener Karen Roth Paffy Roth Toni Rofh Larry Ruof Rebecca Ruppel Darwin Sagel Emilee Sagel Barbara Sanchez Lucinda Schmid? Jeff Schneider Diane Schocke Shawn Schwenke Jeffery Schwindf Terry Scoif Angela Shannon Chrisfine Shull Ronald Sierra David Simmons Ronald Skinner Lori Smifh Maria Smifh Sherry Smifh Larry Smifhey Kevin Snelson Jonna Snider Gregory Spear Pamela Spomer Aniioneffe Sprawka Rhonda Spurgeon Donna S fark Darrell Sfafle y Archie Sfeger Mary Sfone Jay Thomas Ronald Tiff S OPHOMORES w ,ZF f f f if 2? I V A ff f 1 4 R, ' X? k if f r ,W 1 VW 9 ,Q f Q A , ' ff fy , 1 37 s my W f 1 .455 f f 1 My is 4? 1,91 .. , ,,,. , .R .,,, 4 1,52 T ,,:,,...,,,1 Q ,ii iiii 'R I.. S 1 ff ff, , ,im 5' 'ff,ffff.f. ,,', ,S.,S i'SSS A S i iS fr f gy f fs if i ,pf K 2 1 f ff ,gh f fi X f " Q , ' K' 'ifrfm ' 'Q f 4 X gl 2 QW 9' YZ f 5 5 Wi if i is .1-., -1. f ,- X W f ii , 2 ifffff f ' K W , A ,fr Sf we Q f ,f il? S iiccii if A fl ., . as 1 ,gi gf W 1 5 V-, i an 'F' I f, iiii .. , ,,,, fi, 'sp , K mf gii i S 'irri V,', X 1- , , fifx ,: . . SR' x " V . as YS xx K QX Er ie l r ' ii,--rfmz' .T 1' 74' 'aff' ' 5 i f i A3 af Z mn? 4 E 4 wi ,1if' '- i j 7 1 iii D "1 ..',i xsswgr 'zzzfaw j .W r I 'Zi in -'2 , -f .- f2smf??iise2 he I f ,- mv 'f 1' A 1 W U ' i Z w S ,mfg if icc, W M J! I Noi Pictured: Kim Lafoski Class Sponsors' Mr. Pfeifer fheadj Mr. Graff Mrs, Haley Miss Sandau SS'--L1,'gegLl::N-:MA x A X ALX A-,I Xxftn . f A fi .nf'iFn.. -QEEN 9' 'x x ..f ,X ., SX A T X X QL? fb. -wfmrms-s Q' Connie Gill, Audrey Bieich, and Neva Tyler look for feshirfs for the Sock Hop. Terri Tracy Neva Tyler Jeana Uhrich Cafherine VanWyhe Bruce Vaughan James VonFeldf Umofhy Wagner Lance Warboys Ted Ware Heidi Wafson Alan Weimer Janna Welle Craig Windsheimer Cynthia Wood Shelley Woodward Randall Worfhley Gerald Yearous Kevin Young Sophomores Earn Money When winfer became spring, sweaf- ers and boofs were pui away and i- shirls and lennis shoes were broughf out This was fhe Time fhe sophomores held the annual Sock Hop for ihe entire school. "Girls ask guys" was fhe name of fhe game for fhe Sock Hop. The ladies boughf mafching shirfs for fhemselves and Their dares. Tickers and supper ai a local pizza or burger place were usually paid for by fhe females for fhis dale. During fhe dance, a cake aucflon was held. The cakes were baked by fhe sophs and fhe money wenf info fheir freasury for fufure need, Everyone in affendance enjoyed fhe dance and delicious cakes. SOPHOMORE SOCK HOP H ,, wma W m W SPOT? TS SEC TIONA TABLE OF CONTENTS Football ...... Powder Puff . . Volleyball . . . Cross Counfry Cheerleaders Golf ......... Slars ......... Boys Basketball Girls Baskelball Wres fling .... 132- 135 136- 137 138- 139 140- 141 142- 143 . . . 144 . . , 145 146-149 150- 151 152- 155 x Q3 ' 1 5lal1le al al5a.l ,alaQ5 I E f f gg as T W 4 11- T 1 li, we E ,wg EEN! Musrongs Ger Rioped-off 75- 44 "Enfhusiasm This year was greai and fhe affifudes superb, " was fhe commeni by head foofball coach Clearence Slern. "For- ly-six wasn'f The biggesr rosfer around, buf fhe pofeniial was fhere. " Making up fhe 116 were nine seniors, 20 juniors, and 47 sophs. There are many quirks in fhe game of foofball buf fhe biggesf one has To be ihe Hffh down given io Greeley Wesi by fhe oflicials. A large number of fufile y proiesfing fans saw Greeley kick a Held goal fo beaf fhe Musfangs 45- 44 wifh 48 seconds fo play-on ihe Hfrh down. "44- 42 we won" was fhe commenf by coaches, players, and fans alike. The game made fhe ieam work harder for ihe nexf game, Skyline. The healih siluafion was less ihan kind fo fhe Musfangs. Almosf every game some- body gof hurl. There weren'l many seniors our for lhe Team buf fhe coach was safished wiih fheir efforfs despife fhe record. MUSTANG FOOTBALL TEAM FIRST ROW: Brad Dilll, Mali Thompson, Dan Cusfer, Kyle McCormick, Jody Na- berhuis, JB. Whafley. SECOND ROW: Brad Reicherf, Mike Pe- sall, Chris Gibson, Klaas Huberl, Troy Bohm, Don McCarfney. THIRD ROW: Kevin Bofhwell. Jim Von Feldi, Curr Gibson, Tim Wagner, Granf Harden, Mike McFarland, Jeff Schneider. FOURTH ROW: Breff Geisf, Don Kem- bel, Allan Rader, Dan Overfon, Glen Dahl, John Bragg, Bruce Vaughan. FIFTH ROW: Dino Guerrero, Doug Fil- lingham, Greg Carwin, Randy McFar- land, Gary Covelli, Kevin Vaughan, Mike Bass. SIXTH ROW: Sean Colgan, Bryan Weimer, Bill Fries, Brian Downing. Chris Sfroyek, Phil Dalke, Tom Chrisfensen, Lance Hochanadel, SEVENTH ROW: Jim Colgan, Ted Ware, Mike Ballew, Don Geisf, Karl Kronkow. FOOTBALL L T T 1 X TTT f W ,fy ,giw l , M, I V, as J- V, numm 1 mrsiwg QV av 'fi V , , , 6 411 I . - , 3' I ,' V ..4L3fi,:f.5 :Wires ",,,'4.r'f, A- 7 -, fi " V, LM 'W L J . L' w Q, ' f L- f J ff 4 J in i .W 46 if W ' 1 at V' 49' Aw f 3 ,., kj . if 5 U H TH L I A i The Mustang line is ready to block out the Tiger defense, The seniors were small in numbers but gave the team leadership. Karl Kronkow, Tom Christensen, Randy McFarland, Phil Dalke, Jim Colgan, SECOND ROW: Bry- an Weimer, JB, Whatley, A' . ,, L,,,- LW, .. .. ,, M 5 32 uusrifrsl J get-:Z WL. if 'i f m 9' .1 'wwf . , f , V f lim J 4 N '38,-4 u 5 481- 4 MU? HMS Lance Hochanadel, and Dan Q L g V V g I V . Custer, ' 6 , wp f ' L V, gi Pre-season warm-ups started two weeks before school - g T E did, Randy McFarland and Coach Steve Mathews think - T i T T the object of the game is to stretch first, win later. L. as . K, - r--- I 1 L. L The Mustang coaching staff added two new assistants, T X A lgllc 7 Keith Jensen and Ste ve Mathews. Jim Parker, line: Jensen, sf' llli r T TT TT backs 84 ends' Clarence Stern, heady Mathews, linebackers, This is the way the score should have read for the Greeley West game. be -CQ L A. 1- , Zliisi ,:.:T- ., .. - ii.sss.s be s FOOTBALL John Bragg fakes one of ine many hand-offs from QB Don Geisf. H2 Q, it Q in ig n n a iw if sv xi .i Q gf i 2, Jimi gg i im' V ',1, g Q f, i ii fr pg Z5 f w riwfw nni , 3 W- all it Q 1 , fir ff, A , W A2,zw ,, :xi 5 1 b 4 K, J! : b g .Q , W nnni i ' H 1 , s if w r 'ying " ' f ,, Q, f 2 5 ' ' 1: 2, 9 15 ? , if V WWW W if I H I 693' ' A v A 1, 31 'J- i 4 2. U 5 'p 3' .e 4 .2 1 Z' K , t I , . , . 9 PV: ff ff wwf? fv my 'v 'gf ,W ' ,Z ' .936 wi ,,,, 4 W ,, ,. MLW A2 7 J 1 f 5 11 , f 'A ff W F 52 4 LL,L M ,bh fgiz Y .1.. ,ff a M ,W Q Bryon Wefmefmcde fhe Aff-Conference few? Gwwfefvf where DVOVGS he CGD f9C9fV9 GS well O5 defend- ,m,, ii nn i ,'i' f "-, 1'L f f.,,i-: .',, Allan , aa' , + Rader f a ff 3 aaa picks up some of his 704 yards, and led fhe feam in rushing. The fough iine, ready for anyfhing, rough or oiher- wise, Here, ready for Sferiing. Don Kembei gefs sef fo heb Jim Colgan wifh a Sferiing defender. FOOTBALL is 4 Q Hs, nf, '2 '1 sk Q 4 1-av Ay 4 ss .M f n L J. B. Whafley is looking for fhaf ball. John Bragg got hurl al fhe end of the season, buf here he picks up some hard-earned yards. . Thompson Valley Longmonf Greeley Wesl Skyllne Slerllng Rocky Mountain Greeley Central Loveland Nlwof Poudre US THEM 7 13 0 28 14 15 19 0 14 19 0 42 6 14 6 20 7 17 3 20 So Close Bur So For Ending lhe season wilh a record of 4-9 was no indicafion of fhe way fhe young Mustangs played. The ai- lifudes slayed high, and fheir enfhu- siasm was greaf fhroughouf fhe season. The feam had seven games fhai could have gone eifher way. For example: fhe Sferling game, which ended wilh a Hnal score of 49- 44 or fhe Homecoming loss fo Greeley Cenfral 44-6. Of Course, no one will forgef fhe 45- 44, Hflh down call fhaf wenl in Greeley Wesfs' fa- vor. Coach Sfern poinfed ouf fhaf fhis game undoubfedly affecfed The menlal alfifudes of lhe players fhroughouf fhe remainder of lhe season. Sfalisfic wise The Musfangs did very well. They rushed for 4,506 yards, which was fhe besf fofal since Coach Sfern has been here. The defense was Hrsf in fhe Norfhern Conference againsf lhe pass and in fen games, only 544 yards were ac- cumulafed againsf fhem. Don Geisl was second in fhe league in puni- ing, with a 39.3 average. Allan Rader was fhe feam 's rushing leader wifh 704 yards and Bryan Weimer, fhe leading receiver wifh 24 4 yards. Overall, lhe feam healfh was good, buf injuries fo key players proved cosfly. John Bragg was ouf fhe lasi fwo games wifh a knee in- jury, Lance Hochanadel missed sev- eral games on offence wifh ankle problems and a hip poin fer, and Jim Colgan, was hobbled by a bad knee. These could have been the deciding faciors in all Those games. The Muslangs had Hve members re- ceive honors. Byran Weimer, a sen- ior, made fhe All-Conference Team as safely, wilh seniors, Jim Colgan, receiving honorable menlion af fhe defensive Tackle posifion, and Lance Hochanadel, honorable men- fion al running back. Juniors, John Bragg, linebacker, and Don Geisl, punfer, also made honorable men- fion. FOOTBALL l PFElFEl?'S FlGl-lTEl?S, FIRST ROW: Brenda Whel- den, Barb Kula, Sherri Luhrs, Gemme Grooms, Mary Liessler, Val Widner, Tammy Kruger, Su- san Smilh, Lorie Hughley, SECOND ROW: Jill Brunkhardl, Lori Weslover, Robin Carler, The- resa Bauer, Cheryl Lebsock, Mary Custer, Donna Brown, THIRD ROW: Donna Palasfy, Kim Bro wn, Jan Nicholas, Karen l?o lh, Rochelle Schreiner, Karen Keller, Ann Wacker, Coach Pfeifer, FOURTH ROW: Rona Waldow, Vickie Jimenez, Sue Lissole, Tia Price, Diane Lee, Barb lrey, Rhonda Wahlerf, Natalie Fehringer. Nor Piclured Deb Duran, Janine Morris. Ernie Rodarle and Lance l-lochanadel doing their fhlng. Powder Puff Affendanls: botfom to fop, Lyn- da lungerich, Brian Lampe, Tammy Alles, Karl Kronkow, Grefchen l-lume, Ernie Rodarie, Nancy Weber, Lance Hochanadel, Nalalie Eehrlnger, Darren Eurich. PEElEEl?'S FlGl-lTEl?ETTES': Dan Lehman, Mike Trujillo, Brian Lampe, Scorl Binder, IFB 'Q r I U X I 2 K. Q cf si 14, PO WDEI? PUFF ? 'ki'.l'.i' ' .M I STADLEl?'S S TEELEPS, FIRST ROW: Cindy Blachly, Phonda Spurgeon, Lisa lylashek, Crickelr Redd, Tammy Alles, Theresa Vaughan, Deborah Boroughs, Cindy Wood, SECOND RO W: Erin Mercer, Deanne Dine, Nancy Weber, Monica Bass, Dawn Baumgarlner, Shelly Baumgarfner, Tricia Keirhline, Tammy Comer, Jane Ferhihger, THIRD ROW: Coach Ben- ham, Pal Mclylorrow, Gretchen l-lume, Lana Weslover, Lynn Gerlge, Kim Wlemer, Lynda Price, Anneffe Hobbs, Diane Uresre, Gina Uhrig, Coach Sfadler, FOURTH ROW: Diane Confreras, Terri Nuli,l-lelen Samuels, Lori Lirflejohn, Deb Zelgler, Susan Doolih, Kaye Yearous, Lisa Teelers, Pal Bailey, Lynda lungerich. ., . ,,,, , ,, , , , lr , 1 . ff, F J ...Q ' -- A 'M' My Girl F oorballers Foughr Our Annual Game Pfeifer's Fighlers and Sladler's Sleel- ers foughf a hard game which ended wifh The Fighlers being lhe winners. The Sleelers scored lirsl wifh a louchdo wn buf fhe Fighfers foughf back wifh fwo Touchdowns. Penalfies hurl fhe Sfeel- ers in lhe second half and fheir offen- sive unif played very lillle. The final oul come was Fighlers 42 - Sleelers 8. Each leam had aboul lhirly-Nye girls and only one week of pracfice fo gel ready for The big game. Af halffime Lance Hochanadel, who was escorfed by Tammy Alles, was crowned Powder Puff King. Beauly was noi only on fhe field bul also on lhe sidelines. Each feam had four lop heavy beaulies cheering Them on lo vicfory. STADLEl?'S STEELETTES: Lance Hochan- adel, Phil Dalke, Karl Kronkow, Ernie Po- darle, Lance l-lochandel, Powder Puff King, , U A . ., , ,I fa.. VIP ,eww 'V A .11 vial W.. wifh escorl Tammy Alles. foofball as Gemme Grooms and Barb lrey, look on. 36 YW PO WDL-7? PUFF Coach Pfelfer shows a uniaue form of Blonde Bombers Bomb Their Way To Sfore. The Mustang Volleyball team, otherwise known as the Blonde Bombers, bombed their way to a fourth place at state. This was the first appearance at state for the Mustangs. Coach Becky Maxson noted "For the Hrst time down there, l think they did well." The Mustangs also took first in the Conference, first in the Sub-Dis- tricf, and won District, with the heb of the iirst ever pep bus for a girls sport. Eileen Menken and Becky l?og- ers were named to the All-Con ference team. Eileen led the team in spikes with 238 and 82 kills, and Becky led the team ir sets with 453. Kelley Porter, Tammy Hoy, and Colleen Troudt were Honorable Mention select- ees. the varsify's Wnal record was 12-0 in Conference and 22-4 overall. The Junior Varsity team, coached by Wck y Schenk ended up the season with a record of 8- 12 overall and 6-6 in league play. The team was lead by Sharon ldntner in spikes and Nancy Ben- ham in sets. 1 VOLLEYBALL 5 1 1 l Colleen Troudt shows winning form, while in Mustang action, Deb Beauprez spikes with ease, as Linda Dodge looks on. . if VOLLEYBALL SCORES fUS-THEMJ Yuma: 15-12, 15-7 West: 15-8, 15-4 Sterling: 15-7, 15-0 Loveland: 17-15, 11-15, 15-10 Ft. Colllns: 15- 13, 15-11 Longmont: 7-15, 15- 13, 15-6 Thompson Valley: 15-11, 15-B Central: 15-12, 15-12 Brush Tourney: 2nd Place Centaurus: 15-9, 15-3 Nlwot: 15-11, 15-11 Rocky Mountain: 15-11, 15-8 Poudre: 15-6, 15- 10 Skyline: 15-7, 17-15 SUB-DISTRICT Poudre: 15-10, 15- 10 Rocky Mountain: 15-8, 10-15, 17- 15 DISTRICT Smokey Hlll: 15-12, 14-16, 15- 4 STA TE Pueblo County: 15-8, 15- 12 Evergreen: 0-15, 13-15 Cheyenne Mountain: 14- 16, 15-13, 0-15 Conference Champs Sub-Dlstrlct Champs District Winners Fourth In State J.V. Team: Tracy Foster, Nancy Benham, Shelby Foley, Patti Roth, Laura Pettis, Lori Franco, Joan Haas, Cris Harman, Sylvia Dennis, Tony Sprawka, and Lori Gertge. "Hl- YA Kelley Porfer yells on a trick shof in is on fhe home courr. 2 , 5, 1 -19:1 ,I ,Qi fg - i ege , .W 1 5' WW! f www f wk if f ' ' , ,,., , , W ,, X lfv ZQC5' Wadi- fi Mrs gpwm' - ,W . WM- I 1 ,, eff JM Mig, 4 5 fs -2 ' Y ,J fd? J if 'Fifi 'H 'Ta Ein? x E4 " ' 4, V A ZV 1, EX ' U 53, if Krisfi Meece reaches for The sfars on a Brush Beefdlgger spike. Tammy Hoy is noi calchlng the baii, she is selling her way lo Conference honorable menfion, fm 1 Varsity Team: Krisfi Meece, LlhO'G Dodge, Colleen Troudf, Keri Wen- dell, Deb Beauprez, Becky Rogers, Eileen Menken, Sharon Klnfner, Adrianne Wlrfh, Tammy Hoy, Kelley Porter, and LaJean Carwin, Eileen Menken spikes fo All-Confer- ence and All-Slafe honors, The Conference Trophy, one of fhe many fhe girls won lhroughoul fhe season. L+ VOLLEYBALL Running Posr 'Poin" The MusTang Cross CounTry Team had The mosT runners since The sporT was in Troduced aT FMHS. The Team had Twelve seniors, ThirTeen juniors, and seven sophomores amounfing To ThirTy-Two runners, wiTh six of Them girls. MosT of The runners ouT for The sporT were Trying To geT in shape for a winTer sporT. Danny Lehman and Brian Lampe were The only reTurning leTTer- men. WorkouTs were exhausTing. The Team usually averaged TwenTy miles a week, puT They had a loT of fun, Too. Affer running sprinTs aT Legion Field The Team divided inTo Two Teams and played a game of foofball. The Team also held an iniTiaTion in which all sophomores and new juniors were Thrown inTo The Duck Pond aT l?iv- erside Park. Danny Lehman ran The Desi' Time in recenT memory of Morgan Cross Coun Try runners wiTh a Time of 46:40. A sophomore, Emilee Sagel, led The girls wiTh Teri Price always challenging her. Emilee missed going To The regionals by Two places. New This year was The elecTion of Team capTains in which Danny Lehman and Teri Price received The honors. WiTh all The hard work and fun The Cross Counfry Team should become bigger and beTTer in years To come. 1 ri ' P L LJLL f ,Q gl' . I . g ' f. .l...2x.3l1w.g Longmont Inv. Slerling Inv. FT. Morgan Inv. Cenfaurus Inv. Poudre Inv. Loveland Inv. Greeley Inv. Conference Inv. CROSS COUNTRY SCORES 19 of 28 11 of 15 6 of 6 8 of 14 13 of 15 13 of 15 16 of 22 11 of 13 si ' M ' 'f T Moe Reagan Mickey Griffifh. Amy Johnson. and Moe Reagan settle cruises up The big info Their pace. hill. are if CROSS COUNTRY FIRST ROW: Amy Johnson, Teri Price, Ernilee Sagel, Moe Reagan, Nancy Meyer, Mickey Griffith. SEC- OND ROW: Harry Knaub, Brian Po- sener, Pod Sassaman, Sfeve Vas- quez, Randy Alles, Kyle Frick, Miles Rogers. THIRD ROW: Jeff Scheidl, Brian Lampe, Danny Lehman, l?uss Vondy, Garre fl Tibbifls, Mike Trujillo, Phil Oerfell, Brian Morrow, Sfewarf Norrish. NOT PICTURED: l?od Eng- land, Marvin Bauer, Scarf Binder, Gary Fisher, John Morris, Ron Chan- dler, Aff Hoy, Shannon Klindf, How- ard Underwood. Q3 MGH X Harry Knaub, l?od Sassaman, and Brian Rosener resf affer a grueling fhree miles, my , v-D cliff , , Teri Price whizzes by a runner from Wesfminsfer. Garreif Tibbiffs urging Emilee Sage! fo fhe finish line, V P A W, , M, ,,, . - .,-5,4 , f.,V f. w ,-kf . I ,, I Q Q, ,M 4. , Qt ggi!!! Qvmfj. ,.,, hm The Musfangs gel sef for a jackrabbiff sfarf, girl. - wan. CROSS COUNTRY Cheering For Berrer Or Worse The 4979 Fall Sporl Cheer- leaders included eighr foofball and four girls sporf cheerleaders. Tammy Alles headed The foofball group and Kelley Herbsf look lhe head cheerleader posilion for lhe girls sporfs. The girls had a fun buf someiimes busy season. One of fheir many acliviiies included dressing up as Hamburgler, Big Mac, efc., for McDonald's Grand Opening. Donna Duvall fell fhal riding fhe Hre fruck in fhe Home- coming caravan was ihe neafesf fhing fhey did. The cheerleaders worked hard lo keep The sfudenf body's spirils soaring. The len Pom Pon girls under leadership of Nafalie Fehringer and Jamie Walb ye had an aclive season loo. Selling pens for new uniforms and performing al pep assemblies were dulies done by fhese girls. Overall fhe Fall Spirii Leaders rah-rahed lheir way lo an our- sfanding season. GIRLS SPORTS: 'Kelley Herbsi, Deb Vwliams, Michelle Shivers, and Rachel Vasquez. POM PON GIRLS: Rhonda Wahlerf, Theresa Vaughan, Sue Doolin, Deb Ziegler, Gemme Grooms, 'Jamie Wal- bye, 'Nafalie Fehringer, CherylLebsock, Kaye Yearous, Tammy Zambo. 6 P The bell was The symbol of spirif, and rhe cheerleaders had plen fy of spirit rhroughouf fhe year. ..... ff,.,.. iii -..- f.wg.f ...: W ff sff, we "rf .1 ,L f rrsirr ssrrr . in ir" V5 I ,. , V W J y rsr L . I Q Q 5 i Q Q-V Q I Mr K, ,Nil ,XM ,.., ,Q V ...Xgf,f.1:4f4Q+ - Q .I . V A, Q. , gh ,, I H V Vi.. ' if V V V 'J i 1.55 V . f mm? ' 2. ' 1 ., " FALL CHEERLEADERS FOOTBALL: Donna Duvall, Anneffe Hobbs, 'Tammy Alles, Kiffi Parker, Jeane Schoemaker, Wendy Kembel, Gloria Nunez, Gail Ruhl. SOPHOMORES: Amy Helmberger, Cindy Mai, Sherrie Madsen, Janet Lane, Diane Schocke, and Ellen ldshimofo. Beaufy and intelligence were nof requiremen fs for making fhe cheerleading squad. I-45 . Blood Swear And Cheers The 4979-80 Winfer Sporf Cheerleaders included four Wres- fling, four Boys' and four Girls ' Bas- kefball, and len Pom- Pons, The head cheerleaders were Jamie Walbye, Wresfiingf Cheryl Leb- sock, Boys Baskefball: LaJean Carwin, Girls Baskeiball: and Gemme Grooms, Pom-Pons. There were fweniy-fwo cheer- leaders in all. The cheerleaders received new uniforms This year. "The school buys lhem every lhree years," sfafed Miss Sandau cheerleader sponsor. Many boxes of candy canes were sold by fhe cheerleaders fo heb pay for fhem. The new while uniforms were suppose fo have been worn Hrsf by fhe fall cheerleaders buf fhey did noi arrive in lime. BOYS BASKETBALL: Lisa Teefers, Anneffe Hobbs, 'Cheryl Lebsock, Jeane Schoemaker. Gll?LS BASKETBALL: Donna Wickham, 'LaJean Carwin, Ann Wacker, Gina Uhrig. WRESTLING: Tammy Zambo, Donna Duvall, Tammy Alles, 'Jamie Walbye. POM-PONS: FIRST ROW: 'Gemme Grooms, Sheri Bol- lacker, Teri Price, SECOND RO W: Karen Keller, Marfha Hosier, Sue Mason, Sharon Kinfner, Nancy Benham, THIRD ROW: Angie Meininger, Carol Confreras. WIN TER CHEERLEADERS Ro wer Of Posifi ve Purring The Musfang Golf Team was again an- ofher rough Norfhern Conference com- pefifor placing fourfh al fhe Disfricf Tour- namenf held af Longmonf. Alfhough only eighf guys wenf ouf for fhe sporf and junior Dave Alfenburn and Senior Rick Price were fhe only refurning leffermen. The feam performed well af all of fheir mafches placing high in fhe feam scores. A new addifion fo fhe feam was spiffy, maroon and whife golf bags obfained fhrough fhe efforfs of Coach Le Vern Jensen. Rick Price was again fhe fop golfer on fhe feam wifh Dave Alfenburn close be- hind him. Rick placed fhird af fhe Disfricf Tournamenf where he earned his way To sfafe. He placed Hffeenfh af fhe sfafe fournamenf feeling fhaf he could have done beffer. Coach Jensen fhoughf he did very well. MUSTANG GOLF TEAM FRONT ROW: John Kroskob, Dave Al- fenburn, Rick Price, Coach Jensen. Lee Jensen. BACK ROM Vince Alberfa, Mark Madsen, Erik Jensen. Da ve Lauck, Chris Lufz, GOLF SCOREBOARD f . Forf Collins Conference Meef- llfh ouf of 43 i Greeley lnvifafional- 2nd ouf of 47 Loveland Conference Meef- 5fh ouf of 43 ' I Esfes Park lnvirafional- 3rd ouf of 49 as- W 1 gT"3 'OT' Fon' Morgan Conference Meer- 5fh our of 43 'Qu X ' R Greeley Conference Meer- rlfh our of 43 Rick Price, The only Morgan golfer fo go fo sfafe. ended up fied for 45fh. Here Rick is pracficing his wing our af fhe course. GOLF T Sferling Conference Meef- 5fh auf of 43 Disfricf- dfh ouf of 43 Forf Collins lnvifafional- 4fh ouf of 20 H f. ..-W ...nW,AvWm.W.M++-wi.-ff' Dave Alfenburn worked hard and did well fhroughouf fhe season. Here. Dave. shows his puffing sfyle. Mark Madsen and John Kros- kob fake a break from fhe hard grind, of fhe golf course. fo chaf wifh parf of the gallary who came fo wafch fhem. 1 I Y 1 44 2 if r P .m.ae gO A . . L ' N ?!5r.'g , M ,ff Q1 it. Ex ' X ' r O cce W , x N -"E Nh , Kzhh Xl X 0 4 I Qmgzy 4 ' 2 di' 4, DON OEIS T JOHN BRAGG RlCK PRlCE Honorable Menllon Honorable Menflon 3rd Place Disfrlcl E1 P10104 X3 A' BECK Y ROGERS All Conference Honorable Men flon Sfafe E x Q x X , I , I LANCF HOCHANADH Honorable Men fron Sfafe Quollher TAMMY HOY KELLEV PORTER Honorable Men flon Honorable Menflon Si r""' +G' CF COLLEEN TROUDT EILEEN IVIENKEN Honorable Men flon All Conference All Slate BRYAN VVEIMER All Conference Honorable Menrlon Stare JIM COL SAN Honorable Menflon W-1 SUPERS TA RS Spirirs Soar Scores Hoored The 4979-80 Baskelball feam suffered bofh a heighf problem and lack of experience. The average heighf on fhe feam was six-foof and ranged from fhe shorfesf player, Bill Balusong af live-fool-eighf fo fhe fallesf play- er, Sfewarf Norrish af s1x-foof- fwo. Mosf feams usually had one or fwo players befween six-foof- live and six-foof-seven. The second problem fhe feam had fo overcome was fhe lack of experience. The only refurning le Herman was senior Jeff Scheidf. Only four ofher seniors were on fhe feam. They were Sfewarf Norrish, Bill Balusong, Darren Eur- ich, and Bryan Weimer. The resf of fhe leam consisfed of four ju- niors and one sophomore, Arf Hoy. Due fo fhe facf fhaf four juniors and one sophomore were on fhe varsify feam, fhe junior varsify feam suffered from lack of ex- perience. Shorf sfafure plagued fhem foo. Jon Karas was fhe fall- esf player af six-fool-fwo. Jeff Monfel, a local businessman, came fo school every affernoon fo coach fhe feam. Firsf year coach Keifh Jensen coached fhe sophomore feam. They were all early risers during fhe winfer as iheir pracfices were held af 6:00 a.m. , Bovs BASKETBALL My VARSITY: Bill Balusong, Gary Fisher, Glen Dahl, Darren Eurich, Bill Fdes, Russ Vondy, Garreff Tibbefis, Don Geisl, Jeff Scheidf, Sfuarf Norrish. NOT PlCTUl?ED.' Bryan Weimer COACHES: Keifh Jensen, sophomore coach: Darrell Blachly, varsity coach: NOT PlCTUl?ED.' Jeff Monfel, Junior Varsify coach. Garreff Tibbeffs fries fo block Ari Hoy's shof. JUNiOl? VAl?SlTY: Arf Hoy, Bobby Alvar- ado, Jon Karas, Lee Jensen, Larry McFar- land, l?on Chandler, Vince Alberfa, NOT PlCTUl?ED: John Marfin ,I , MANAGERS: Chris Fonseca, Archie Sfeger, Brice Cochran. SOPHOMORES: FIRST R0 W: David Eise- nach, Jeff Schneider, Jim Von Feidf, Scoff K eirnes, SECOND ROW: Brian l?o- sener, Greg Corwin, Paul Peferson, Randy Ailes, Kyle Frick, NOT PICTURED: Lou Perkins, Bob Pine, Greg Spear, Arf Hoy goes up for the shof while Bill Balusong positions for fhe rebound. Darren Eurich drives in for the shof. I BO YS BASKETBALL Hard Dmes Musrangs Suffer Disappoinring Season The key word in The Boy's Basketball season was disappointment. The ma- jority of Their opponents had an ad- vantage in both height and exper- ience. Turnovers and Tough compeTa- Tors also played a large part in The season 's defeaTs. With such scores as 402-68 TFT. Collinsj, 94-57 fLovelandj, and 82-59 CSTerHngj it was hard To get out of The slump. The closest game all season was with Greeley West. The Mustangs out scored The Spartans in Held goals buT lost The game 54-47 on free Throws. The Spartans hit 55 percent while The Mustangs only hit 4 4 of 23. The boys led West until late in The Third quarter. Then The Spartans Tied iT up aT 40 points each. AfTer That The points piled up against The Mustangs. Darren Eurich Tried To explain what went wrong, "l feel we had The TalenT but a loT of The oTher Teams had The Talent also. lt seems lice most of The Teams were good. The weaker Teams of The past were good This year. They just had The Talent show up along wiTh heighT. We didn 'T have The experience and iT really hurt us. BO Y'S BASKETBALL Brighton Sterling Ranum Regis Greeley Central Greeley West Sterling Ft. Colllns Loveland Longmont Thompson Valley Greeley Central Centarus Greeley West Nlwot Skyllne Rocky Mountaln Poudre BOYS BASKETBALL Gary Hsher Tdes to grab a loose ball with Lee Jensen, Bill Fries, and Garrett Ubbetts trying to help. Stewart Norrish goes up for The shot while an Eagle player Trys to block it. SCOREBOARD THEY WE 82 53 63 52 55 40 61 33 69 45 51 47 82 59 102 68 94 57 75 49 73 43 74 47 50 43 79 54 94 64 77 69 70 52 90 58 . x , Jeff Scheidf moves for fwo n' Don Gelsl pulls down cnolher Scheidf and Russ Vondy look WA.e Alb9ffG or:5Bryon Weimer do nor agree wllh fhe referee 's coll. R x Jeff l B me it l Lkkvr BO Y'S BASKETBALL Coaches Barb Oberlander and Ted Luiz. Rhonda Wahlerf demonslrales her skili ai "Si- mon Says". 2 L X Varsity: Becky Rogers, Tammy Hoy, Rhonda Wahleri, Barb Burkeff, Krisfi Meece, Keiie y Porter, Mickey Grifmh, Jana LiifUohann, Eileen Menken. Noi Picfured' Barb irey. Eileen Menken Nnds if hard fo pan' wiih the ball in pracfice. GIRLS BASKETBALL Krisfi Meece comes up shorf on fake off, ,,...-1 iii' 1 Nix Lu-af 4"-3.3 -5 No bench WGTITIBTS, DUT G heated b6f'lCh. in- , Junior Varsity: Karen Roth, Carrie Weimer, Cindy Blachly, Shelby Foley, Nancy Meyer, Cris Harman, Michelle Shivers, Cindy Newton, Vicki Owl, Tracy Foster, and .loan Haas, Enthusiastic crowds cheered the girls team to many victodes. Roosevelt- 48-42 Sterling- 47-34 West- 55-53 Central- 40-55 Yuma- 42-32 Sterling- 48-43 Ft. Collins- 37-49 Loveland- 36-25 lrush- 40-39 GIRLS BASKETBALL Longmont- 43-48 Thompson Yalloy- 30-34 Central- 48-44 Contaurus- 60-41 West- 41-51 Nlwot- 46-38 Skyllno- 40-33 Rocky Mountain- 58-78 Poudro- 40-35 A Par On The Baclf "The girls know how to spell team- work, " stated live year coach Ted Lutz as he praised the 1979-4980 Girls Basketball team. This is a bright spot on the team. There was some height, but not great, with Eileen Meneken topping the squad at live- foot-ten inches. The girls had Hve re turning letter- men. Eileen Menken, Barb Burkett. and Becky Rogers were the senior returning lettermen and two juniors, Kelley Porter and Jana Liithohann were also returning lettermen. Kristi Meece, Mickey Griffith. and Rhonda Wahlert, all juniors. played varsity. Sophomore Barb lrey also made a varsity spot. One of the exciting games was against rival Brush. The girls held on to a 40-39 win. The junior varsity consisted of mostly sophomores with Rhonda Wahlert, Jana Liittjohann, and Mi- chelle Shivers, all juniors, playing ju- nior varsity. Barb Oberlander, in her fourth year, was the coach. 1" ff s .Ji Qi ln tense concen tration scores Becky her extra point. GIRLS BASKETBALL Irs A World B y lrself The 1979-80 feam of Musfang Wresilers was sfacked wifh seniors and refurning leffermen. Fourieen seniors made up fhe squad, includ- ing nine leffermen among fhem fhe '79 185 lb. Sfafe Champion Lance Hochanadel and 132 lb. runner-up Brian Lampe. The Team was well-balanced in some weighfs and lacking in ofhers. A key blow hif fhe Musfangs when refurning junior lefferman John Bragg was injured in foofball and was ouf indehnifely. The feam sfarfed fhe season wifh iwo fournamenl wins in fwo weeks. They had a landslide win af Highland wifh seven champs and a feam score of 15918. Greeley proved fo be a fougher fournamenf buf fhey pulled fhaf off foo wifh :ive winners and a feam score of 12718. Sophomores Hlled fhe gaps wifh fhe Musfangs were shorf on man power. John Kroskob injured an el- bow af Greeley, so Blair Lampe Hlled in af 145. Vwfh no 185 pounder, lWke Ballew look over fhe posifion. Troy Bohm gefs all wrapped up for anofher grueing practice. WRES TLING Q MTM . KSYGHGQ MER? ' ,sg .Qffg V465 WEIESTLEZEQ WRESTLING COACHES! Dick Harden, Stan Lampe. The wresflers are all ears when Coach Lampe speaks. f Jeff Kroskob 's imper- sonaiion of a frog. Rick Price demon- sfrafes one of fhe many exercises, fhe Sfrefcher push-up. HW si' f 4 ig i iii 5 ,,,,. -fr 1' . ...W-WMM " I 'Wi' -. ' "" MwW.W.,L T" . 1 'MM ff, f .fif .... J, .MW ' su M ,, q , . ,,,,, , ,ff A W6 U Y X , L .ef ,. 1 2, f Q' Z FRONT ROW VARSITY: 'Rick Price, 'Rod England, 'Steve Vasquez, 'Manuel Sanchez, TJ. Clark, 'Rod Sassaman. BACK ROW: 'John Kroskob, Blair Lampe, 'Brian Lampe, 'Lance Ho- chanadei, Mike Bailew, 'Karl Kronkow, Dave lungerich, Jeff Kroskob, 'Leffermen FRONT ROW J. V. Troy Bohm, Tim Kroskob, Kyle McCormick, Harry Knaub, Greg Presfon, Paul Ferguson. BACK ROW: Granf Harden, Tim Wunsch, Dino 1 , Guerrero, Fernie Rodriquez, Terry Heaton, Doug Fillingham, Nm Carpenfer. rrrr T' " T , x , hd' ' ki wh. ww W J -ff -X' Q ,,,, mall fn 1 K k,,' 1,7 V .xbvg ,,.,,.H, VVVV M Nylg V1 -Q, A - W mv ,,,. 5 , . Managers for Wrestling- Lin- da Dodge, Rodne y Miller, Superman, Brian Lampe, brushes up on a new Russian dance sfep, Hard work and dedication pays off with a pin. , . ., ,, f r ' 1 - , ., ivt1Z12Z,,,,., gs 'wil ,c WRESTLING lg Team E fforr Spells Srare Champs Seven years afTer ending a sTreak of Hve sTraighT sTaTe cham- pionshws, our wresflers regained The sTaTe class AAA crown. They did iT as a Team wiTh all seven quamers conTribuTing To The linal score buT, symbolically, The win- ningesT MusTang of all Lance Ho- chanadel, ,ouT us over The Top when he pinned The WheaTridge wresTler for The heavyweighT championshio. The Hnal score was Wheafrldge 801A and FT. Morgan 8516. Of The seven going inTo sTaTe six placed. Besides Ho- chanadel, Brian Lampe placed Third, Manuel Sanchez and Miles Rogers, who wouldn 'T even have gone To sTaTe excepf ThaT The l7rsT place Hnisher aT regionals was ill and couldn 'T go, Hnished 17fTh. l?od Sassaman and Rick Price each nnished sixTh. AlThough John Kroskob did noT place, he Too won poinTs for The Team ToTal. The Team Hnished The season wiTh a Conference record of 4 4- 4 and over-all record of 42-2. The losses came from l?ocky Moun- Tain in Conference and The Wray Eagles. ln Conference dual mee Ts The Team averaged 40.5 poinTs per maTch To Their opponenTs 45. The MusTangs shaTTered The Team record for falls wiTh 93. Lampe and Hochanadel had 4 4 befween Them. The' MusTangs were HrsT in Dis- TricT wiTh 469 To Thompson Val- ley's 42814. New This year was a regional TournamenT. The NorTh- ern Conference meT The CenTen- nial Conference aT GaTeway High School in Aurora. Ending The year wiTh an hour long pep assemly. The whole communify was very proud of This MusTang Team. WRES TLING Manuel Sanchez, 405, works for an escape Musfangs spell SUCCESS!!! Brian Lampe Telling his opponenf To "Lay There a second and iT will qun' hurTing A new hiT single: "Turn ouT The Hghfs The parTy s over sung by Lance Hochanadel Steve Vasquez is thinking "Come on ref he 's stuck." WRESTLING SCOREBOARD Ranum- 34-22 Highland Tournament- tlrst place Skyline- 42-24 Greeley Tournament- tlrst place Poudre- 31-25 Greeley West- 46-10 Nlwot- 47-11 Rocky Mountain- 21-26 Sterling- 35-15 Ft. Collins- 50-7 Loveland- 56-3 Longmont- 40-11 Thompson Valley- 30-22 Greeley Central- 42-15 Centaurus- 46-11 Wray- 16-36 Dlstrlct- Ilrst State- Flrst HE HARMTR I wc THE LUCK! fm vftjfvy 'V' STRJN I MAKE DISTRICT and REGIONAL WINNERS: Front Row: Rick Price, 3rd district-3rd regionalsf Steve Vasquez, 2nd districtf Manuel Sanchez, Ist district, 1st regIonaIs,' Rod Sassaman, 2nd district, 2nd regionaisp Back Ro wp Lance I-IochanadeL ist district, 1st regionalsf Jeff Kroskob, 4th district, John Kroskob, 2nd district, 3rd regionalsy Brian Lampe, 4st district, 1stregionaIs,' Miies Rogers, 3rd district. I STA TE QUALIFIERS: Front Row: Rod Sassaman, John Kroskob, Mies Rogers, Manuel Sanchez, Back Row: Rick Price, Lance Hochanadei, and Brian Lampe, The 1980 State Championsiilll WRESTLING I Index AAA Sr ABBOTK DANIEL 62, 87, 406 S ACOSTA, BERTHA 424 J ACOSTA, ELVA 67, 444 J ADAIR, LESLIE 46, 4 4 4 S ADAMS, MIKE 424 S ALBERT WILLIAM 45, 424 J ALBERTA, VINCENT 49, 444, 438, 444, 446 S ALDRICH, LORI 424 Sr ALGEE, HOWARD 86, 406 S ALLES, RANDEL 424, 440, 447 Sr ALLES, TAMERA 45, 44, 45, 57, 64, 87, 405, 406, 436, 437, 442, 443 AL TENBERN, DA VID 4 4 4, 444 S AL TENBERINL THERESA 424 S AL VARADO, ROBERT 424, 446 S AMEN, ROBERT 424 J ANDERSON, MARY 44, 4 4 4 J ARGUELLO, PAULA 4 4 4 J A TWOOD, DIANNE 4, 5, 4 4 4 S ATWOOD, TAMERA 24, 46, 424 J A YRES, JEFF 67, 4 4 4 BBB Sr BAILEY, MICHAEL 63, 87, 406 Sr BAILEY, PATRICIA 57, 87, 406, 437 J BALKEN, SHERI 49, 57, 67, 444 S BALLEW MICHAEL 4, 5, 424, 432, 452, 453 Sr BAL TAZAR, EUGENE 62, 87, 406 Sr BALUSONG, WILLIAM 70, 87, 406, 446, 447 Sr BARTZ, SHERRY 24, 26, 42, 43, 44, 45, 46, 59, 67, 87, 406 J BASS, MONICA 42, 57, 67, 44 4, 437 S BASS, CRAIG 424, 425, 432 Sr BASSETT, SHERRY 24, 67, 87, 406 Sr BAUER, MARVIN 4, 87, 406, 440, 454 J BAUER, THERESA 46, 57, 4 4 4, 436 J BAUGHMAN, JO 444 Sr BAUMGARTNER, DA WN 2, 36, 48, 54, 55, 57, 64, 67, 87, 406, 437, 460 S BAUMGARTNER, SHELLY 46, 54, 57, 424, 437 Sr BEAUPREZ, DEBRA 42, 48, 57, 67, 87, 406, 438, 439, 460 Sr BELHASEN, DIANA 406 J BELHASEN TERRI 444 J BELLIS, MONTE 63, 444 J BENHAM NANCY 39, 57, 67, 440, 4 4 4, 438, 443 Sr BERNHARD71 DANA 32, 57, 67, 88, 406 J BERTLINE, TAMMY 4 44 S BEURSKENS, REX 424 Sr BILLS, SHERRY 42, 44, 45, 67, 88, 406 Sr BINDER, SCOTT 49, 64, 67, 88, 406, 436, 440 J BISHOP, JINA 444 S BLACHL Y, CYNTHIA 49, 57, 420, 424, 437, 454 S BLECHA, JEFFERY 44, 424 S BLEICH, AUDREY24, 44, 45, 57, 424, 429 Sr BLEICI-L KIMBERLY 48, 49, 54, 57, 67, 88, 406, 460 Sr BLOEDORN, JOHN 24, 24, 25, 26, 36, 44, 46, 49, 54, 59, 64, 88, 89, 406 S BOA TRIGHT, ERIKA 57, 74, 424 S BOEHM, HERBERT 424 S BOHM, TROY 420, 424, 432, 452, 453 J BOLLACKER, SHERIL YNN 24, 44, 45, 46, 54, 59, 67, 444, 443 Sr BOOS, STACEY 42, 43, 88, 406 Sr BOROUGHS, BRYAN 88, 406 S BOROUGHS, DEBORAH 37, 42, 54, 57, 58, 424, 437 S BOTHWELL, KEVIN 424, 432 INDEX -A - FRI S BOWEN, ARVINE 424 S BOWEN, BARRY 424 Sr BOWEN, IRVIN 62, 88, 406 S BOWLES, BRENDA 424 Sr BOWLES, TIMOTHY 26, 44, 88, 406 J BRAGG, JOHN 57, 60, 67, 444, 432, 434, 435, 445, 452 J BROCZKO, STEPHEN 67, 4 4 4 S BROWN, DONNA 54, 57, 424, 436 Sr BROWN KIMBERLY 2, 35, 57, 67, 88, 406 S BRUNKHARDT, JILL 44, 45, 57, 424, 436 S BRYANT MARK 44, 46, 64, 424 J BUCHANAN, JERRY 4 4 4 S BUCHANAN, ROBERT 46, 424 S BUELL, LISA 44, 67, 424 Sr BUELL, TRACY 88, 406 Sr BURKETT, BARBARA 44, 57, 67, 88, 406, 450, 454 Sr BUSCH, DORIS 8, 89, 406 CCC S CALDERON, JESSE 424 Sr CALL, CHARITY 405, 406 Sr CAMPBELL, WILLIAM 89, 406 Sr CANFIELD, GARY 55, 67, 89, 406 S CANFIELD, SANDRA 24, 46, 424 J CARPERNTER, TIMOTHY 4 44, 453 S CARSON, LESLIE 424 S CARTER, ROBIN 54, 57, 424 S CARWIN, GREGORY 44, 424, 432, 447 Sr CARWIN, LAJEAN 24, 26, 43, 46, 49, 54, 55, 57, 58, 64, 67, 89, 406, 439, 443 J CA VALERI, TERESA 8, 35, 4 44 J CHANDLER, RONALD 4 4, 4 4 4, 440, 446 S CHAPMAN, SANDRA 24, 44, 424 J CHAPPELL, DA VINA 4 4 4 Sr CHRIS TENSEN, CURT 62, 89, 406 S CHRIS TENSEN LORNA 24, 422 Sr CHRIS TENSEN, THOMAS 89, 406, 432, 433 J CLARIC LA YTON 63, 4 44 J CLARK, TIM 453 J CLUTTER, SUSAN 58 444 S COCHRAN, BRICE 2, 46, 422, 447 S COLGAIXL EDDIE 422 Sr COLGAN, JAMES 67, 89, 406, 432, 433, 434, 435, 445 J COLGAN, SEAN 58, 444, 432 Sr COLLINS, WILLIAM 44, 45, 89, 406 S COMER, TAMMY 37, 54, 57, 422, 437 J CONTRERAS, CAROL 44, 45, 4 44, 443 S CONTRERAS, DIANA 58 422 Sr CONTRERAS, JOHN 44, 45, 54, 90, 406 S CONTRERAS, JOSEPH 62, 422 J CONTRERAS, LYDIA 58, 444 Sr CONTRERAS, TERESA 58, 67, 90, 406 J COOK CRAIG 63, 444 J COVELLI, GARY 44, 444, 432 S CRAIG, PENNY 422 J CRANDALL, HOWARD 24, 63, 4 44 S CRANDALL, TIMOTHY 422 S CRANFORD, LISA 422 Sr CURTIS, CHERYL 90, 406 S CURTIS, MICHAEL 422 Sr CUSTER, DANIEL 35, 55, 63, 406, 432, 433 S CUSTER, MARY 54, 422, 436 J C YPRIAN, DEBBIE 49, 4 4 4 DDD J DAHL, GLEN 44, 70, 4 40, 4 42, 4 44, 432, 439, 446 Sr DALKE, PHILLIP 24, 25, 59, 67, 89, 90, 406, 432, 433, 437 J DA VIS, ROBERT 4 42 J DA VIS, SHARI 34, 57, 4 42 Sr DA VISSON JAMES 90, 406 'Sr DEAL, MATTHEW 26, 42, 43, 55, 59, 90, 406 S DEAL, SHA WN 422 Sr DEFFENBAUGH FREDERICK 90, 406 Sr DEFFENBAUGH, MARYELLEN 90, 406 J DEFRIES, RICKY 4 42 S DEFRIES, TERRI 57, 422 J D'ETTORRE L YDIA 4 42 S DELGADILLO, RAY 422 S DENES, RONALD 90, 406 S DENNIS, S YL VIA 44, 57, 422, 438 Sr DEROCHE VINCENT 63, 90, 406 Sr DIAZ, JOE 406 Sr DIBBENS, DREMA 47, 90, 406 Sr DILLARD, TIMOTHY 90, 406 J DILLL BRADLEY 2, 3, 44, 46, 4 42, 432 Sr DINE, DEANNE 94, 406, 437 Sr DODGE, LINDA 6, 8, 9, 44, 44, 45, 48, 57, 67, 94, 406, 438, 439, 453, 460 J DOMINGUEZ, C YNTHL4 58, 442 Sr DONEZ FRANSISCO 406 S DONEZ MICHOLAS 422 J DOOLIN, SUSAN 57, 4 42, 437, 442 S DOTY, GLENN 62, 422 J DOWNING, BRIAN 67, 4 42, 432 DRE W CURTIS 44, 48, 54, 442, 460 J DUNNING, PEGGY 4 42 S DURAN, DEBRA 423, 436 Sr DUVALL, DONNA 24, 26, 27, 42, 43, 46, 48, 54, 64, 65, 94, 407, 422, 442, 443, 460 EEE S EDWARDS, MICHALL 423 S EDWARDS, SHEILA 423 S EGAN, TIMOTHY 423 Sr EIRING, ROBERT 62, 94, 407 S EISENACH, DA VID 44, 64, 69, 423, 447 J EISENACH, JUSTIN 42, 43, 64, 62, 442 J EKBERG, JERRY 46, 4 42 S ELDRED, ROBERT 423 Sr EL WOOD, MYRON 94, 407 Sr EMICIC LYNDA 44, 57, 94, 407 Sr ENGLAND, RODNEY 67, 94, 407, 440, 453 S ERICKSON JEFFER Y 42, 423 Sr EURICH, DARREN 42, 47, 48, 65, 67, 94, 407, 436, 446, 447, 460 FFF S FALLOS, TOM 69, 423 S FANNING, JAMES 423 Sr FARRIS, CYNTHIA 42, 94, 407 S FAZ, ANNABELLE 42, 423 J FAZ ELISEO 24, 4 4, 44, 45, 46, 442 J FEHRINGER, JANE 48, 57, 442, 437, 460 Sr FEHRINGER, NA TALIE 42, 44, 45, 46, 48, 57, 64, 65, 94, 405, 407, 436, 442, 460 J FERGUSON, PAUL 69, 442, 453 J FERGUSON, RICHARD 63, 4 42 Sr FERNANDEZ JUAN 24, 26 J FILLINGHAM, DOUGLAS 69, 4 42, 432, 453 S FINCI-L MICHELLE 423 S FISCHER, CARLOTTA 24, 44, 45, 57, 423 J FISHER, GARY 49, 68, 69, 442, 438, 440, 446 S FOLEY, SHELBY 423, 438, 454 S FONSECA, CHRIS 58, 423, 447 Sr FOOS, THERESA 94, 407 Sr FORBES, MA YNARD 63, 94, 407 S FOSTER, TRACY 57, 423, 438, 454 Sr FRANCO, IRENE 44, 45, 58, 92, 407 S FRANCO, LORI 423, 438 S FRICK, JACOB 423, 440, 447 JFRIES, WILLIAM 36, 442, 432, 439, 446 S FRITZLER, KATHERINE 123 GGG J GEIST BARRY 44, 112, 114 S GEISK BRETT 123, 132 J GEISK CLINTON 63, 112 J GEIST DONALD 112, 132, 134, 135, 139, 145, 146 S GERDESZSTE VE 123 S GERTGE, LORI 123, 138 SR GERTGE, LYNN 26, 54, 59, 64, 65, 69, 71, 92, 107 J GIBSON, CHRISTOPHER 112, 132 S GIBSON, CURTIS 44, 123, 132 S GILL, CONNIE 24, 42, 123, 129 J GILL, ROBERT 69, 112 S GODO, EVA 123 SR GOEDERT, JAMES 92, 107 J GOMEZ, ANTHONY 44, 112 J GOMEZ, REINA 44, 67, 112 S GONZALES, ROSIE 123 S GOOD, ELIZABETH 123 J GOODMAN, ANDREA 112 S GOODMAN LISA 42, 123 SR GORRELL, JODY 42, 43, 71, 92, 107 SR GRAULUS, JERRY 92, 107 S GREEN, DANIAL 123 J GREEN, TAD 14, 19, 24, 25, 42, 43, 54, 59, 67, 112 J GRIFFITH, MICHELLE 68, 112, 140, 151, 150 S GRIFFITH, TROY 123 J GROOMS, GEMME 15, 24, 25, 42, 44, 45, 46, 57, 67, 112, 136, 137, 142, 143 S GUERRORO, DA VID 123 S GUERRERO, DINO 123, 132, 153 SR GUMAER, GARY 92, 107 J GUTIERREZ, JESSE 112 HHH S HAAS, JOAN 123, 138, 151 J HALL, LORA 112 SR HALL, PA TTY 92, 107 S HALL, PETER 123 J HAMILTON, TAMERA 42, 44, 45, 112 S HANSEN, MATTHEW 123 S HANSON, MICHAEL 123 S HANSON, TERESA 124 Sr HAPPEL, LESLIE 92, 107 J HAPPEL, TERESA 24, 42, 43, 112 S HARDEN, GRANT 124, 132, 153 Sr HARFORD, CHRISTOPHER 69, 92, 107 S HARMAN, CRYSTAL 46, 57, 122, 124, 138, 151 S HARNED, DEAN 124 J HARRIS, AMY 63, 113 J HARRIS, DEBORAH 42, 57, 113 J HARRIS, DONNA 113 S HASS, GUY 124 Sr HASS, JAMES 92, 107 S HA YS, MARY 124 S HEA TON, TERRY 46, 124, 153 J HEISEL, MARVIN 63, 69, 113 S HEISEL, MITCHELL 62, 124 Sr HEITBRINIC KEITH 35, 63, 93, 107 S HEITBRINK, KEVIN 35, 63, 93, 107, 124 S HELMBERGER, AMY 44, 57, 120, 124, 142 J HELZER, TAMMY 24, 63, 113 J HENDERSHOT, SCOTT 63, 1 13 S HENDERSON, KENNETH 62, 124, 126 Sr HENDERSON, KOLLEEN 56, 67, 92, 107 S HENDRICKSON DONNA 44, 57, 124 Sr HENDRICKSON, WINDY 107 Sr HENSON, ALAN 24, 26, 40, 42, 68, 92, 107 J HENSON, RUTH 24, 113 J HERBST, KELLY 44, 46, 57, 113, 142 J HERGENRETER, RODNE Y 62, 1 13 S HERNANDEZ, DA VID 124 J HERRIN, JOHN 113, 114 J HERT, MICHAEL 14, 24, 25, 26, 113 J HOBBS, ANNETTE 43, 57, 113, 137, 142, 143 S HOBBS, SUSAN 46, 49, 124 Sr HOCHANADEL, LANCE 8, 9, 13, 17, 20, 22, 24, 25, 26, 58, 59, 61, 65, 67, 93, 107, 122, 132, 133, 135, 136, 137, 145, 152, 153, 154, 155 S HOFF, DANA 24, 42, 44, 124 S HOFFMAN, ALLEN 124 Sr HOFFMAN, KENT 93, 107 J HOFFMAN, DANIEL 33, 113 J HOFFMAN, DA VID 62, 113 S HOFFMAN, JOHN 124 J HOFFMAN, KRIS TINA 42, 44, 114 J HOFFMAN, MA TTHE W 63, 69, 1 14 Sr HOFFMANN, TODD 93, 107 J HOLBECK, DANNI 114 Sr HOLBECIC EDWARD 93, 107 J HOLQUIN, GREGORY 44, 46, 54, 114 S HOMER, KIM 46, 124 Sr HONAKER, MARY PAT 67, 93, 107 S HOOD, TAMIE 124 Sr HORS71 GARY 63, 93, 107 Sr HOSIER, MARTHA 8, 9, 57,-61, 67, 93, 107, 143 S HOY, ARTHUR 44, 124, 140, 146 J HOY, TAMMY 44, 46, 114, 138, 139, 145, 150 J HUBERT, KLAAS 114, 132 S HUDSON, KIMBERL Y 124 S HUGHES, ROBERT 124 S HUGHLEY, LORI 124, 136 Sr HUME GRE TCHEN 12, 22, 26, 27, 54, 55, 57, 59, 60, 61, 65, 68, 94, 107, 136, 137 S HUNTER, CHRIS 124 S HUNTER, JONNIE 124 Sr HUTCHESON, ROBERT 63, 94, 107 Ill S IREY, BARBARA 22, 57, 124, 136, 137, 151 S IRE Y, ROBERT 62, 124 Sr IUNGERICH, DA VID 63, 94, 107, 153 Sr IUNGERICH, LYNDA 15, 23, 57, 69, 94, 107, 136, 137 JJJ J JACOB, SHAJI 46, 54, 68, 114 J JENSEN ERIC 18, 42, 43, 114, 144 J JENSEN LEE 19, 63, 114, 144, 138, 146 J JIMENEZ, FRANK 44, 45, 114 S JIMENEZ, JOE 63, 124 Sr JIMENEZ, VICTORIA 24, 46, 86, 94, 107, 136 S JOHNS, MICHELLE 124 J JOHNSON, AMY 44, 45, 55, 57, 68, 114, 140 J JOHNSON, BECK Y 114 S JONES, TIM 124 S JORGENSEN, DA VID 69, 124 KKK Sr KALOUS, TERESA 57, 94, 107 S KALOUS, ROBIN 44, 124 J KARAS, JONATHAN 24, 42, 43, 44, 45, 114, 146 Sr KEEFE, JOSEPH 63, 94, 107 Sr KEENE, DEBORAH 49, 57, 67, 94, 107 S KEENE, DONALD 44, 124 S KEIRNES, SCOTT 22, 124, 147 J KEIRNES, SUSAN 22, 67, 114 S KEITHLINE, PATRICIA 24, 46, 57, 71, 124, 137 J KELLER, KAREN 44, 67, 45, 115, 136, 143 S KEMBEL, BRIAN 62, 125 J KEMBEL, DON 36, 63, 67, 114, 115, 132, 134 Sr KEMBEL, WENDY 13, 16, 17, 18, 27, 57, 61, 86, 94, 107, 142 Sr. KINNISON, JUDY 67, 107 J KINTNER, SHARON 67, 68, 115, 138, 139, 143 Sr KINZIE, KOLENA '94 107 S KISHIMOTO, ELLENK24, 44, 46, 57, 61, 125, 142 1 ' S KITTERMAN, CHERYL 46, 125 J KLINDT, SHANNON 115, 140 S KLINE, KEITH 67, 125 J KNAUB, HARRY 62, 115, 140, 153 J KNOPP, KRIS TINA 115 Sr KNOPP, RICKY 24, 26, 54, 55, 59, 94, 107 S KNUTSON, O'JAY 125 J KOEHLER, VICTOR 115 S KRAFT, DEBRA 125 J KREHMEYER, BILLIE 63, 115 Sr KRENGEL, ERIC 63, 94, 107 J KRENING, VAN 115 Sr KRIEN, STEVE 63, 95, 107 Sr KRONKOIM KARL 24, 67, 68, 95, 107, 132, 133, 136, 137, 153 Sr KROSKOB, JEFFREY 12, 16, 69, 95, 107, 144, 152, 153, 154, 155 Sr KROSKOB, JOHN 6, 7, 63, 95, 107, 144 152, 153, 155 S KROSKOB, TIM 125, 153 J KRUGER, TAMERA 67, 115, 136 Sr KULA, BARBARA 50, 95, 107, 136 Sr KUNST, GERTJE 21, 24, 44, 57, 58, 95, 107 LLL S LAMPE, BLAIR 2, 4, 5, 18, 37, 54, 61, 125, 152, 153, 154 Sr LAMPE, BRIAN 12, 22, 54, 65, 67, 95, 108, 136, 140, 152, 153, 154, 155 S LANE, JANET 57, 125, 142 S LANE, KARIE 125 S LAUCK, DA VID 2, 3, 24, 44, 45, 46, 125, 144 -J LEBSOCK, CHERYL 24, 44, 45, 46, 57, 68, 115, 136, 142, 143 Sr LEBSOCK, DANIEL 63, 95, 108 S LEBSOCK, LISA 125 S LEE, DIANE 125, 136 J LEE, THOMAS 115 J LEFE VER, DA VID 63, 115 Sr LEFEVER, RANDALL 63, 95, 108 Sr LEHMAN, DANIEL 20, 86, 95, 108, 136, 140 S LEISSLER, MARY 125, 136 Sr LENOX, PATRICIA 95, 108 J LIITTJOHANN, JANA 2, 3, 19, 115, 150, 151 Sr LIITTJOHANN, DEBRA 55, 67, 95, 108 Sr LINKER, LESLIE 63, 96, 108 Sr LISSOLO, SUSAN 96, 108, 136 J LITTLEJOHN, LORI 67, 115, 137 J LOOSE, TAMELA 67, 115 Sr LOPEZ CORINA 96, 108 Sf LUHRS, SHERRI 15, 24, 44, 49, 96, 108, 136 J LUTZ, CHRISTOPHER 115, 144 MMM S MAAG, MICHELLE 125 Sr MADSEN, MARK 57, 96, 108, 144 S MADSEN, SHERRIE 4, 57, 126, 142 S MAI, CYNTHIA 46, 57, 126, 142 J MALLORY, DIANE 57, 115 J MANDES, ANDREA 4, 5, 36, 67, 115 Sr MARICIC KIMBERL Y 69, 96, 108 J MARICIC MARK 63, 115 J MARTIN, JOHN 44, 45, 115, 146 J MARTIN, THERESA 115 FRI - MAR!-I INDEX J MARTINEZ MATTHEW 115 S MASHEIC JULIE 126 Sr MASHEK, LISA 96, 108, 137 Sr MASON SUE 23, 24, 26, 57, 96, 108, 143 Sf MA TTHEW5, BRMN 95, 108 1 Q 5 MA r111Ew5, JEFFERY 125, 126' J MAUZYC VERNON 55, 115 S MA ws, DALLAS 62, 126 J MA ws, DIANE 115 Sf MA YES, CAMEO 105, 108 S MA YELELD, JOAN 45, 126 J MCBRDE, MIKE 42, 45, 115 J MOOARINEY, DONALD 42, 115, 132 Sr MCCARTNEK VHERESA 22, 23, 42 43, 96, 105 J MOOONKEY, -SHA WN 69, 70, 115 S MOOORMJOIQ KYLE 126, 132 155 S MOGRA CKEN OHERYL 57, 125 Sf MCCRACKEN, DA VID 55, 96, 105 J MOEARLAND, LAURENCE 49 115, 146 S MCFARLAND, MICHAEL 62, 126, 132 Sr MCFARLAND, RANDAL 62, 57, 95, 108, 132, 155 S MCFARLAND, ROSE 44, 126 sf MOEARLAND, SHARON 57, 97, 108 Sf MCLAUGHLIN ROBIN 97, 108 S MOMORRO W, ELLEEN 54, 57, 55, 126 Sf MCMORROW PATRICIA 26, 57, 49, 54, 57, 55, 67, 97, 108, 137 J MEECE KRISO 2, 5, 44, 45, 52 57, 115 132150, 151 J MENNGER, ANGELA 39, 57, 57, 115 S MELLOTT, JULIE 45, 57, 126 JMELLOT72 SCOTT 115 s MENDOZA, JESSE 126 S MENDOZA, PA rR1c1A 126 s MENDOZA, PAUL 126 Sf MENDOZA, ROY 105, 108 srMENDOzA, WILLIAM 97, 108 ST MENKEN ELEEN 5, 28, 57, 51, 55, 62 97, 108, 138, 139, 145, 150, 151 s MERCER, ERIN 24, 45, 57, 127, 157 5 MESE, CYNTHM 127 5 MESE KEMBERLY 127 J MESE, STEPHANIE 57, 115 J MESSENGER, JAM1 57, 115 Sr MEYER MRSIEN 21, 54, 57, 55, 97, 108 S MEYER, NANCY 44, 45, 57. 127, 151 s MILLER, JAMES 127 J MILLER, JUSTIN 115 ST MILLER, ROBIN 57, 97, 108 SrN1LLER, RODNEY 51, 57, 97, 108, 153 J MOELLER, TAML 1 16 J MORALES, ROSEANN 55, 116 5 MORALE5, YOLANDA 127 J MORGAN RANDY 55, 115 J MORRIS, JANINE 115, 136 , JMORR15, JOHN 19, 59, 115, 140 SrMORROVlL BRYAN 55, 97, 108, 140 s MO YER, MARYANN 127 Sf MURRAY RA Y:-,1Or,D 55, 97, 108 J MYERS, LAR1NDA 55, 116 Sf MYLANDER, NORELDA 97, 108 J MYLANDER, RUSSELL 69, 115 NNN L Sr NAB, DANIEL 58. 97, 108 J NABERI-IUIS, JODY 116, 132 Sr NEAL, VICI11 98, 108 Sr NELSON, LORI 67, 98, 108 S NE WTOINL CYNTHIA 24, 127, 151 J NICHOLS, SIRENA 117 S NICKLAS, JANELL 127, 136 Sr NOBLE JAMES 98, 108 Sr NORRISPL STEWART 67, 98, 108, 138 1.391 150, 146 S NUKA YA, JOYCE 127 J NUKA YA, JUDY 44, 54, 57, 116 J NUNEZ, GLORIA 48, 57, 116, 142, 160 J NUNEZ, TON! 44, 45, 54, 58, 67, 116 INDEX . MAR -- SOL S NUTT, SI-IEILA 127 JNUTI TERRI44, 49, 116, 139 OOO Sr OERTELL, PHILLIP 98, 108, 140 Sr ORTI-L. NANCY 67, 98, 108, Sf OSBURN, MALINDA LEBSOCK 57, 105, 108 S OSTWALD, DENISE 44, 127 J OVERTON, DANEL 24, 26, 46, 110, 116, 132 S OWL, VICTORIA 24, 42 44, 57, 127, 151 A PPP Sr PAGE S TEPHANE 98, 108 Sr PALASTY, DONNA 98, 108, 136 J PANKOW DEBBIE 50, 116 S PANKOW, TWA 61, 127 Sr PAPE JA Y 99 108 Sr PARKER, KITTI 15, 20, 42, 58, 67, 71, 99, 108 Sf PEREZ DAVID 99, 108 S PERKINS, LOUIS 127, 147 J PESALL, MIKE 33, 116, 132 S PETER, KRISU 42, 46, 57, 127 J PETERSEN LORI 24, 44, 63, 116 S PETERSEN, PAUL 127, 147 J PETERSON, BRADLEY 40, 116 J PETTIS, LAURA 116, 138 S PICKENS, RICHARD 69, 127 S PICKNER, HOLLY 54, 57, 64, 127 S PILCHER, SARA 127 S PINE, ROBERT 127, 147 J PITMAN, CARL 116 J POLACEK SUSAN 69, 116 S POLANCHEIC KRISIIN 54, 58, 127 S PONCE, CECILIA 127 J PORTER, KELLE Y 5Z 61, 67, 116, 138, 139, 145, 150, 151 Sr PREISENDORF DA VID 992 108 J PRESTON, GREGORY 24, 42, 43, 59, 116, 153 S PRICE LYNDA 43, 127, 137 Sr PRICE RICK 20, 99 108, 144, 145, 152, 153, 155 JPRICE, TERI 42, 61, 67, 116, 140, 143 Sr PRICE, TIA 24, 6, 65, 68, 99 108, 136 Sr PRWTZ DEBBIE 99 108 , S PRINTZ, LORIE 24, 42, 44, 127 J PROBASCO, RODNE Y 40, 44, 1 16 RRR J RADER, ALLAN 67, 116, 132, 134, 135 Sr RAINE, JAMES 99, 108 Sr RANSDELL, JOHN SCI-IOENECK 24, 42, 59, 67, 991 108 S REAGAN, MAUREEN 12.7, 140 J REAGAN THOMAS 63, 116 Sr REDD, CRICKET 55, 99, 108, 137 S REED, BRADLEE 69, 127 J REED, DEAN 63, 116 S REED, DIANA 17 Sr REHKOP, TAMERA 23, 57, 67, 99, 108 S REICI-IERT, BRADLEY :SQ 127, 132 Sr REYEZ2 SANDRA 67, 99, 108 J RIOJAS, GRACIELA 116 Sr RIOS, RUBEN 63, 100, 108 S ROBINSON, DIANA 69 127 S ROBISON, STEVEN 44, 127 J ROCK WELL, SAM 116 Sr RODARTE, ERNEST 44, 45, 67, 100, 108, 136, 137 Sr RODRIGUEZ DONNA 100, 108 S RODRIGUEZ, FELIX 127 I Sf RODRIGUEZ LAWRENCE 100, 108 S RODRIGUEZ CI-IRISUNA 127 J RODRIGUEZ, FERNANDO 116, 153 S RODRIQUEZ, FRANK 127 J RODRIGUEZ, RICHARD 116 Sf ROGERS, MILES 12, 20, 44, 67, 100, 109 140, 155 Sr ROGERS, REBECCA 24, 46, 57, 65, 67, 100, 109, 138, 1392 145, 150, 151 Sr ROSALES, JOVITA MONSIVMS 100, 109 A 1 S ROSENER, BRIAN 120, 127, 140, 147 Sf ROSENER, DOUGLAS 19 49 61 100, 109 S ROTI-L KAREN 128, 136, 151 J ROTH, KAY 67, 116 S ROTH PA TTY 128, 138 " S ROTM TONI 128 Sr RUDMANN JOHN 19 23, 100, 109 Sr RUHL, GAIL 2, 12 15, 20, 22, 23, 46, 57, 59, 61, 100, 109, 142 'L S RUOT, LARRY 128 S RUPPEL, REBECCA 24, 25, 42, 44, 128 Sf RUPPEL, SI-IERYL 67, 100, 109 Sr RUSCH MARK 63, 100, 109 SSS' S SAGEL, DARYWN 44, 49, 128 S SAGEL, EMILEE 42, 43, 44, 46, 67, 128, 140 J SAMUELS, HELEN 61, 67, 116, 137 S SANCHEZ, BARBARA 44, 128 J SANCHEZ, JESSE 117 Sr SANCHEZ, MANUEL 4, 67, 101, 109, 153, 154, 155 Sr SAND, SUSAN 42, 71, 101, 109 J SASSAMAINL RODNEY 48, 57, 67, 70, 116, 140, 153, 155, 160 J SCHAEFER, BRADLEY 24, 44, 46, 54, 68, 116 Sf SCHAEFER, ROBERT 101, 109 J SCHAEFER, RONALD 117 Sr SCHEID71 JEFFREY 67, 101, 109, 139, 140, 146 Sr SCI-IEIDI WAYNE 49, 101, 109 Sr SCI-IIEL, TYLER 63, 101, 109 S SCHMIDI LUCINDA 15, 24, 128 J SCHMIDT, MICHAEL 44, 46, 67, 117 S SCHNEIDER, JEFFREY 44, 128, 132, 147 S SCHOCKE DIANE 43, 57,' 61, 128, 142 Sr SCHOEMAKER, JEANE 45, 57, 101, 1092 142, 143 J SCHREINER, GLENN 117 J SCHREINER, ROCHELLE 44, 117, 136 S SCHWENKE, SHAWN 128 S SCHWIND T, JEFFERY 2, 128 J SCHWINDP TAMMY 117 Sr SCHWINDT, TROY 58, 101, 109 J SCOTK SHERRI 42, 71, 117 S SCOTK TERRY 46, 128 J SEARS, KRISI7 117 Sr SEGURA, ROGER 101. 109 J SEWALD, MIKE 63, 117 S SHANNON, ANGELA 128 J SHIVERS, MICHELLE 44, 45, 57, 67, 117, 142 ' S SHULL, CHRISTINE 47, 49, 57, 128 S SIERRA, RONALD 128 J SILZ, DAN 117 S SIMMONS, DA VID 128 J SKINNER, GLENN 63, 117 S SKINNER, RONALD 62, 128 J SMITH CANDACE 117 Sr SMITH, DONNA 101, 109 J SMITH JEFFERY 24, 42, 46, 63, 117 Sr SMITH, KENNETH 101, 109 S SMITH, LORI 128 S SMITH, MARLA 128 S SIWTH SHERRY 128 J SMITH, SUSAN IVL 57, 117 J SMITH, SUSAN R. 118, 136 S SMITHEY, LARRY 128 S SNELSON, KEVIN 128 S SNDER, JONNA 46, 128 Sr SOLIS, JOY 67, 101, 109 S SPEAR, GREGORY 428, 447 S SPOMER, PAMELA 428 J SPOTTS, JOHN 24, 64, 443, 448 S SPRA WKA, ANUONETTE 44, 428, 438 S SPURGEON RHONDA 43, 428, 437 S S TARK, DONNA 428 J STARR, HOLLY 448 S STA TLEY, DARRELL 428 S STEGER, ARCHIE 46, 428, 447 0 J STONE, JUSTIN 24 26, 42, 43, 45, 56, 59, 448 Sr STONE, KELLY 24, 42, 46, 48, 59, 402, 409 460 S STONE, MARY 46, 428 J STROYEK, CHRIS 35 448, 432 TTT Sr TADOLINL ALAN 22, 62, 402, 409 J TEETERS, LISA 24, 44, 45, 46, 57, 64, 68, 4 48, 437, 443 J TEMPLE DA VID 63, 4 48 Sr TEMPLE DEBORAH 402, 409 J TEMPLE, LINDA 4 48 S THOMAS, JAY 428 J THOMPSON BOBBY 63, 4 48 J THOMPSON, MATTHEW 63, 448, 432 J TIBBETTS, GARRETT 448, 439, 440, 446 J TIBBE TTS, ROGER 448 Sr TICNOR, WAYNE 63, 402, 409 Sr NENSVOLD, PAM 402, 409 S HFF, RONALD 69, 428 J TIFF, SHEILA 448 J TIMPE, SUSAN 69, 448 S TRACY, TERRI 8, 57, 429 f J TRAXLER, BRYAN 63, 449 Sr TROUDI COLLEEN 2, 3, 6, 45, 46, 49, 54, 57, 65, 402 409 438, 439, 445 Sr TRUJILLO, MICHAEL 402, 409, 436, 440 S TYLER, NEVA 429 UUU J UHRIG, GINA 44, 45, 4 49, 437, 443 Sr UNDERWOOD, CARL 48, 20, 67, 402 409 J UNDERWOOD, HOWARD 34, 449, 440 J URESTE DIANE 74, 449, 437 S UHRICH JEANA 429 YYV S VANWH YE, CATHERINE 44, 46, 429 S VANME TER, LORI 49 J VASQUEZ, RAQUEL 57, 67, 449 442 Sr VASQUEZ, STEVEN 67, 403, 409, 440, 453, 454, 455 S VAUGHAN, BRUCE 44, 422, 429, 432 J VAUGHAN, KEWN 449, 432 Sr VAUGHAN, THERESA 44, 45, 48, 57, 403, 405, 409, 437, 442, 460 J VIETH, KAREN 24, 44, 54, 449 J VONDY, RUSSELL 63, 449, 439 440, 446 S VONFELDT, JAMES 429, 432, 447 WWW Sr WACKER, ANN 48, 57, 67, 7 4, 403, 409, 436, 443, 460 S WAGNER, TIMOTHY 429, 432 J WAHLER72 RHONDA 43, 57, 67, 442 436, 442, 454 Sr WALBYE, JAMIE 48, 24, 45, 46, 49, 64, 403, 409, 442 443 Sr WALDOW, RONA 24, 42, 44, 57, 403, 409, 436 Sr WALKER, ALLEN 63, 403, 409 J WALKER, SHALA 449 J WALKER, STEVEN 67, 449 Sf WAL TERS, CHERYL 62 403, 409 S WARBOYS, LANCE 429 S WARE TED 64, 429 J WARFELLL JOHN 449 J WARREM JENIFER 48, 448, 449, 460 J WA TERMANS DONALD 63, 4 49 S WATSON, HEIDI 42, 429 J WEBER, LYNN 4 49 Sr WEBER, NANCY 44, 45, 42, 43, 44, 57, 67, 403, 4042 436, 437 S WEUVIER, ALAN 429 Sr WEIMER, BRYAN 49, 64, 67, 69 89, 403, 409 432, 433, 434, 435, 438, 439, 445 J WEIMER, CARRIE 46, 67, 4442 454 Sr WEIMER, KIMBERLY 67, 403, 409, 437 S WELLE, JANNA 42, 44. 46, 429 J WENDELL, KERI 39, 67, 449, 439 Sr WERNER, RONALD 22, 23, 62, 403, 409 J WESTHOFF, GLEN 63, 449 Sf' WESTOVER, LANA 54, 403, 409 437 Sr WESTOVER, LORI 46, 54, 67, 404, 409, 436 Sr WHALEY, JAMES 404, 409 Sr WHATLEK JAMES 67, 404, 409, 432, 433, 435 Sr WHELDEM BRENDA 57, 67, 404, 409, 436 J WHITE MONTI 63, 449 J WHITE SUSAN 4, 5, 67, 4 49 Sr WHITNEK MARY ANNE 67, 404, 409 J WICKHAM DONNA 24, 25, 26, 42, 43, 54, 57, 59, 449, 443 J WIDENER, VALERIE 4, 5, 449, 436 Sr WILEK JOHN 63, 409 J WILLIAMS, DEBRA 57, 67, 449, 442 J WILLIAMS, LESLAE 449 J WILSON, LORRETTA 44, 46, 51 7 4, 447, 4 49 Sr WILSON MARTIN 62, 404, 409 S WINDSHEIMER, CRAIG 62, 429 J WINKLER, TAMARA 24, 44, 45, 46, 4 40, 4 49 J WINTER, JENNIFER 2.4, 36, 42, 43, 57, 449 Sr WIRTH, ADRIANNE 48, 24, 42 43, 44, 45, 46, 57, 65, 404, 409, 439 Sr WOOD, CAROL YN 32, 42, 43, 50, 67, 404, 409 S WOOD, CYNTHIA 67, 7 4, 429, 437 S WOODWARD, SHELLEY 44, 429 S WORTHLEY, RANDALL 429 Sr WORTHLEY, UMOTHY 404, 409 J WULF, BRYAN 63, 449 Sr WUNSCH, TIMOTHY 34, 63, 404, 402 453 YYY S YEAROUS, GERALD 62, 429 J YEAROUS, KA YE 48, 49, 23, 44, 45, 46, 57, 444, 449, 437, 442 J YEAROUS, MARK 63, 449 S YOUNG, KEVIN 46, 429 J YOUNG, LLNDA 67, 449 J YOUNG, MARK 24, 46, 449 ZZZ J ZAMBO, TAMMY 24, 25, 26, 46, 54, 57, 59, 4 49, 442, 443 J ZIEGLER, DEBRA 57, 64, 67, 4 49, 437, 442 J Z WE TZIG, BRENDA 4 49 Sr Z WETZIG, CRYSTAL 24, 44, 45, 46, 48, 54, 57, 89, 404, 409, 460 FACULTY LUCAS, R.E. 34 PORTER, RICHARD 34 ANDRUS, KARL 46, 33, 64, 69 BENHAIVL JACK 23, 34, 64, 437 BLACHL Y, DARRELL 50, 67, 70, 444, 446 BRUNELLL JACAL YN 44 CARR, JOHN 38, 54 CHANDLER, FRED C. 44 CIMAGLIA, DONALD 38 CORTEZ SHIRLEY 32, 67 GRAFF, VIRGM 33, 69 HALE Y, BE VERL Y 36, 49 HANSON, CONRAD G. 40 HARDEN, RICHARD 32, 444, 452 HA YE51 PAUL B. 40 HOCHANADEL, TONY 37, 4 47 HOLDER STEVEN W 46, 33, 62 HOL TZ, DARRELL R. 37, 58, 447 JACKSON, MITZI 37 JENSEN, KEITH 46, 40, 433, 446 KEENAINL BARBARA 44, 36, 4 47 LAMPE STAN 50, 452 LA TTA, PATRICIA 54 LEE, HAROLD 3 4, 448 LEWIS, HOWARD 54 LIND, MARY ANN 36, 38, 58, 89 LWDELL, GRETCHEN 47, 447 LOOSE ROBERT 33 MCGRAW MARGARET 36, 447 MASON, MILDRED 39, 50 MAXSON REBECCA 50 OBERLANDER BARBARA 38, 55, 45 4 OSTWALD, JOANN 20, 36, 48, 54 OVERTON LARRY 46, 85 PFEFER HAROLD 44, 38, 447, 436, 437 POWELL, STEVE 24, 26, 37, 59, 4 47 ROMANO, POLL Y 54 SANDAIJ DEBRA 44, 69 SCHENK, KENNETH 48, 24, 42, 43 SQMRES, VON ES THER 39 STADLER, PI-HL 32, 67, 437 STERN, CLARENCE L. 50 432, 433, 435 SUMNER, SANDRA 36, 64 THIEL, GERRY 47 TRAVIS, SHIRLEY A. 36 WARE, BYRON 24, 45 WELLE, LINDEN 8, 4 4, 68 "THANK-YOU'S" The 4979-80 PACEMAKER Eaiifors would Hke fo fhonk the following . .. , . . The Sfaff for fheir persisfance and creafiveness. . . .Mrs. Osfwald for her faifh fn us. , , . Darren Eurlch for his oufsfanding arfis- flc abilify. . . .Mr. Holsrein, our yearbook represenfa- five, for glvmg us new ideas and hewmg us fhroughouf the year. . . .Mn Lucas and Mr. Porfer for granfrng our requesfs. , . . Mr. Thiel for arf supplies and he4o. , . . The TIMES photographers for fhe many pictures they provided us. . . .Mrs Hansen for hem wifh Enances and bookkeeping. . . .Mrs Lorenson for cIass hsfs and senior accomplishments. . , .Mr, Lee for faking pictures of the staff . . . Gene 's, Schure 's, and orher studios for Senior porfraifs, . . .Area Businesses for their tinancial sup- porf. . . .Mn Karas for special picfures in fhe book. . . .Miss Lind for special picfures. , . ,Mrs Helen Rasmussen and Judge and Mrs. Johnson for fhe use of fheir plcfur- esaue yards. ...and fasf buf noi leash fhe Sfudenf Body-for wifhouf you there would be na PA CEMAKERI SPE - FACUL TY'- INDEX THE ll Mn , . N w. Q ..,,E, 1 ,,f,,L7,,,,,,E WI ? i ' ' V ,,, W , ,, A CLOSING


Suggestions in the Fort Morgan High School - Pacemaker Yearbook (Fort Morgan, CO) collection:

Fort Morgan High School - Pacemaker Yearbook (Fort Morgan, CO) online yearbook collection, 1930 Edition, Page 1

1930

Fort Morgan High School - Pacemaker Yearbook (Fort Morgan, CO) online yearbook collection, 1951 Edition, Page 1

1951

Fort Morgan High School - Pacemaker Yearbook (Fort Morgan, CO) online yearbook collection, 1963 Edition, Page 1

1963

Fort Morgan High School - Pacemaker Yearbook (Fort Morgan, CO) online yearbook collection, 1964 Edition, Page 1

1964

Fort Morgan High School - Pacemaker Yearbook (Fort Morgan, CO) online yearbook collection, 1978 Edition, Page 1

1978

Fort Morgan High School - Pacemaker Yearbook (Fort Morgan, CO) online yearbook collection, 1979 Edition, Page 1

1979

1985 Edition, online yearbooks, online annuals 1970 Edition, online yearbooks, online annuals 1972 Edition, online yearbooks, online annuals 1965 Edition, online yearbooks, online annuals 1983 Edition, online yearbooks, online annuals 1983 Edition, online yearbooks, online annuals
FIND FRIENDS AND CLASMATES GENEALOGY ARCHIVE REUNION PLANNING
Are you trying to find old school friends, old classmates, fellow servicemen or shipmates? Do you want to see past girlfriends or boyfriends? Relive homecoming, prom, graduation, and other moments on campus captured in yearbook pictures. Revisit your fraternity or sorority and see familiar places. See members of old school clubs and relive old times. Start your search today! Looking for old family members and relatives? Do you want to find pictures of parents or grandparents when they were in school? Want to find out what hairstyle was popular in the 1920s? E-Yearbook.com has a wealth of genealogy information spanning over a century for many schools with full text search. Use our online Genealogy Resource to uncover history quickly! Are you planning a reunion and need assistance? E-Yearbook.com can help you with scanning and providing access to yearbook images for promotional materials and activities. We can provide you with an electronic version of your yearbook that can assist you with reunion planning. E-Yearbook.com will also publish the yearbook images online for people to share and enjoy.