Forest Avenue High School - Forester Yearbook (Dallas, TX), Class of 1925, Cover

“

1 " qvGi'Cl-2v'-f-f2'- awww. NK l 5,44 ff fl f vf Q5 2' 0 'Z IW 3 f '90 V - L. WIQHIHII Im. " - S Z LSXE Q 5 2' E x24 I ' D? SZ-J ' Ex I..-1L1'1S 4 , u 4 7 4 x X ni- ' f dl' 1 45, vu-55 i,nbg Q , . , QQ, I 3 X NEEL WARFIELD Edztor-Im flzigf eva GERALD MCTNABB Wllffllflf Manager QHE CFUEEETEE 1 9 2 5 I Published by The Senior C7355 l of FOREST AVENUE HIGH SCHOOL Dallas, Texas VOLUME IX MR. F. E. NORTON Y nl g' Y Ill g l r q ir JU V edication To our friend Mr. F. E. Norton, who has Won the respect and admira- tion ofthe en tire student body through his Whole- hearted service to the school and its activities, We, the Senior Class of 1925, dedicate this, the ninth volume of the Foreyfer X 25 ,E A x i 1. , K e ww' t x f xy QS lnmljypw Nga If xf, f.- , 1 N , f - ' 1 Lv, of H out fl ,p l lin N ' t " '-2, MY 9, X ' fa- 'Q' v-A , ' "N . F - ax .N 7-A , 1 , my . Y sf , fffrfly-X, X, xx lxhw XZAVN N Whgffqf m ff 'NNN' N M , 53: "fag ll "I, ll: 5 pl l ,-4 K ff ' :9g'f':: 111351. ll ' r" I 2 stil? I, 'ff glffyg tllllll' .r M ' l' 5 fr ' , Hyzffz' Wilt' .,., 4 l J W, ,I ,.,J'-4115 'ti-Q.'.-31, .B " 5 y 1 , , 4557743247 'r..':t.1'.. 1 1,, H . , l . J, -wgfz' .uw ll l l mf Life is a leaf of paper wh1te, will W l W If 1 a,. -' ,X Whereon each of us may write." I' 1, ' ' A- t . , wuz! 'H l X ' Th srudent body has written a x, Z S chaptgr in the Book of Life. We,the M ,H I xy l staff, have endeavored to record these , yd' ,' W' ,,-11 ll X' I "M V. llhlll Writings in this,our Year Book. Thls ,xl ' ' V 1 l l 1 X , 1 l W... "Forester" IS a chapter ofwork,hap- yn x X ll ,H I V pincss, play, and success. The year 'W 1 Q y X IQ ,X itself can never be repeatefl, bin the f I NM X A W 'Hx events of the year can be xve over 4 ' N 1 Q 1 ill NH I in dreams. To bring tneyrixuqn future Ml X X ,. N Y ' rs the memory o I lS year In K 'K lf ,Q 'Y V I: il hinalest is the purpose of thrs pubhca- 5 J -13 f ii K tion. If in the future you final thxs 1 , 3 V 5 F F K' s 5 book a treasure trove of memorles of l. 2 ,. f' g 5 3 Forest,we who have worked on it wlll E 2 Ru ia: E l 'ff feel that our labors are well rewarded. Q LE IJ '4 'ji , . S , . 1, J- , ., : l :E -2:0 l -' 55 I ,, j f it ? ' ,? l - rs - f fav .y 5 ' Jos Mwnams. 'X V : ' 2 L ' get ' fZ- X 'P X x X r .. , A as J' w I ,, .uX...N-'X Page Eighty-Iwo N hm. 013.27 ofBoo1ns Che School C135 se Sm Hclcivihes Htlilefics Deparimenfs Sherwood EV' Tn Ullemoriam WILLIANI SUTH FRLAND B111 oh U1 fhe tomb 0 LZ muzzshefl blllllf in ze Mat If JMU Cf If , V f ' 1 Am! the mum! of a , ,' f 7.71 -wiv X f WZ 5 N N, N f, f 3 K , ,,,J..1a- X . ,W K" - 1' X 'H u '1viii'l"feig' Y' '2li'Qkf1133556 Q3-iliali y' hlIlII.f" 'J fl ff, ,MTW WM QCWWQ X 1' f'C VJ M fy, f A337 - , QUQIM-3 UMw g l Q E OtQsDoziev CLQ Schccl s I g nk 1 7 J ff ia 1 5 . THE SCHOOL . f v I Page Nina Page Tan 1 1 2 5 E i 'i Il lx ' l 5 li I , 9 l li 5 2 ill if 12 iii ti 71 e S-no , ,fu-...I Imam ofa e--S 1 - S 'sri l 3 ll 5 1 it Y , is is x 5 S a i i 5 gl 5 it in ff in l ll " ll . i l 3 1 i I li if i 1 l li l lil T l E , l 9 THE orrrcia ,, E I l' l l li ll ll ,l , ' ig . I ull 1 l Hzstory of Forest ofvenue Hzgh School , , r 1 1 l OREST Avenue High School was founded in 1915. It is a beautiful school with l W large classrooms, Wide corridors, a large auditorium, and modern equipment in the laboratories, business rooms, and gymnasium. M 1 1 li f l' ll The school was first established and organized in September, 1916, with an en- S rollment of seven hundred and thirteen. Mr. F. B. Cauthorn was appointed as the E 5 5' 5 il, first principal. The teachers and pupils Worked very hard, and the iirst year was very 5 5, li successful. During 1916-17, the Hamilton Literary Society, the Senate Literary So- I' ,E im 11: ciety, La Tertulia, the Shakespearean Club, the Crestha Club, and the Girls' Glee Q51 gl 'VN Club Were organized. The first monthly magazine, "The Forcsterf' was published xl i 4 in 1917- 1 if ii i l In September, 1917, Forest had an enrollment of seven hundred and forty-nine lg ! H 1 pupils, a slight increase over the first year. Rapid progress was made in athletics dur- if Q ing this term. The success of the football and basketball teams was Very marked, 5 despite the fact that this was the first year that the green and white had been repre- sented. Two new societies, the Forest Avenue High School Literary Society, and Q El Circulo Espanol, were organized. During this year the Great War was being il E ig fought, and we cannot forget the Wonderful spirit the Forest students manifested. 5 9 li gg 1 E! t ffl so J:Z1tii:?3,'1:i:gi3igg:3 We-'W'1!efuf+fef1e'me"memfe Heefwef'-1--Mm'e1""'e-"""l Lil F ...,..,,.....a.. ..,. .,.,,m,.,,.,.,,w ,ru-M K 7-W,,,:,,, , ,,,,,, no w,w,,,,L,,,,,,m,,LL,,C,,W: TY , U r-........,......i"":1:.t.T:g:L.fT::fg3'1':l':l"ij"'?""'i2TI's:i'W"t":sWrW:'ra- ee W is 'r'1f '-'f'H- -'i' - it--Wi "'eee --'- Y f - ,en-wt-we-,,.z.,,..,, , -,,,,, H , ,,,,,, Y, ,.,.,-... -n... ,, ,.., , , ,W Page Eleven Us i me 1 SECOND FLOOR CORRIDOR The third year at Forest was still more successful. The year began with an en- rollment of nine hundred and seventy-one students. The school was closed awhile during the fall of 1918 on account of an epidemic of influenza. The Standard De- bating Society was organized January 1, 1919. This club is a splendid organization and has continued to increase and improve until now it is the leading literary society of the Dallas High Schools. Great improvement was shown in athletics over the records of preceding years. Earle Wilson and Adolph Marder took their niche in the athletic hall of fame. , The year of 1919-20 was a most successful one. State championships were won in basketball and track, thus making Forest well known throughout the state. City honors were won in declamation and debating, and in the city interscholastic tennis tournament. In the lifth year there was an enrollment of fifteen hundred and eighty-five students, a marked increase over the first year. Mr. E. B. Cauthorn, our beloved and faithful principal, accepted a position in a large business firm, and was succeeded by Mr. Wylie A. Parker, former principal of Colonial Hill School, and a former teacher of both Bryan Street High School and Forest Avenue High School. The teachers and pupils were sorry to lose Mr. Cauthorn, but they cordially welcomed Mr. Parker Page 'Twelve l ID U19 1 THE LIBRARY as principal. The baseball team proved itself worthy of Commendation, and the track team won many honors in both city and district meets. Earle Wilson was our star for this year. Our debating team, composed of Wentworth Pierce and Dick Russell, won both city and district championship, and the girls, tennis team, composed of Lola Chapman and Theresa Kleinman, won the city championship. During the term of 1921-22, there were many important events. ln football the "Forest Eleven" lost only two games. The basketball team did some brilliant playing under the leadership of their captain, B. Nlann. The relay team of 1922 won the state event in the state meet at Austin. ln the fall of 1921, a very successful carnival was held, the First Forest Fun Frolic. The funds obtained from the Frolic were used to buy many beautiful pictures, which now adorn the walls in the corridors. Athletics and scholarship won many victories for Forest during the term of 1922 and 1923. Clean sportsmanship was manifested in all the athletic contests. The track, basketball, and baseball teams all had highly successful seasons. One notable feature of this year deserves special attention. Mr. Parker started a new plan to encourage scholarship and raise the standard of intelligence of the school. The pupils were urged to compete against their own records, that is, to raise w,r , L..- 1 Page Tlurleen El J U THE GYMNASIUM their own grades on each six weeks' report. Pupils who raised their grades from report to report, or who kept the same average, became members of the Principalls General Staff. The Arthur A. Everts Company presented beautiful gold pins to every student who obtained membership in the Principal's General Staff for four divisions, and also to those who were on the official roster. The year 1923-24 was one of the most successful in the history of Forest High, for the football season inspired Forest to do even better in other activities than in pre- vious years. Two scholarships given by the Reuben Davies Club Were Won by Goldina Mc- Farland in expression, and Mamie Grace Fenley in piano. Mamie Grace Fenley also Won a business scholarship offered by the Y. W. C. A. The year 192.4-25 was the most successful in the history of Forest. The "For- est Wondersl' in football beat Oak Cliff for the first time. They lost only two games during the entire season. The Forest High Golf Club was organized and is making a great record for itself. The enrollment reached a total of fifteen hundred and ninety-two pupils. Mr. Parker Went to Cincinnati to represent Forest at the National Educational Association, which met to discuss educational problems in the high school. I to l U Page Fo ufleen EI 1 I 1 I I l L. V. STOCKARD N. R. CROZIER E- B- CAUTHORN ADMINISTRATION N. R. CROZIER - - Supcrintcndent E. B. CAUTHORN - - .As.rirfa:zz Supcrinlsmlcnt BOARD W. C. LEMMON, President Alex W. Spence W. C. Everette Mrs. H. L. Peoples Boude Storey Mrs. Kirk Hall J. H. Black L. V. STOCKARD Supervisor of High School Instruction UR ANNUAL recognition of the administration would not be complete should We fail to recount the changes that have taken place in it during the past year. Two of the three of last year's group are still members, but each occupies a different position. Dr. F. Kimball, former superintendent, resigned, and the position Was given to Dr. Norman R. Crozier, former assistant superintendent, the position made vacant by Dr. Crozier's advancement Was given to Mr. E. B. Cauthorn, former superintendent of high school instruction, the position made vacant by Mr. Cauthornis promotion Was, in turn, given to Mr. L. V. Stockard, former principal of Bryan Street High School. We deeply regret the loss of' Dr. Kimball from the field of high school activity. Because of his sterling qualities of mind and character, he had endeared himself to us, hence, as a man and as an educator, We greatly miss him. But our loss was com pensated by an equal gain, and We consider ourselves very fortunate indeed, for in Dr. Crozier, We have found the same admirable qualities which characterized Dr. Kim ball and made possible his wonderful achievements. A To the administration and to the new School Board, we Wish to express our sin cere appreciation for all their efforts in our behalf during the year that has passed. May our earnest efforts and the accomplishments in the coming year prove our gratitude. V 1 III UI I LID Page Fifteen Ifl ,il ,Z s: 5 Z Qi E? 3? il ll 5. il il H il si gi ii li Q C ' l MR. VVYLIF A. PARKER Trilzeipzzl URING the past five years in which Mr. Parker has been our principal, Forest has made wonderful progress in all lines of activities, due to the remarkable leadership and influence of this quiet, but forceful man. The kindness, generosity, and patience with which he has dealt with us have endeared him to every pupil in the school. VVe have always found him willing to help, sympa- thetic, and appreciative. ln him are combined to a high degree, scholarship, sterling character, industry, patience, firmness and courtesy, and we consider it an honor and a real privilege to have him as our principal, our counselor, and more than thatfour true friend. y Q Page Sixieen U I .-.E I I Foculty IQ24-25 M1ss NANNTE D. ANDREWS ..,.,... ..................,........ JW athernatics MRs. MINNIE P. ARDREY .,..,,. .......,. L ...v.. - ..,...................A F rench MR. S. N. BAKER .,..,,........... ....,.,. S horthand and,Typewfi1fing MR. L. S. BARRETT ..... ,,,,.. .,.......... Jil e chanical 'Drawing Mxss IMOGENE BOARD ....... ............ ..,....................... A....... E n g lish Miss RUTH BARHAM ,.,,...,....,, - ......... . .,,,.,......... - ........,......... .. ......... Spanish MRs. HELEN C. BRAACK ....... .... - LL .... ...- ............,, L ....... .Study Hall MRS. EMMA H. BROWN ,,.,,,,. .......,...,..... - .... , ,.,. .. ........... Jil athematics MR. W. H..Bu'rLER .....,.. ..,,. H istory and Commercial Geography MAJOR H. E. CARRICO ....,........ ,. ...,......, Jllilitary Science and Tactics Mxss ETHEL1 CARTER. ...........,....... .............................. - ...Ojice .Assistant MAJOR RICHARD L. COLEMAN .,....,.. ........ O 'Military Science and Tactics Miss SARA DAVIDSON ,....... Q ...,,,.., ................................................. S punish Miss GRACEL DENNX'. ,...........,.,., ........."Biology and General Science MRs. TURA W. DIAL ................... ........................................ 5 nglish Miss EMMALINE D. DONOHUE ........... ...... ............. L i hrarian Miss ELLEN. DOUGLAS ................ L ..,.... ... ............. History Mxss LOULA ELDER ,..,,,,.,. ......... ...... JW a thentatics Miss RETTIE ENSOR ............ L ...... .................................. V4 rt Miss RACHEL M. FOOTE ...... ......... - ......,.............. R egistrar MR. Miss Miss Mxss Miss Miss Miss MR. MRs. Miss MR. Mxss MR. Mlss Miss Miss MR. Miss MR. Mlss MR. MR. Miss Miss MR. MR. Miss Miss Miss Mlss Mlss MR. Mlss Miss MR. HERSCHEI. FoRREsTER .,..... .................w,.......... T hysics, and Chemistry CYNTHIA A. FRANK ..... ... .......................... - ............................... English MINNIE GALE ................ ., ............. Tontestic Science and Home Economics DOROTHY R. GERLACI-I, ...... L .....................,...................................... History ANNIE LEW GILLAM ........ ............................................ L ...Special Class MARY GIL,SON .....,............ ............................................................... , Spanish ALICE R. HARRINGTON ................ Tomestic Science and Home Economics CLYDE HILL ................. .......... - ...Journalism and Tuhlic Speaking PERCIE PIOLDEN ..,. .. ..,...,......................... Gymnasium 'Pianist BERTHA JACKSON ....... - .... L .... 4 .................,.................... English ALFRED Loos. ................... , .............. . ,.......... Jllathernatics and .Athletics J. HARRIETT MCCLELLAN .... .,... ......... .. ,......... Q ..............................Y E nglish C. T. MCCORMACK ..................... Vifccounting and Commercial Arithmetic ETI-:EL MAsTERs. ....... ...Q ........................,........................ . ......,. Latin PEARLE MATTHEWS .... LOURANIA MILLER ...... GRAY MOORE , ...... W. IVIARGARET S. MOSBY ,.,,. C. A. MURRAX' ,.,,...... ELLA J. MURPHY ..... ,. F. E. NOIl'FON . EARL R. PARKER .. LOTTIE PLUMMER ..... JULIA PRITCHETT .... GEORGE C. RORIE L. E. ROSSER ...,,..... EDNA ROWE ,....,. MABEL SHAW ....... RUTH ST. JOHN .. . BESSIE 'PHATCHER .,........... FLETCHER R. WICKPIAKI J. T. USRY .................... ....... LOUISE WILCOX . JENNIE R. WOLFE ...... H. B. YATES. .... .... ... ....., Tomestic Vfrt ......... ....-.............-.Latin .. ....... .................. ..... C h emistry .......-......................... Histo ry ..............,...............c7llathe1natics ........JWathematics and English ...........,......................... Histo ry ..............t....................... Physics ........................................Spanish ,.......Shorthan1l and 'fypewriting .... ..................... -..Jllathematics .........,...........-,....Jllathematics ... ...,..., English and Counselor ......... ...........-Thysical Training ..-.........................................English ..... ...........................,... History .....-............-.........-.......Spanish ........Sociul Science and History ..........-....................... Jllusic ............Secretary to Trincipal - .............................. .History Elf In Page .Seoenteni "U , V f ii 33 if i 1. I' Elf Page Eiglzleen Miss MARGARET S. Mossy B. S. and M. A. Peabody College M Rs. PERCIE HOLDEN MR. W. H. BUTLER H. A, and M. A. Unirerxity of Texax Miss CYNTHIA FRANK B. L. Washburn College Miss IMOGENE BOARD B. A. Baylor Unifversity MR. GEORGE C. Roma H. A. U7Zi'L'Ef.ffl3' of Arknmas 52901, MR. T. USRY B. A. Peabf1zfyC0lls'gc MRS. MINNI15 P. ARDREY B. S. U7Zfi'C7'.Vff3' of Texas 9 f f mx... .h-....., N -...,...-.-.........,....,.........-----w--f----'--f-f-0f MR. S. N. BAKER Wz'xI4'1'71 Sizzle Nnrvzal College--A Miss RETTIE ENSOR B. S. Peabody College M155 ALICE R. HARR1NcToN B. S. Univerxily of Arkanxax MR. CLYDE WALTER HILL MR. EARL PARKER H. A. Ausfifz College Miss RACHEL M. FOOTE Ph. B. University af Chicago 1 . ,1 P X ffllilffflfr Miss GRACE DENNY B. A. Unifuersity of Texas MR. F. E. NORTON B. A. University of Texas H. A. and L. L. B. Texas Universify TE V? .L,....., . 2 1' e ,f . 1 S 12 2. 33 5" 'E 2. 5. E3 Ei EI 53 LV fi N H 13 B. ia S5 i, s '4 I 5 r E1 E5 .1 5? J if i :7 2- l'L 5? fi px :ii iQ? as :S .. ,A .. .lx E? I' E? if ig 22 22 ,, 52 EP sg 2? 22 .M EE SS 22 is ii fi . ik E: 3: 3? ii J 1 ae Sk E. ,. E5 59 12,5 iz fe ge is .1 S1 Page Nineleen Pagu Twenty ,N MAJUR H. li. Cmuuvu f.v."IIfl'tIl Tmivzing Srfmnl for Czzvaffy af For! Rflvy, Kawai NIISS EUNA Rexx 1-i H. .'f.a1I.!'.11. ff. l'f11Z'f'1xfly uf Trxax Miss JULIA PRl'l4CHE'l'T H. A. LfvlZii'A'l'5ffy of Tuxax NIR. L. E. Russmz H. fl. Bayfur lfrzi-z'.'1',fily MR. GRAY Moom: lf. :1. S0z4fl1tL'wIf'z'11 lfrziiwfxity NIISS NI,-us!-11. S 11.-uv lxflfogg Stfzuol of Physftaf Edzuwziiurz Miss LoU1,A linnrzu ll. xl. fz11ffM. A. IJ'IIf'I'l'l'Xflj' of Oklahoma MR. C. T. McCum1AcK D1'nugh11'.r Eznifzfxx Cnflvgr f,'u11rlr1fySrM1ol of l"rr1z1111a21.vf1ip R ..,.-7. 4 QE ffTi2g1p'i"i fJ,' -'y,,...A-4. MR. H. B. X7ATES lf. 1-1. U11i'zw'1'.vily of Tmzfzfxxu' Mus. EMMA H. Blcowy L. I. Urlizw-.fify r1ff11'kn21.m5 ,Ynzvnlf Sfhzmf, H. 11. H. xl. Urliiw-iffy nf drfmzzsns Miss .ILLNNILQ R. WOI.FE 111171 npnlflafz lfIl5f7IL'S.f C0l1.fg.- Mlss SARAH DAVIDSUN lf. fl. Uni-z'4'r.rfly of Texas Miss PEARL IVIATTHEXVS If. S. Ifolfugr of Industrial Arty MRS. TURA W. DIAL H. S. Prabody College Miss LQURANIA MILLER H Ji. Urlimmvity Miss -I. fiARRIE'l'T MCCLELLAN B. A. Imiiafm Stale University 1 Page Twenfy-one 1 5 i 2 S li 1, 5 I! E 55 S 4 2 1 4 EE if E! 5 , E Q is S 5 x Y Page Twenty-two 449 Mlss FLETCHI-LR R. WICKHAM B. A. Uniwerxily of Oklahoma Miss ELLA MURPHY Ph. B. Uniwfrxily of Clllmgo MR. ALFRED Loos B. A. Grinnell College Miss LOTTIE PLUIVIMER B. A. Uni-versiiy of Texas Miss NIIYNIE cz.-KLIC Lincoln Callegv of JlI1l2t'5 Milik1'11 U Miss ETHEL MASTERS 3. A. Uniwvsify of Txxax Miss LOUISE W11.cox Missouri Slate Teachurk Collegi- MR. HERSCHEL FORRESTER B. A. Merce1' Unifzfenity if T W Ay, L1 .A-4IiiiillfiL31liZff?:T:ii:ii:::jiit333ii'1: gg14,,g'.1f:7t"'"'::T:iiZii'W'fYiT:LiTil.3L3i LLii,M4Z's-Em N, .W ,- ,,,,,x, W ,.,, m,mWM,M, W.....,,A , ,..m.,,M.,,T.Q.,..,.,,..,.,..? jg 2 +V 43 i Y ix 35212 sk w ff gg RW . IH 1:11 me M 55 , IME Q' ff 3? :iii fi W 1 41 K: M + Ei if i' fi 1 ix 5: Ei X lg H L' 5511 f 1 vf? wi ,EH F . 'E f'12 if sf Ni if Zi ill Ei Ez fm tu if vs EH r, is :Q x ps ge si 21 259 M 'ii' fi if 555 if :E ff 312 if ei 1 ga 25 si in lb 1' 1 i P Vi 'N 35 if It V is ?k wg QU ,S fa if 1: 55 if A Sl is 1f55 ix if 25 si pa i? gg 'f 22 E! 21, 52 gs f 2 Ei W ,Q fi 51 f Eg sf gzy f 55 22 is 12 fi EE S: 5 zx ii 2 if E! 11 :P 2. gl E291 X' 21 gf 22 Ei gn 21 is Y ' 5: ' 29 25 I. 5' is ,. gf ug ' t Q . 511' ,, A, 15 Q5 3? f' Q9 Ei si al 5: ig eq 5? fi is if as if 35 fi H al. fi is 2? :E ig Ei Q1 Ei S24 2 2 ff 2 E E: , w if + if 2 gi aw v I HN E is Q i?: 155 2 1. 91 :A Q2 Q 21 i 5242 ii .fy X5 if xx fl , YZ if A - 1 55 fi il V14 fa? gg as :Z 1 5 5' , 5 . 1 . ' A zz: QI if - I , 1 4, .Q , U :I I . 55 Q5 H M K X , gl 22 ws 52 ai 13,3 5 ' 1 Li fi if fi fit Z5 21 M 0 . ii , l 1 , , 4. -r I , 4 'lr ?i :ff f si H 5 ' lFL.,.!ig , H. 4 ...X .,,,.. ,.,,j1f1i'ji'jjjjj'j-KM'-HM'--www-www'-m---Q-W-M--A-M-Y -sr--..-m..-....n-- , -M.if-mm-1Jam-.-.M,:.,.wn, , ,,, 1 V :2 .V,,, 7 iffy, Q .-4v,Y4 ' '"ww-"'M'4w---mf-'M-'-1-'f--H-W-M-L-fA--M-.-........n,..,...,.....,...-,.A,.,..,,--- ,Yf, ,f-.1..m............,,,,..,,,.,..,,,.........,.,,,,,A,,.L ,,,Y. :..,,,::Lw,,,,wx:.mwl WJ! f Q1fmm-M- -.-Wp-,.-. ,. . m-.w,..,,,,,.m.,,,, . H, A ,M , ,. m,,M,,m,,,W,WM,,,,,-,mW,-M Ar f' , in-V -f-H-m----N----- f- WM.-my-W.-.M-.-M...,Q,..-M,..-M.M.M...,-,,w ....:h. -.,,W.,,..,,..-,.w.,K,,.....,--,,.:--...,.,,..,.,'-t"-wQ Page Twenly-three w Y'-:emily-fo Our Loyalty Song If you ll1lVCHll lielt the hot' tears come, .-Xs you join with the wet-eyed throng And sing, in that moment of sxttl clcfeitt, Qur clear old Loyalty Song' .... . lt' yott h:1t'en't choked zz hard lump clown As the clear notes ring' out strong, Wlhen the Seniors rcacli the end of the trqtil, .-Xncl they sing that Loygtlty Song. . . . A a ll yott httyent clenchttl your hqtntls gtncl prnyecl, VVhen the Tegun is tighting' along And you know you must put all your heitrt :intl your sou lnto the Loyalty Song ..... lf you hin'en't thrilled with n joyous thrill Wyhcn you know that you really helong, 'llhen you cztnnot sing ns it Forester sings. . 'llhatt tlciir oltl Loyalty Songl fHtjli'l'lQNSlQ Pstxlmtzitls lntxinatiitt. '23 '23 1' lVe're loyal to you, Forest High, The Green and the White, Forest High, NVe'll luck you to stgtntl 'ggtinst the hcst in the land, For we know you have sand, lforest High, R.thl l Rithl l Go lifter that lull, Forest High, VVe're hztcking you itll, Forest High, Our tegtnt is our ligtmecl protector, Un hoysl For we expect il Victory from you, Forest High. ' Z gm mmm X S X I Q I NSVWQXX X fl W xlxxxxtllkyk "germ, aww, ' 9 nm 'fx.5xw W 6 Q ff K 21- - V V ' - ,, 'W-' ,, pa- " - "' Q '16 -Y Y " X mm , Z 7? 3, 7 'N' 5 T,,3:,,m! A 4 n'I'1??1T xg Las:-:u::a'V Us JU 1 June 925 Seniors THETIS LEMMON GERALD MCNABB CHARLES WALDMAN ROBERT BuRNs Secretary President Vice-President Treasurer History of the June 325 Class T one o'eloek on a bright September day in IQZI, a school of green fish, big fish, little fish, lean fish, fat fish, and a few other specimens not found in an ordinary aquarium, swam into the sea of students at Forest High. With much difliculty we fish assembled and held our first meeting October 31, 1921. The fol- lowing officers were elected: President, Frank Fstesg Vice-President, Henry Adams, Secretary and Treasurer, Clara Goldberg, Class Prophet and Historian, Maurine For- ester. This first year of our school life at Forest was certainly an invitation to come again next year. lt was not until November 1922, of our second year, that we attempted to or- ganize ourselves into a class. The oflicers elected were: President, Frank Fstesg Vice- President, Henry Adams, Secretary and Treasurer, Clara Goldberg. Dorothy VVin- frey, Fmogene Frey, and Evelyn Oppenheimer were our reporters, and Miss Swin- dells our sponsor. These officers held sway during the entire year and proved very capable and efficient. Many were elected into clubs, many were on the scholarship assemblies, and all attended the football games. At the close of the sophomore year, W-n-1-W WT-..-',qsm.m,.,.-1-zz..--s.v.W ,.,....,...v ... A-..,...,...,.G .. 1 ...7,.,. --- Page Twenty June 725 Sponsors MISS Al. IIARRIETT MCCLELLAN ' MISS EDNA ROWE we faced the future with a successful Past and the determination that we would al- ways be loyal 4'Forcsters." ln the third year the class of June ,25 showed up better than ever. A stronger feeling of class spirit and loyalty was evident. We subscribed practically one hun- dred per cent to the 4'Forester,', and heartily supported all other activities. We haunted the side lines of the Forest gridiron and cage, and fought right along with the men. ln '24 our President was again Frank listesg Vice-President, Clarence Huntg Secretary, Charlie Waldniang and Miss Harriett McClellan, Sponsor. Now at last we are dignified Seniors, looking as important as we feel. The lirst half of this last and IHOSI eventful and important year was again lcd hy Frank listes as Presidentg Vice-President, Charlie VValdn1ang Secretary and Treasurer, Neel War- heldg Miss Harriett lWcClellan, Sponsor. Neel Warfield was elected Editor-in- Chief of the Annual, and Gerald lVlcNabh, Business lVIanager. Fvelyn Gaines was chosen as Class Historian, and Marie Kynerd, Class Prophet. Our Senior rings and pins have been ordered and everything points to the most successful year of all the four. At mid-term we elected as President Gerald McNahh5 Vice-President, Charlie Waldmang Secretary, Thetis Lernrnong and Treasurer, Robert Burns. It will HDI he long before we shall he leaving Forest High and all our teachers and classmates who have been associated with us through four years of work and pleasure. But it makes no difference what we shall do or where we may go, we shall always he found loyal and eager to do our bit for Forest Avenue High School. Page Twenty-:ix Ur A JU MINNIE DEE TURNER Girl Reserves. BEN WATHEN Camp Dallas '23, '24, Crack Company '24, Principal's General Staif, Poet's Corner, Hi Pepper Club, El Circulo Espanol. FLORENCE RYAN Auditores Caesaris '24, '25, Girls' Public Speak- ing Club, President '24, Treasurer '24, Girl Re- serves '21, '24, Golf Club, President '24, '25, Sliurter Oratorical Contest '24, Annual Staifg DORRIS APPLE Poets' Corner '21, Girl Reserves '21, 7225 Fun Frolic '22, Gym Dem 7225 Commercial Club '23, Principal's General Staff '23, '24, Annual Staff '255 Pep Squad '23, WALTER EWELL ' Football Team '24, Lions' Club, Band. l l Hi Pepper Club '2I, "Roman-American Weclding" ETTA BELL MLRDOLK l '23, Principal's General Staff, Scholarship As- Principz1l's General Staff '23, '245 Gym Dem '22, 4 semblies. :23. ELMER WAGNER 1 Hi-Scholarship Club '2g1.21i?5g Principal's General RICHARD DATHE E ALGENE BALE. El Circulo Espanol '24, Principal's General Staff. Tau Delta Epsilon, Girls' Public Speaking Club, N Gym Dem '22, Komcdy Koncert, Girl Reserves, BERTHA BETHURUM Vice-President '23, President '24, Golf Club. Principal's General Staff, Radio Club. l I rl 4 i l, i 'Q 1 li li r 5 5 - -is 1 -,.-,Y-2 2 V- 2 We ,-.....-.e,Zl Y " " W' 'T"v-ff-fi, 2 CT, ,C lllll, ll llll,, M ,Ji Page Twenty-seven l , MARGARET VINEYARD I'rincipal's General Staff, Girl Reserves, Audi- tores Caesaris, Poets' Corner, Gym Dem. REX PYRON Principal's General Staff. EVELYN OPPENHEIMER Scholarship Assemblies, Forester Staff '21, '22, '23, Assistant Editor '24, Annual Staff '23, Girl's Public Speaking Club, Vice-President, Par- liamcntarian, Hi-Scholarship Club, President, Sec- retary, Literary Dramatic Club, Le Cercle Chan- tecler, President, Vice-President, Parliamentarian, Southern Inter-Scholastic Debating Champion '24, Forest Publicity Reporter, Annual Staff '25. OLIVER BRECHT Baseball Team '23, '24, '25, Lions' Club '23, '24, '25, Football Team '245 Glee Club '23, Commercial Club '23. WILLIE MABEL TAYLOR Girl Reserves, Gym Dem '21, ,223 Hi-Scholar- ship Club '22-'25, Scholarship Assemblies, Prin- cipal's General Staff- Secretary, Junior Class '24, Annual Staff '25, Golf Club, Girls' Public Speak- ing Club, Forester Staff. IVON. DOBSON Crack Company 7225 Hi Pepper Club, Principal's General Staff. CATHERINE LIVELY Hi-Scholarship Club '23, Principal's General Staff, Girl Reserves, Hi Pepper Club, Gym Dem ,2I, '22, Poets' Corner. MARIE KYNERD Crestha Club, Secretary '24, Crestha Capers '24, '25, Symposium Club, Symposium Musical Re- vue '23, Literary Dramatic Club '21, Principal's General Staff, Annual Staff ,25. PAULINE GOLDBAUM junior Chamber of Commerce Essay, Ist prize '24, Literary Dramatic Club '22, UA Christmas Carol" '24, Principal's General Staff, Hi-Schol- arship Club, Secretary '24, President '25, Schol- arship Assemblies, Annual Staff '25, Girls' Public Speaking Club, Vice-President '24, Secretary '25. JESSE BODIFORD Pep Squad '23, Crack Company '24, Principa1's General Staff, Fun Frolic '24. 1l'l ,i ' Mmm? VW E LJ: ,il , lil 1 ll? 4' 'L d I -W --YY H 4.f.a,..t.......,.,....2..f....a...,.,.......,.......,....,..... L.. Jr iz gl- 2QlL2.ff1 ""' Q Page Twenty-eight Y FRANK DAUDELIN Camp Dallas '22, '23, Marksman '22, Eiilciency Medal '22, lst Lieutenant, R. O. T. C. VIDA RHODES El Circulo Espanol, Girl Reserves, Principal's General Staff, Gym Dem '22, '23. LULA KING HUSSEY Girl Reserves, Forest Literary Dramatic, Forest High Orchestra, E1 Circulo Espanol. HOWARD ANDERSON Scholarship Assemblies '21-'24, Debating Team '25, Bryan High Literary Dramatic, Secretary, Treasurer ,203 Bryan High Latin Club '23, '24. KENNETH LAGOW Principal's General Staif, Scholarship Assemblies '21-'24, OTIS DOZIER Forhi Art Society, Principal's General Stall '23- '25, Art Editor, Forester ,22, '24, '25, Art Edi- tor, Annual '23, '25, Les Beaux Arts Club. KATHERINE STEPHENSON Annual Staff '25, Poets' Corner '22, Le Ccrcle Chantecler 722, '23, Literary Dramatic Club '22, '23, Girl Reserves '21, '22, Pep Squad '22, '23, Gym Dem ,22, '23. 'ELIZABETH WILLIAMS Golf Club. SADIE MAE WRIGHTSMAN Gym Dem '21, '22, Hi Pepper Club '21, Pep Squad '24, Fun Frolic '22, t'Le Petit Paris" '22, Principal's General Staff '23, IZ4. JAMES MCGRATH Lieutenant, R. O. T. C., Crack Company '23, 24, Camp Dallas ,245 E1 Circulo Espanol '23, Ser- geant-at-Arms, Junior Class 'z4. x Page Twenty nme gum-.1 ,s..s.....a..:.L1sa..gewa...,.,.s,-....w......m.1Ei...a..,s-..,Q.....a.Ws-Q22.M ..s,.,.-- ..aL..,,t... W ...,....-. , ,.,...,.... H 1 ,gf 2... ,,,.,,.f-.....,.....w,-,.-.... -.- . 1 L 1 ., 1 nf 1, 5-si W- W.-n...f..MT....,... ,T 7,L,,,,1,-,L3g,gg:- f.-iw--HW-. aff .ff -'-- -f f-ff f-f-my ':" H K 1 1 23 EE 1 fi ii 1 1 1 1 1 2 Z E i 2 L ll Q if 11 S1 is 1 331 Qi , 3 11 1, 1 s gg 1 2 1 1 11 11 3 i l li li 3 1 1 Z gl 1 l l S 2 1 1 li 1' 1' 5 '1 1 !i gl 11 11 l ii 11' N11 1 1 il 2 51 1. 1 ii I i 3 11 i li it ii 11 Ii ' 1 1 1' 1 1 i 3 1111 1 ' 1' 1 1 1' 1 'I GLADYS SHORT PIERRE FONTAINE Girl Reserves ,215 Gym Dem '21, ,225 Princi- Camp Dallas ,2l, ,22, '235 Crack Company ,2I. pal's General Stalfg Scholarship Assembliesg Pep Squad. JEANETTE SPENCER VVILLIAM SINGLETON Annual staff ,255 .Commercial Club Reporter 1245 , Captain R. O' T. C.. Camp Dallas ,23 ,24' Principa s General Staifg Roman-American 1 C k 6 , , ,' DA d 1 ' ' WCddlHg,, '235 Girl Reserves ,205 Hi Pepper 1 1 rac ompany 23, 24, rum an Bug e Corps Club ,ZIA Golf Club ,2 25 1 Q! 7223 Rifle Club ,223 Demosthenes Debating So- l 4' ' i ciety 'zzg "Roman-American Weddingng Komedy Koncert '235 Principal's General Staff. ELSIE STEGMAN Principal's General Staffg Commercial Club5 Q 1 ETHEL SHINDER Salesmanship Club5 Volley Ball Team. A ' Q Girl Reservcsg Girls' Public Speaking Club3 Prin- 1 1 Q1 cipal's General Staff. 1 1 1 T1 EDITH GOAD 11 1 D 1 ,L LONGWORTH LUNDELL Girl Reserves, SCClE5i1ZatiL243 Forest Literary N i 1 Principal's General Staffg El Circulo Espanol5 1 i '1 1 I 1 i 1 Standard Debating Society3 Debate Team '25. 11 'i 1 ' 1 11 1 Wi ARTHUR SULLIVAN 1 9 ' DAPHNE RUTHERFORD Bandg Orchestrag El Circulo Espanolg Radio i 1' Girl Reservesg Principal's General Staff. Clubg Hi-Y Club. i Ni 11 1 1 A1 ix V 1 11 1 1. 11 1 , Q 1 , " ' 1 l 1 l 1 1 1 l 1, 41 1 1 1 11 . 1 . 1' ' 11 EQ '11 l 1 1 T 1 1 F M , 11 L1 11 V' 311 EQ1 'VY Zi if "1 11 11 5 1 11 1215 11 211i 111 11 1 41" I5 il j 511 lili 3.31 .11 f 1 15 '1 11 fl 11 11 1 1 1 i'1L1i 1:1 '- i1 Q11 if 1' l 1 li 1 lf 51 5 4 Q 1' 11 ' 11 111i 111 1 1ij1 '11 5,11 ,1' 1.1 H1 11 if fb--1-A ..,, wma ,,,,,. , ,LWW V 1 V L 1 'M KW. Y Y MM H Y KAFMI M-M salt: ,AY M 'YW HJ 1 """""fE'1F:'5:' "J ' '-e-'---'ff . W-. W- -7-242 . l"n""'n""'f"" -W L "'L"""hv R"'.Q.l1l.,IlLl.ff.Qf'fhM'ffLL.QQ,'Q1' 'N , ij NL We--M C N C C W ' Wm C wi QW, Laflgillil-i"'ii'Tq' T7 '11wffiilfQf2'.iijZ7T3Tffiil3ilf"5 'f"lf' ll'lf.IiiQIQili,l' . ,JE Page Thirty l 1 E , 4 1 ,t w -. Y --,LW - ff ' Y- -fr' j"' 1i""'if3 S ' just L .W .3 "M-F C' if S ll ll V E il El ll Q 11 S Q A ii il E 1 l Q ll i lf ' 1 WUANITA JOHNSEN CHAD STARKS Crestha Club, Treasurer '24, Crestha Capers '24, Pi-incipa1's General Staff, Symposium Club, Principal's General Staif. il '5 ROBERT BURNS LOUISE WESCH Hi-Y Club '22, '23, '24, Crack Company '23, Girl Reserves, Principal's General Staff, Gym r , Camp Dallas '23, '24, Captain, R. O. T. C. Dem '22, Girls' Pep Squad, El Circulo Espanol. 3 MARGUERITE HARRISON Commercial Club, Girls' Public Speaking Club, RUBY WARE' 'li Girl Reserves, El Circulo Espanol, Gregg Club, Forest Literary Dramatic, Girl Reserves, Audi- Principal's General Staff. tores Caesaris, "Roman-American Wedding", fm Poets' Corner, Pep Squad, Scholarship Assem- FRANK AUTRY bliesg Gym Dem 721, 722. if Q' Forester Staff '23, '24, Assistant Editor of An- if 1 nual '24, '25, E1 Circulo Espanol, Vice-President 3 r 4 N X' '24, Hi-Scholarship Club '22-'25, Treasurer '24, LLILABETH MONLRIEF Principal's General Staff, HA Christmas Gym Dem '21, '22, English Club '21, El Cir- 51 Carol" '23. culo Espanol '23, '24, Girl Reserves '21, Pep 51 Squad '21-'24, Principa1's General Staff '23, '24. Q KATHLEEN FREELAND X Annual Staff '25, Forest Literary Dramatic, For- l ' hi Art Club, Girl Reserves, Auditores Cacsaris, GH-'BERT CARTER KLROUIHFI-AH1Cl'lC3H Wedding", Pep Squad, Schol- ISK Lieutenant, R. O. T. C., Band '24, Stand- arship Assemblies, Principal's General Stalf, Gym ard Debating Society '23, '24, Secretary '23, Hi- ' ' Dem 721, 322. Y Club '22-'z4. Q Wi I . 5' fl 3 A Q ir G ag r 5 Q ill ll 5, ii it lg ri vii if f' ll L , N ll il ' 1 1 E ' il i 'll ll -Y W..- ..,,,,.,.,,, ...,L,,,., LLL., ,W ,,., , ...-.,..,, , ,,, ,, ,, ,LH ,W Y ,Y,Y 'ww ,Y,,, N, L C ...,-.2.,,,..-.-, Y -- 'v""""""""' "i W""e " L-:-. Y 52221.92-fLggL52i?7x:i1LQ.zifif'TTQ2:-,11i22iQ?Q.5in Page Thirty-one ENE Fuse-a .a..wQ....,,...1w.......,.s,,,...,......M.....,.,,,.,.. ..-we .........,.-..........,.a........y.,.-a..m................m...-,,...l...-..,..- J' 2 LM.,v.-Q..-w..v-wana.-..,.w.i-q...,....-.-M..v-.--wha..wwW.-2,-4.c,-2...v....-....,-,.s-..w.a.,.-,.,..-wem.r.-,ff...-..,-..mc..f-u,..4,.,.,.we-vwf-.,,v 2 5 , 5 M... G , ma, ,wid 9,1 : muaN..wwfugmaw.W.w.MAmwm.mMMNmMswa.f....-.2...,..W-f-m---f- i 5 r li 5, ll f 4. Q' -4 n ,1 it 1 lil Q I ,Wag .,,.,,,,.,.,,,,,.-....:.,,, f,.- :,,.e-.m.,N.. ,.,..-....s,w , G., .V , Y . - - i A . Q 2 1 s ? 5 1 5 I 3 2 QS E S E? 2 ii I G ll 1' ,i l li lt ll ji Il ll ! l ij f ll il il 1 11 l ,, 15 l l Q ll s ll 5' 2 Yi' ll i ll ll NIILDRED FREELAND JACQUELYN JONES Commercial Club '245 Gym Dem 'Z2. Girl Reservesg Principal's General Staff, E1 Cir- , culo Espanol. MAY HOFFMAN L0 Cerclc Chanteclcr '23, "Le Petit Paris" 'ZI5 1 STANLEY WILKE5 Poets' Corner, Principa1's General Staff '22-'243 2nd LICUYCHHHY, R- O' T- C-S PCP Squad 713- Pep Squad '23. , i DOTTIE FOWLER i ' l 3: PAUL JEFFERS Gym Dem '21, Hi-Scholarship Club '225 "Ro- l Auditores Caesaris '2I5 Hi-Y Club '22-'ZSS Prin- m311'Amer'c3n Vveddingni 1'fiHCiPH1'S Genera' ll l ,Q cipa1's General Staff '23, '24, Staff' li, '3 1' if 5 l l wa 2 l le! ll eg it it RUTH STEERE IRVIN BEREN g l 1 il 1 Girls' Public Speaking Club, Girl Reserves, Treas- Standard Debating Society, Auditores Caesarisg l l fl urer '25g Commercial Club, Gym Dem '23, '24, Hi-Scholarship Club, Treasurer '25, Senior Play. 5 fi Komedy Koncertg Fun Frolic '22, '23. I W il ll Ii ll ll . V L' , li 1 ELOISE sIsK r 1 ' LUCILE MARKHAM Semper Fidclis, Bryan Highg Principal's General l Forest Literary Dramatic. Staif. l . 2 9 'l ls l l l l' li .l Q li . 1 il ,E gi i i il li " L iii r E ll l IE ll ? Q Ei E sl 2 r gl lr S El i..MM...2,,V....M,w....r..,.mi.m.,.2,.,..W....2..,.,..Q........a.,2.....M.2...,,,.,.w,mwt,.N ,.,.,. X 5' H--:W--M-A--Mw.w..a-w-avg.-..mm.a.my..,,....,..........au.,.v.,,.,l,,., W,,,,,,,Q,.,M,,,,,,,,,,,,,,,..,,,,,mw,,,,,,,,,,,n,.,..2,,..,..,,,,0...,,.gA-.W.,,..a.a..w..-....mfF..f.a-.v-.-WW.-...a.fs.-f.w-ww.,-am-V-M-lc? S, lm! """"m'f"""'L .V W , 2.-V -- . ffar Page Tlzirly-I-wo rn 1 U FREDERICK HAAS Crack Company ,2I, ,225 Hi-Y Club '21-,235 Glee Club, ,23-'25, Principal's General Staff. ELNA RIDDELL Girl Reserves. EVELYN NORMAN. Girl Reserves, Principal's General Staff. CLAIRENE ROGERS Forest Literary Dramatic ,215 El Circulo Espanol, Principalls General Staff. EDGAR HUCKABY Crack Company ,233 Hi-Y Club '23, '24, 2nd Lieutenant, R. O. T. C., Forester Staff ,25. ELIZABETH POTTS Tau Delta Epsilon, Secretary ,24, ,255 Commcr- W cial Club ,23, ,245 Principalls General StaH ,23, '24, Girl Reserves ,223 Le Cercle Chantecler ,23, '24, Volley Ball Team 722-,245 Girls, Public Speaking Club ,243 Pep Club '23, ,245 Gym Dem ,ZZ-,243 Golf Club ,24, ,25. LILLIAN GREEN Girl Reserves, Girls' Public Speaking Club, Sec- l retary, Parliamentarian, Orchestra, Principal's General Staff. FLOYD PRATT 1 Principal's General Staff. ROSE ROTHSCHILD Girl Reservesg Le Cercle Chanteclerg Poets, Cor- ner, Scholarship Assemblies, Principalls General Stall, Gym Dem. SELMA GOLDSMITH Girls' Public Speaking Club '23, Principal's Gen- eral Staff, Orchestra 722-724. l l l as rl :Ii ! sl ill r l R ll l , S s s r,r 1' lbw: L E LQ Page Thirty-three lr-A C I j ,i I , N r li lf ll ff 1 'sw 5 :I 31 lj Q i l U '1 LUCILLE REID , KATHERINE SLATON Girl Reserves ,22, '23g Principal's General Staff Commercial Club 'z4g Principalls General Staff ,ZZ-,24. '23g Scholarship Assemblies ,2I, '22g Pep Squad ,22. MARGARET SULLIVAN Le Cercle Chanteclerg Girl Reservesg Principal's JULIAIHAAS General Staffs poetsv Comer. Gym Dem lzz, '235 Prmcipal's General SIIIEQ Girl Reserves. HN H F MA Prgx?ipal's Gcsngal Srjaff. OLIVER RAYNER Hi-Y Clubg Crack Company 723-72.45 Camp Dallas l22, ,235 Scholarship Assemhlies5 Captain, R. O. BESSIE GOEBEL T- C- Hi-Scholarship Club5 El Circulo Espanol, Treas- urer '24g Principal's General StaFt'5 Salesmanship ,, Clubg Gym Dem 721, ,223 "A Christmas Carolv . MATIIE .MAE MADDEN ,Zn Girls, Puhlrc Speaking Llubg Gym Dem 72.13 J' Principz1l's General Stzlflg Pep Squadg El Circuln Espanol. RUBY ALLUIVIBAUGH Principal's General Staff '22-,243 Gym Dem l22, BERTLE SKAGGS '23g Commercial Club. Girl Reserves. 1 li 1 rl l l 1 A l l l il is F fl lv I ll , 'll 1 I 1 i R, ll ..i , ,jr Y L 2 Page Thirly-four 'ln I CLARA GOLDBERG Girl Reserves '21-'23, Secretary, Freshman Class '21, Secretary, Sophomore Class '22, Chief of Principal's General Staff '23, Girls' Public Speak- ing Club, President '23, '24, Secretary '23, '24, Parliamentarian '22, Shurter Oratorical Contest '24, Annual Staff '25, Forester Staff '25, Sophie Newcomb Debate '25, ABE SCHACKMAN Poets' Corner, Principa1's General Staff, Hi- Pepper Club. INEZ KRETZ Gym Dem '22, '25, Hi-Scholarship Club '22, '23, Hi Pepper Club '21, Pep Squad '24, Fun Frolic '23, Komedy Koncert ,235 Girls' Public Speaking Club '22, '23, Forest Literary Dramatic '24, Principal's General Staff '24, Scholarship Assemblies, Poets' Corner, Forester Staff '25. PIERRE GORDON Principal's General Staff. ALACIA MANN Girl Reserves '21, '25, Vice-President '25, Secre- tary '22, Tau Delta Epsilon, Secretary '23, Girls' Public Speaking Club '22, Komedy Koncert '23, El Circulo Espanol '24, Commercial Club '23, Fun Frolic 722, '23, Principal's General Staff '22, Gym Dem '22, '23, Annual Stal? '25, Poets' Corner '22, Crestha Club '25, Symposium Club 724. MAX RUDBERG Standard Debating Society, Crack Company '22, El Circulo Espanol '24, Principal's General Stall, Scholarship Assemblies. FAYE DUKE Girl Reserves, Principal's General Staff. BUER LOVE Principal's General Staff, Glee Club, Pep Squad. THETIS LEMMON Hi-Scholarship Club, Scholarship Assemblies, Annual Staff '24, '25, Forester Staff '23, '24, "A Christmas Carol" '23, Forest Literary Dram- atic, Forhi Art Society, Secretary '24, Principa1's General Staff. HERBERT BERKMAN Commercial Club, Crack Company '22, Princi- pal's General Stall, Standard Debating Society, Demosthenes Debating Society, Radio Club, El Circulo Espanol, Hi Pepper Club, Advertising Manager, Forester '25. EI El Page Tlzzrly fi U4 , j ALMA LEE HAUSE Girl Reserves, Principal's General StaH, Girls' Public Speaking Club, Scholarship Assemblies, Gym Dem '21, ,223 El Circulo Espanol, Hi Pep- per Club '21, Pep Squad '24, ALEX FISCHBACK Principal's General Staff. IDALIA STEERE. Girl Reserves, Hi-Scholarship Club '23, Princi- pa1's General Staff. WILLIAM PIERCE Standard Debating Society, Vice-President, Secre- retary, Treasurer, Demosthenes Debating Society, President, Secretary, Treasurer, Latin Play ,22- '24,, Principal's General Staf, President, Sopho- more Class ,22. MATTIE WEAVER Poet's Corner, Principal's General Staf '22-'24, Girl Reserves, Le Cercle Chantecler, Gym Dem ,22, '23, Commercial Club '23, "Le Petit Paris" ' '21, Pep Squad '24, Fun Frolic ,2I, ,22. THOMAS SARGEANT Hi-Y Club '22, Hi Pepper Club '21, Annual Staff ,253 Principa1's General Staff '23-'25, De- mosthenes Debating Society '22, Pep Squad '22, El Circulo Espanol ,245 Tennis Club ,24, '25, Track Team '25. ALICE STEINBERG Girl Reserves, Girls' Public Speaking Club, Principal's General Staff. BYRON MCDONALD Forest Rifle Team, Crack Company ,22, '23, Principalls General Staff. BESSIE WALDO Principal's General Staff. ROBERT WEBSTER Crack Company '20-'22, Forest Rod and Gun Club, Camp Dallas '24, Principal's General Staff. Q i p pvpbi 1 p J, p 1 D Page Tlzmfy -.vix U U JAMES LEE Principal's General Staff, Glee Club, Standard Debating Society, Hi-Y Club, Annual Staff ,25. RUTH REYNOLDS Poets' Corner, Principal's General Staff '23-'25, El Circulo Espanol '24, Annual Staff '25, For- est Literary Dramatic '24, '25, Pep Squad '23, ,245 Gym Dem '22, '23. NEEL WARFIELD Editor-in-Chief of Annual '25, Annual Staff '24, Standard Debating Society, Secretary '25, Treas- urer 7243 Round Table '21, Demosthenes De- bating Society '22, '23, Scholarship Assemblies ,22, '23, Principal's General Staff, Winner, An' nuul Essay Contest '24, Secretary and Treasurer, IVB Class. DOLLIE 'WESTBAY Principal's General Staff '23, '24, Poets' Corner '21, Girl Reserves '22, Cercle Anatole France '22, Le Cercle Chantecler '23. ERWIN KINNE Camp Dallas '21, '22, Radio Club, Principal's General Staff, Ili Pepper Club. JAMES MCKEE Principal's General Stall. VIRGINIA PEARCE Girl Reserves, Principal's General Stalf. CHARLES WALDMAN Standard Debating Society, President '24, Vice- President '24, Treasurer '23, Secretary '25, Dec- lamation '23, '24, Crack Company '22, Camp Dallas ,243 Vice-President june '25 Class, Bas- ketball Team '24, '25, ISC Lieutenant, R. O. T. C., Forester Staff '23. DOROTHY BURRUSS Girl Reserves, Principal's General Staff, Gym Dem '22, '23, HENRY ADAMS Principal's General Staff, Scholarship Assemblies, Editor, June '25 Senior Publication. , U It be I . Cl Page Thirty efoen U1 QU CHARLES NEISLAR Crack Company '23, Camp Dallas ,243 Princi- pal's General Staff, Annual Staff '25, Forester Staff '25, 2nd Lieutenant, R. O. T. C. BEATRICE MYERS Girls' Public Speaking Club, Girl Reserves, Prin- cipal's General Stalf. EMIL KILGUS Principal's General Staff, 2nd Lieutenant, R. O. T. C. THELMA HARRIS Principal's General Stat? '22-'24, Gym Dem '22, '23. NATHAN DONSKY Principal's General Staff, Scholarship Assemblies. JACK WERTHEIMER Golf Club, Principa1's General Staff, Camp Dal- las '24. EFFIE NICHOLS Gym Dem 'zo-'24, Girl Reserves '225 Hi Pepper Club '21, Pep Squad, Girl Scouts. HUGH MOORE Principal's General Staff, Demosthenes Debating Society, Golf Club '24, Radio Club '22, Senior Play, Football Team '24. EVELYN GAINES Annual Staff ,255 Principal's General Staff '22, '23, Forest Literary Dramatic, Vice-President, Scholarship Assemblies, Gym Dem '11, '22, Pep Squad '22, ,235 Girl Reserves ,2I. RICHARD WILKINS Triple C Club, Secretary-Treasurer '21, Hi-Y Club '22-'25, Major, R. O. T. C. ,255 Military Vaude- ville '22, '23, Crack Company '20-'22, Wozen- craft Drill '24, '25, C. M. T. C. '23, '24.. K+' I x 7 H, Ai U V . .2 .... -Qs -LZCLQL G, Le l D Page Thzrty-eight U 1 1 . . , . 7.2.1 if 5 az' WLT 5555: if DAVE JOHNSON Principalls General Staff LEVY WAKEFIELD Principal's General Staff '22, '23, Hl-SCl1IllHI'SlllP Club '23. ANNIE O'LEARY Commercial Club '24, FLORENCE KELLY Crestha Club, Symposium Club, Les Beaux Arts, El Circulo Espanol. BANCROFT BIGGS Ist Lieutenant, R. O. T. C., All-City Rifle Team, School Rifle Team, Football Team 324. LOUISE MQADOO El Circulo Espanol, Girl Reserves, Principal's General Staff, Gym Dem 721, ,225 Pep Squad. W. A. Biccs l 2nd Lieutenant, R. O. T. C., Hi-Y Club '22-'243 LLOYD HAMPTON Demosthenes Debating Society ,ZIQ Principal's Hi-Y Club 1253 Principalys General Staff- General Staffg Crack Gcgrxpany '22, C. M. T. C. ALYNE PORTER BERNICE MCCARTY Pep Squad '22, Auditores Caesaris ,223 Tau Delta Tau Delta Epsilon, Girls' Public Speaking Club, Epsilon '23, Girl Reserves ,213 Hi Pepper Club Girl Reserves, Principal's General Stuff. ,2I, ' 1 l I 1 D - 1 D Page Thirty-nine U E El? S . S E ,F ga.-...,... y.....2..-...., .nun , ,, ,W M... .,, .,.... ,...s. ..m... v-A -SYM la ,-.s 1 s I 53 if 53 1 2 l 53, S2 sf ,E i in 'e il: ii li is E55 E2 ii is 2? fi SE Ei 91 li 3, S 1 fl fi 2 2 is ii Pl l if is 5 1 A 2 i 1: l H 1 TRAVIS CRABB Principalls General Staff, Basketball Team '25, Baseball Team 325. RUTH TINSLEY Hi Pepper Club, El Circulo Espanol, Principal's General Stalf, Forhi Art Club. RENA PENDLEY Principalls General Stalf. HALLIE RANDALL Girl Reserves 721, '22, Hi-Scholarship Club '23, ,24, Principalls General Staff, Poets' Corner, Gym Dem ,233 Annual Staff l25. EDWIN BUTTERS Camp Dallas, Radio Club, Forhi Art Club, Hi- Y Club, Principalls General Staff. CELIA SPARKS Girl Reserves, Forest Literary Dramatic. GERALD MCNABB Business Manager of Annual '25, Forester Staff 724, ,255 Standard Debating Society '23, '24, Golf Club, Secretary '24, '25, El Circulo Espanol '24, Camp Dallas 7223 Crack Company lzg, Princi- palls General Staff, Scholarship Assemblies, Fun Frolic l23, Pep Squad '24, Hi Pepper Club ,213 President, june '25 Class: DOROTHY MAE HART Gym Dem ,2I, ,225 Girl Reserves, Forest Lit- erary Dramatic, Secretary '23, ,245 Girls' Public Speaking Club, Principal's General Staff, Poets, Corner. GEORGE CURTIS Crack Company ,22, '23, Principalls General Staff. DIMPLE GOODMAN El Circulo Espanol, Principalls General Staff 323, ,245 Gym Dem ,22-,243 Scholarship Assemblies, Hi Pepper Club l2l. I: . ,I . Page Forty U, JE' l JOSEPH TAYLOR Hi-Y Club '23, '24, Camp Dallas '24, Crack Company '23, '24. RONALD ROORBACK Camp Dallas, Hi-Y Club, Band. ILA MAYE HUMPHREYS Principal's General Staff. WALTER SMITH Hi-Y Club, Hi-Scholarship Club, Principal's Gen- eral Staff, Track Team '25. DEE BURCH Crack Company, Hi Pepper Club, PrincipaI's Gen- eral Staff. FRANK ESTES President, Freshman Class '21, Sophomore Class '22, Junior Class '23, Captain, R. O. T. C., Camp Dallas '23, '24, Crack Company '22-'24, Wozena craft Drill '24, Rifle Team '24, Hi-Scholarship Club, President '23, Treasurer '24, Scholarship Assemblies, Principal's General Staff, "A Crist- mas Carol" '23, URoman Banquet" ,243 Annual Staff '24, '25, Forester Staff '23. G. L. FELKNER Oak Cliff Hi Public Speaking Club, Forest Hi Band '23-25. ERLLNE THOMPSON Gym Dem '21, Girl Reserves '22, '23, French Club 721, Le Cercle Chantecler '23, Poets' Cor- ner '22, Fun Frolic '21, '22, Principal's General Staff '22, Commercial Club '24, Pep Squad '23. HENRY ADLER Orchestra, Hi-Y Club, Art Club, Principal's Gen- eral Staff. EDWARD HICKS Major, R. O. T. C., Crack Company '21, '22, Camp Dallas '22, '24, Sth Corps Area Riile Team, C. M. T. C. '24, National Matches, Camp Perry, Ohio '24, Captain, Forest Rifle Team ,253 All City Rifle Team '25, Congres- sional Medal for Rifle Marksmanship. Page Forty one EI U r 1 1 5 . L E Wh0'5 W710 in . merica in 1935 Frank Autry is American Minister to Spain. Alma Lee Hause--Head of a research party to Egypt to collect antiques for the wonderful museum and home of Frank Daudelin and Alacia Mann, who have been married two years. Mae Hoffman-Teacher of geometry in the Sleepy Valley High School of Texas. Ila Maye Humphreys-Taking subscriptions for the magazine called Parking Aeroplaner, a very interesting magazine edited by James McGrath of New Orleans, Louisiana. Lula King Hussey-Devoting her life to the cause of penniless, brainless flappers and jelly-beans. Wuanita Johnsen-Prima Donna of the Chicago Grand Opera Company, who has been acclaimed Galli Curci's successor. Mary Louise Jackson-Secretary to Max Rudberg, president of the Radium Golf Ball factory of New York state. V Florence Kelly-Butterfly chaser, is collecting many interesting specimens. Ronald Roorback+A chemistry teacher of Dallas. ' Oliver Rayner-One of Dallas, many traffic cops, stationed at the corner of Pacific and Masten streets. g Thetis Lemmon-Matron in a home for disabled cats and wayward kittens. Floyd Pratt-Head of the F. Pratt Follies of Atlanta, Georgia. Catherine Lively-Gymnasium instructor in the Ward-Belmont school for girls, Nashville, Tennessee. Louise McAdoo, Bernice McCarty, Mattie Mae Madden, Lucille Markham, Katherine Mimms, and Elizabeth Monc1'ief are dancing their lives away in the St. Dennis Danc- ing School. Ruby Allumbaugh-Lancaster's chief librarian. James Lee-Has retired from the screen, and is residing in Beverly Hills, California. His biggest hit was "Custard Pies." MelbafPalmer-Is happily married to Robert Webster, the latter having succeded as a hot tamale merchant. Walter Smith and William Singleton--Owners of the Smith-Singleton Undertaking Com- pany of Dallas. Abe Schackman-Owner of the A. Schackman Lumber and Loan Company of Mexia, Texas. Elizabeth Potts-Instructor of trigonometry in the University of Hung'Chou, China. Hallie Randall, Lucille Reid, Ruth Reynolds, and Vida Rhodes-Bathing girls in the Edwin Butters' Travelling Show. Irvin Beren-President of the I. Beren Undertaker's Shop. Clairene Rogers-Teacher of piano in the Sullinsl School for girls of Bristol, Virginia. Rose Rothschild-The best known game hunter in the United States. At the prsent time she is hunting mosquitoes in Africa. Jesse Bodiford, Travis Crabb, George Curtis, Richard Dathe, ani lvon Dobson are mem- bers of the Walter Ewell Famous Minstrels. Florence Ryane-Is the beloved tango dancer of the Ritz. Robert Burns-President of the United States. In his cabinet we find G. L. Felkner and Alex Fischback. Ethel Shinder-Head of a cosmetic factory. Harold Dean-Marble Champion to represent America in the Olympic games. Neel Warfield is Neel I, the powerful king of Bolonsy. Howard Anderson-Stenographer for the Henry Adams and Dee Burch Oil Association. Dorris Apple-Choir leader of the Rural Shade Endeavor Society. Buer Love, Longwortb Lundell, Byron McDonald, and James McGrath-The Board of directors of the Square Theatre, owned by Hugh Moore, the opulent capitalist. Bertha Bethurum-Is takng the line of least resistance with her fifth husband, Gilbert Carter. Gerald McNabb-A model of Strangfortism. Page Forty-two l LD P.: , I 1 d VVHO'S WHO IN 1935-Continued Algene Bale-National Field Secretary, Y. VV. C. A. Charles Neislar is a brick layer, residing in Colorado City, Texas. Evelyn Oppenheimer is now one of Americals foremost dramatists. Her tragedy, "The Dark Nun," is attracting much attention from the censors. Bessie Goebel-Spanish instructor in the University of Texas. Charlie Waldman-Has recently hung out the sign of the three balls. Joseph Taylor-Beloved principal of Forest Avenue High School. Erline Thompson-President of the Enemies of Men Club of Peoria, Illinois, of which the following old Forest students are members: Lillian Green, julia Haas, Thelma Harris, Dorothy Mae Hart, and Marguerite Harrison. Arthur Sullivan-President of the Kansas City Real Estate Board. Etta Bell Murdock-Contributor to the True Story Magazine. Henry Adler and W. A. Biggs-Joint owners of a sanitarium for demented people. Among their many competent nurses are Marion Murdock, Effie Nichols, Evelyn Norman, and Annie OlLeary. Fred Starr-Weather interpreter of the city of Tulsa, Oklahoma. Chad Stark-Owner of the Starks Floral Company of Washington, D. C. Margaret Sullivan and Alice Steinberg are well known women pugilists. Fred Haas-Instructor in civics in the University of Michigan. Beatrice Myers-Usher at the Palace Theater. Lloyd Hampton and Ed Hicks-Acrobats in the world famous H. Berkman and A. Black Circus. John Hoffman-Is taking life easy on a ranch in Arizona. Ed Hackaby is Mr. Hoffman's efficient supervisor. Ruth Tinsley-Believes what a fortune teller told her, that she would meet her lover in Winslow, Arkansas. She has been waiting ten years, and has decided that perhaps she misunderstood the fortune teller. Minnie Dee Turner-Is successfully playing "hotU lead in Margaret Vineyard's famous play, "Gas Stoves." Erwin Kinne-World famous toilet article manufacturer of Mobile, Alabama. Bessie Waldo-Is happily living in Spain with her husband, the American consul to Madrid, Frank Autry. Kenneth Lagow-Chief Cook at the Adolphus, specialty, "Apple-sauce." Marie Kynerd-Since being disappointed in love, has taken the veil in Naples, Italy,-and that's not all. Louise Wesch-Aesthetic dancing instructor in the Dollic Westbay School of Dancing of Dallas, Texas. Elizabeth Williams-Has sailed to Hawaii to make a picture with John Cooper Moving Picture Corporation. Sadie Mae Wrightsman-Has sailed to Italy to open her villa for the summer. Gladys Short, Eloise Sisk, Bertle Skaggs, and Katherine Slzzyton are all mannekins of Oliver Brecht's Elite Women's Shop of Fifth Avenue, New York. Otis Dozier-Is a prominent toreador in Mexico. Pierre Fontaine and Richard Wilkins-Instructors in military training in the Castle Heights Military School. Elsie Stegman-Saleslady in the Nathan Donsky Hosiery Shop. Pierre Gordon-The owner of a Ford Agency in Brownwood, Texas. Stanley VVilkes--Is the superintendent of Dallas Public Schools. Neatie Birdwell-Is successfully established with Pete Pate's Syncopated Steppers. Jack Wertheimer-Owner of the Menls Clothing Store, Houston, Texas. Dorothy Brown-Has retired on the income which she gets from her establishment, the home for Dumb Animals. Ernest Wilkes, Ben Wathen, Levy Wakefield, and Elmer Wagner are American Counsuls tc Boloney where they are in high favor with their old friend Neel I. re in Page Fa fly-lhree ,I 1 , , .I , WHO'S VVHO IN IQ351C07Zff7Z1l6d Kathleen Freeland-'Organizer and leader of the famous "Say it With a Ukelele Clubf, Frank Estes-Is still a freshman at the U Know It All University of Grand Prairie. Inez Kretz-Most popular member of the Old Ladies' Home. l l . Willie Mabel Taylor-Famous inventor of Non-smearablc, Kiss-proof Lipstick. Clara Goldberg-Has Written a book on 'Allow I Maintain My Golden Silencef' Jeanette Spencer-Is the model for Otis Dozierls latest picture "The Nymph." ldalia Steere-Is teaching Chemistry in Oak Cliff High School. Alice Steinberg-Is an elevator girl at the McNabb Hotel. Katherine Stephenson-Is ticket-seller at the Lyric Theatre. Edith Goad-Is now President of the Goad Sanitary Goat Milk Farm. ' Floyd Pratt and Richard Dathe are putting onan' exhibition, getting acquainted with the Am- erican "F1apper" in record breaking time. Vida Rhodes-Is proprietor of the New Magnolia Barber Shop for ladies. Some of her - popular barbers and manicurists are Ruth Steere, Mattie Mae Madden, Lucile Reed, and Mary Louise jackson. ' Edgar iHuckaby--Is a wealthy bachelor residing in the Bachelor Apartment in Chicago, with three other wealthy bachelors, namely Alex Fischback, Thomas Sargeant, and Paul Jeffers. Ivon Dobson-Is now a typical sailor and is scrubbing decks with Longworth Lundell and Rex Pyron. P Dorothy Mae Hart-Editing a well known paper in St. Louis stating the low-down on Movie Stars. Her able reporters are Lucille Markham, Elna Riddell, and Edwin Butters. Evelyn Gaines-just married to her fourth husband who is Oliver Brecht, the other three, who met with a catastrophe were Bancroft Biggs, Frank Daudelin, and Frank Stephen- son. It is rumored that she has acquired a large fortune from insurance. Bernice McCarty, Margaret Vineyard, Faye Temple, and Thelma Harris are old maids who have been disappointed in love and are living together to Comfort one another in their old age. Robert Webster-Disappointed in his first love in High School days has not yet chosen a wife but it is rumored that he has renewed his acquaintance with Miss Bessie Goebel. Cecelia Sparks-Has just received quite a fortune from her popular novel, "The Art of Mod- ern Love Making." b Otis Dozier-A scientist of fame has just reported, that on his recent expedition in Egypt collecting insects, he ran across Inez Kretz and Daphne Rutherford dancing in the Emil Kilgus Temple. Ada Brown-Owner of a beautiful floral shop in Los Angeles, California. Walter Ewell-Acting as model for Marx Schafneriv Men's Clothing. Pauline Goldbaum-Owner of a pawn shop with Selma Goldsmith, Lillian Green, and Na- than Donsky, where they are auctioning off many valuable gifts. Dave johnson-Is running a beauty parlor where she makes a specialty of her new method of arching eye-brows. Ruby Ware-Star in Mack Sennett Comedies playing opposite Daniel Rosenbaum. Dolly Westbay-Now Mrs. Richard Wilkins is happily married and sharing an apartment with Victor SauHey and his recent bride, Julia Haas. Gilbert Carter-Head of the American Federation of Fly Catchers. Travis Crabb-Teaching the Pigmies in South Africa the art of making love. His learned assistants are Effie Nechols, Virginia Pearce, and Byron McDonald. Mattie Weaver-Head of the "pep squad" at Urusline Academy. Some of the well known squad are Alyne Porter, Rena Pendley, jacquelyn jones, and Florence Kelley. James McGrath and James McKee arc clowns in a well known circus, owned by Henry Adams and Dee Burch. William Pierce-Is now shining shoes in a well known shining parlor of our own city to the tune of a phonograph. He is quite an expert. Gerald McNabb and Neel Warneld are confirmed polygamists and are living happily in Turkey. - Page Forty-four ml l U El 5 U NORMA HARR1s RALPH DARNALL 1 J. P. KIRKPATRICK Vice-Tfemimz Tfesidgfa Swfrafy and Treasuffr History Class of January '26 OWARD the first of February, 1922, a group of frightened and much dazzled freshmen entered the wide corridors of Forest Avenue High School. After the few weeks required to get their balance, they organized with the lA's and elected the following ollicers: president, Frank Estes, vice-president, Henry Adams, secretary-treasurer, Clara Goldberg, and sponsor, Miss Swindells. The following fall, as lAls, it wasrtheir turn to unite with the "Hsh,l' and the two classes elected the fol- lowing ollicers: president, Annie Bradshaw, vice-president, Linda King, secretary, Vaughnetta Stapleton, treasurer, Claire Baum, sergeant-at-arms, Mortimer Goldstein and sponsor, Mrs. T. W. Dial. Thus, having completed the first round of their journey, by spring, IQ23, they were ready for their sophomore year. A wiser class of wise fools have never been seen. With the llAls they elected the following officers: president, Frank Estesg vice-president, Bernice lVIcCartyg secretary, Clara Goldberg, treasurer, Bertle Skaggs, sergeant-at-arms, Lawn Rees, and sponsors Mr. Rosser and Miss McClellan. The following spring they enrolled, considerably depleted in numbers, but with even greater enthusiasm, since they were now juniors. Many of the members had D l as LD Page Forty-fi 'UE D af 2 1 if I r lx 1, I 1 4 1 I 1 l r i NIISS EDNA ROWE Q 1 dropped out to continue their education in the business world. Some had forged i ahead, and the June ,25 class became the richer for the lIlB,s loss. And some, it must be admitted, had found sophomore life hard to leave, and so became members of the June '26 class. For these reasons, and also because they were a mid-term class, they did not organize as lllB's. That they were still loyal class supporters was shown by the fact that in the fall of 324, as IIlA's, they rallied and organized as one of the most enthuiastic classes in the school. Their ollicers were: president, Ralph Darnallg vice-president, Nlilton Kinneg secretary-treasurer, Joe Cormang reporter, Norma Har- ris, and critic and sponsor, Miss Rowe. W - And now, at last they have entered upon the fourth and last round of the jour- 1 l ney, and the goal is in sight. They are seniors and have performed their fourth year , W work with characteristic activity. Their ofhcers are: president, Ralph Darnall, Vice- ! :N president, Norma Harris, secretary-treasurer, P. Kirkpatrick, parliamentarian, Ben ,l Barzuneg sergeant-at-arms, A. M. Sanders, and reporter, VVilson Stricklin. ' ,N With Miss Rowe as critic and sponsor, the class is destined to spend its happiest and most successful year, at the end of which it Will bid Forest goodbye with real ,Q regret. l ' l La gi f if it J- Llff- f---W, i ""f"'f"" jig Page Forty-six RALPH DARNALL I 7 Hi-Y Club, President 245 Track Team I24, 255 President, January '26 Classg Hi-Scholarship Clubi lst Prize in City Home Lighting Contestg Popu- larity Contest ,255 Scholarship Assemblies5 For- ester Stalf ,243 Annual Staff ,255 Principal's Gen- eral Staif. MARIE MAXWELL Principal's General Staffg Gym Demi Pep Squadg Girl Reserves. MILTON KINNE Color-Sergeant, R. O. T. C.g Crack Company ,235 Vice-Pres. January '26 Class. MABEL FRIZZELL Principalls General Staffg Gym Dem ,ZI, ,223 Scholarship Asscmbliesg Girl Reserves '2l. JAMES ROOTS Tennis 'lcam ,24, ,259 Principal's General Stuffg Hi-Y Club. I GRACE WILLIAMS Girl Reservesg Volley Ball Teamg Girl Scoutsg Principal's General Statfg Girl's Public Speaking Club. CARLO MESSINA Ist Lieutenant, R. O. T. C.5 Standard Debating Societyg Camp Dallas ,245 C. M. T. C. 'z4g Football Team '243 Principal's General Staffg Track Team '25, HELEN CLIFFORD ' Girl Reservesg Girl Scoutsg Tau Delta Epsilong Principal's General Staff. MARCUS MCLEAN Ist Lieutenant R. O. T. C.g Crack Company '22, ,245 Forest Rifle Teamg Camp Dallas ,245 Prin- cipal's General Stalfg Auditores Caesarisg Hi-Y Club. ELIZABETH SIEBENHAUSEN Principal's General Staffg Girl Reserves ,2Z. Page Forty :even I-, le 'Tl l , 2 .. ,... ai I5 i l il 5 l l i 1 i ,I l l 1 l 1 l NATHAN HARRIS ELAINE MITCHELL Principal's General Staffg Camp Dallas ,243 Principal's General Staif5 El Circulo Espanol. Crack Company '22, YZ4. EUGENE ALEXANDER OLLIE ADAMS Hi-Y Clubg Demosthenes Debating Societyi Prin- Girl Reservesg Commercial Club5 Hi Pepper cipays General stafh Older Boys, Conference 125I Clubg Principal's General Staff. . R RABURN BURKE F LI NSRMAL HAIIYZITI 1 hl V, . I . , I I orest iterary ramatic- 1- c 0 ars ipg ice- Hi-Y Club ,231 Pisiicllxlis Cgjimml Staff, Scholh Pres. January '26 Classgi Latin Play '23, ,245 MS IP ssem ies' "A Christmas Carol" ,235 Principal's General Staff. JEWEL ALLEN I Auditores Caesaris ,225 Girls' Public Speaking . Club lzz, '23g Girl Reserves 'zgg Principal's Gen- I YANCY LINDSILY 01.31 Staff ,ZZI 125I Hi-Scholarship :23I :ZSI zncl Lieutenant R. O. T. C.g Crack Company ,22, '24,3 Demosthcnes Debating Socictyg Principal's General Staffg Hi-Y Club '25. JOSEPH MALONE Hi-Scholarship Club, Parliamentarian ,245 Prin- cipal's General Staff5 Annual Staff '25g Forester LUCH-LE RUPE Staff '24, 7255 Forhi Art Society ,245 Les BCZIUX Girl Reservesg Iii Pepper Clubg Principal's Gen- Arts Club ,2S, Vice-Pres. '255 HVY Club ,25. eral Spaff. dgjifxxnl l' l . ll , -- - Ld M 2 L is .L ,L El ,C is -2- is -- all Ui Page Fo fly-eight Ula lm 1 1 l 1 , 1 V V 7 Y W 1 W , ' 4 l JOE CORMAN LOIS JEAN MEDLEY Crack Company '24,g Demosthe-nes Debating Girl Reservesg Principal's General Staff5 Hi- Society. Scholarship Clubg Girl Scouts. T DI E 1?fRlfICE,PARgEf , 7 MORRIS COHEN au eta psi on 22, 233 rc estra 21, 243 . . ' Gym Dem ,Zh ,235 Principaps General Staff- Pr1nc1pal's General Staff, Camp Dallas. BENJAMIN BARZUNE NAOMI LUCK Principal's General Stalfg Scholarship Assembliesg El Circulo Espanolg Principal's General Stafg Standard Debating Society 'zgg El Circulo Hi Pepper Clubg Gym Dem. Espanol. PRINCE HALL U ROY SflCH5 I Principaps General 'Staff' El Circulo Espannl5 Pl'1l'lClPZlllS General Staff. OLIVER HOLT LUCILLE TUCKER Radio Club ,225 Crack Company '235 Glee Club Girls' Public Speaking Clubg Girl Reservesg Prin- '24, '253 Hi-Y Club '25. cipalls General Staffg El Circulo Espanol. tn V l C1 l . Page Forly-nine i i , i M" prffifr---:af -H iff- Y , ef- -W-, , , ,, , , ,,, , ,,--,. , . A f--Tim 'S'--Zig, L3 U E..2.,,W,M ..., ..,, - Mn , Zn, ,mf .,,, ,u,,,,,.,NH.m,MAMH-H V G? WW .W y -J -:MY - ..., ,,g-,. ,:,..-,, YYYVY W ,mm Y V V74 Y V Y ET- V Y V :W , F-G lT-....-m,..-,.,,,,,....a.......,.....,,,.,.,...,,,:,,, ,, ,umrggiwiv Y,G,1V4M:? E e V lf E, rg l f lj? - l if N3 V i 'L 'j l l i 1 i i , KATHRYN MCADAMS DOROTHY BROWN El Circulo Espanolg Principal's General Staffg Girl Reservesi Gym Dem, Volley Ball Team ,235 Gym Dem '22, ,243 Scholarship Assemblies. A. M. SANDERS TONIE AMOREI-LA Hi-Y Clubg crack company 222. Principalls General Staffg 2nd Football Team '2 5 4 Y i Tmk 23' KORITA BENSON KITTYE TAYLOR Principalls General Staffg Gym Demg Pep Squadg Girl Reservesg Girl Scouts. i Girl Scoutsg Principalls General Staff. i lx , X MORTON RUBIN P. KIRKPATRICK X l I I . v 1-,rincipavs General Staff ,ZA ,245 E1 Circulo Lrack Company ,235 Pr1ncxpal's General Stall. 3 ' Espanolg Crack Company ,23, ,24,. l li RUTH WEIL in KATHERINE MIMMS l 51 M . ' . Fnrest Literary Dramaticg Tau'D.elta Epsilong 3 M Tau Delta Epsllong Pr1ne1pal's General Staffg Girls Public Speaking Clubg Pr1nc1pal's General i Gym Dem lzz, '23. Stag, l i l i li S . 1,5 3 li! 1 ,, 1 1 il li 3 5 ll EQ i all Lg ..ea , E, rr,,,e it G , it G ii G GA G sm -'-L-ff':::V:,.-2---L 2.--Y ,, , -W ii H Y Y 74 j AQ1 1 W -H QlAi1f'1f"""M"'e"'W"e-W-A "" "!4f""" W f We "frm 'E' 'li'i"W':ff:r i 'WAMW' W- ,ii Page Fifty A ' ,Qi c e 2 renter-:ami M II j I 'I If ' I I I I I I I ' ,I I I I I: , I I I It If I 'I I 5 I Ist I I QI II I 1 M ' II I rl, ' I 1 I I , LOUISE HARDIN EDA ROSENTHAL K French Club 'zxg Fun Frolic '22, '24,g Girl Re- Girl Reservesg French Club5 Poets' Cornerg Le serves '21, '233 Gym Dem '22, '235 Principal's Cercle Chantecler, Vice-Pres. '24g Gym Demg III General Staff I23, '25. Forest Literary Dramatic, Vice-Pres. '25. I , II . 2 I DUDLEY KILLIAN X AMSNUEL BLOOME I N' . . 1 , . I Principal's General Staffg Scholarship Assemblies. Inmlpdls Centra' Sm ' III II II ANNA GOLDSTEIN I I I I WILLIE YOUNGBLOOD Le Cercle Chanteclem Girl Reservesg Forest Lit- 1 I I :I I Gym Dem '21, 'zzg Principa1's General Staffs erary Dramatic, Treasurer '24, President '25g THU Delta Epsilons El Circulo ESPHH013 Hi Pep- Principal's General Staffg t'Le Petit Paris"g per Clubg Pep Squad '24. Poets' Corner5 Gym Dem '21, '22g Komedy Kon- I cert ,22. H E I I! I1 Li I DIMON vRA'r1s , I 5 II Princi al's General Staff SIDNEY ABRAMSON I ' P I ' Principal's General Staffg Crack Company 'zzg Camp Dallas '24g Pep Squad. I I I' IRENE LEWIS II President Freshman Class 'zzg PrIncipal's Gen- - MILDREDIMFVVELLIAMS " eral Staff' Girl Reservesg Principals General Staff. N ix I II I 2 II W ' E i I I : I II II Y 3 , I is I 25 I' EI II IE II I I Ii I I' I' I- I I Y I I I 5 U ,I I E I I 5 7 " 'i ' 'gw , 2 'W , jfQ'f7I.'fl77,,'1l,".L'?L.I Page Fifty-one Lf: mm-.. .,v, ff- , ig- e AW, ,,,, ,,, ,,,,,,,,,.,,,,,:,:..i,.,, , , ,.,::.e..,-L-..e.f, W Y 'ev'-fj":f-'ijifjli gm-1---1-fx... .. --W -A we ...,,...,,mM ,,k, ,,,i,,,,,,,,,31,1v ,,,V- Q ...rt-get-.... .,..,Y ,:. ..T:::-::--'--v-'--f-f--+M--ff""f'---- Q if 45 52 ii ss fi sq i S " il tg 5 is . i i ' i! l 1 l ' l xi i ll ii .T . N! l WILSON STRICKLIN LENA BLOUNT Crack Company ,243 Principal's General Stalf. Girl Reservesg Girl Scouts5 Spanish Clubg Vol- ley Ball Team. SULTANIA COOK SYLVIA BORKON P"iUCiP31,S General Stag- Girl Reservesg Girls' Public Speaking Clubg Le Cercle Chanteclerg Gym Dem '233 P1'incipal's JOE LERER General Staffg El Circulo Espanol. Standard Debating Society, Treasurer ,255 Audi- HENRY WREN tores Caesarisg Demosthenes Debating Society. wrhe Vvords of Wise Mlm are Heard In Quictnessf' Y 1 LUCILE BRALY 1 Crestha Club ,24, ,255 Symposium Club '24, '255 MINETTE KIMMELL THU Delta Epsilon 122, 1235 Crestha Capers ,245 Forest Literary Dramatic5 Principal's General l Hascholmship Club 1225 Girl Reserves 1223 Staifg Girl Rcservesg Hi-Scholarship Club. ' Principalls General Staffg "The Fates Decreefl MARTHA DICKARD i l Gym Dem ,2I, 'zzg Principal's Gem-ral Staff ,243 i ' CORLOS KRUEGEL Principal's General Staffg Glee Club. Wi' 1' l l i 1 i it iz, N r. H it ii Egii if la A. Ii i, i Roman-American Wedding ,223 Ili Pepper Club ,213 Pep Squad ,24. r--e .Y ,-Q ..,., N., T, ,J :wwf VP v xg y I E ,C ,Li C 53 l t C Page Fifty-two .-.--,..,Mr.fr-.W Z..-..-.,--.,.:.::,::G. .,,, ,,..:,,-,,.n::...i------- V- - -44,41 Us I- To the graduate Youive got your sheep-sk'n clutched in your hand and your trunks are packed to go- Your bills are paid and your way is clear-it is over at last, you know, And you think of the hard, hard grind it was, and the thoughts come back to you Of the four long years that are finished now, and you say you are glad you are through. There was many a thing in those four long year that you did not like at all- Many a rule that irked your soul, petty and mean and small, And you say to yourself, "Thank God, I'm through-through with the endless grind, Away from stricture and 'straint at last, and leaving it all behind.l,' lt's all right, here in the heat and dust of a room you are ready to leave- And you think to yourself you can quit it all, with never a thought to grieve, But wait till they're calling, UAH aboardlv and the engine's whistles blow- And you're really leaving it all, old man--youlll Hnd it is hard to go! And it's plaguey hard to keep fighting back the choke that your throat endures, When the thoughts well up of all the years have meant in this life of yours- Of the friends that are scattering far and wide-of ways that may never meet, When the pathways stretch to the press of years to be travelled by weary feet. "It's life outside," you say to yourself, "and this is but school-boy play!" But a tear wells up with the crowding thoughts of all that you leave today- It's nothing to be ashamed of, lad--you'll know with the passing years That the further you grow away from school, the prouder you are of tears. For there's many a time in the years ahead, when everythingls breaking wrong, That youlll think of the vanished high-school days as one grand stream of songg lt's life-outside-all right, old man, but life is frequently pain, And there's many a time in the years to come you will wish you were back again! I D V so e, t ...,l.E1 Page F i fly-three El J Ur p I Jan '26 Class iprophecy December I8, IQ4O. Dear Diary: Truly this has been a pleasant day as I expected it would be when I ac- cepted Lucile's invitation to spend Christmas vacation with her in Dallas. Lucile Braly and Willard Morrison were married several years ago, and Willard is coaching the Forest High football team. jim Collins, now a Dallas business man, took dinner with Willard, and among the other things, we talked over our old class of Forest High, so I shall tell you what has become of us. Dudley Killian is a great lecturer, and he and his wife, Eda Rosenthal, are traveling over the country. Toney Amorella is chief waiter at the Ritz- Carlton Hotel, while Carlo Messina peddles kiss-proof lip stick in New York. Korita Benson and Leslie Jones are great and powerful evangelists. Sylvia Borkon and Manual Bloom are in the cafeteria business in Chicago. Ralph Darnall is a great polo player in Wales, and Thad White has retired from the ring and is living with his third wife, Naomi Luck. One of the best tailor shops in Paris is now run by Dimon Vratis, who has for his model Roy Corpier. Herbert Corwin is an acrobat in a travelling show, and Olvin Birdwell is a human fly. James Roots is playing tennis in Arkansas. Some of our talented class-mates who have risen to fame are Joseph Malone, noted for his last picture "Cinderella's Prayer," and Howard Miller, Chief Justice of the Supreme Court. Raymond Elfenbeim is an artist, and P. Kirkpatrick, Raeburn Burke, Zeno johnson, Lois Jean Medley, Lucille Tucker, and Prince Hall are mem- bers of the "Famous Comedians."' Marcus McLean, because of his ability in argument, has risen from the ranks to be a well-known lawyer. Eugene Alexander is selling "No-to-kink" hair tonic, and Ben Barzune is agent for a Chicago Safety Pin Company. The latest hobby, women aviators, has captured Katherine McAdams and Kittye Taylor. "Baby" Frizzell is a politician in Washington, D. C. VVillie Youngblood has journeyed to Africa in quest of heathens with the zealous missionary, Myrl Robinson. At the court of the Spanish king is Louise Hardin, the dancer. Ruth Weil may be seen with Zieg- feldls beauties, and the character impcrsonators, Marie Maxwell and Elizabeth Siebenhausen, have stormed the movie world. Mildred McWilliams has re- cently sung her Way to fame via the Chicago Grand Opera, and Joe Lererls composition. Of great renown is the typewriter speed king, John Peeler. ml L it I Page Fifty-four V U' 'U Milton Kinne, the practical, is a cotton broker in New Orleans. The civilized world is supporting the vast reform movements in China, led by Wilson Stricklin. Those of the class who have remained nearer home have become useful citizens. Melba Whidden is a taxi driver between Dallas and Ft. Worth, and Grace VVilliams is a traffic cop at the corner of Elm and Harwood Streets. Morton Rubin runs a day nursery for children, and Irene Lewis holds the responsible position of matron at Buckner Orphans' Home. Ollie Adams has fulfilled her promise and has become a professor of mathematics at S. M. U. Sul- tania Cook is a news hound for the Dallas Journal. Sidney Abramson and Roy Sachs are pawnbrokers on Deep Elm, and Sam Segal runs the Clean Clothes Laundry. Joe Cormon and Natan Harris are working in the Ford Company. The Dallas Country Club employs Bert Hatzenbuehler as golf instructor. Kress's Five and Ten Cent Store is flourishing under the capable management of Oliver Holt. The first prize of the last Texas State Fair went to G. W. Cawdell, the famous fat man. Yancey Lindsey is a sour old bachelor, having been disap- pointed in love. Lucille Rupe moved to Fort Worth, and has been elected president of the Famous Bachelor Ladies' Club. The Dallas philanthropist, Morris Cohen, is at present working on a book that he hopes to publish next year. Now, you see, dear Diary, that the class of January '26 has made its mark in this old world. Write to me soon and give me all the newsy news you know. Very cordially yours, JEWELL ALLEN. Q Y 5 ! . A 32' mi. L - 1 u Page Fifty-five Page Fffly-six CLASS IUNIOR FW J U 1 l Junior Class When this class enrolled as Freshmen in the strange place called Forest Avenue High School, it might easily have been compared to a bevy of little frightened birds. However, the fiuttering ceased, day by day, until finally we organized, electing these oiiicers: Dorothy Kelly, president, Mary Perkins, vice- presidentg Jenny Bock, secretary, L. E. Engle, treasurer, Byron Sachs, sergeant- at-armsg Gladys Mary Robertson, reporter, Mrs. Tura W. Dial, sponsor. Soon the faculty and student body realized we were a class of high schol- arship pupils, singers, musicians, and public speakers. No longer were we classed as Freshmen, but wise and welcome Sophomores. In 1923, our officers were: Annie Bradshaw, president, Linda King, vice-president, Vaughnetta Sta- pleton, secretary, Claire Baum, treasurer, Mortimer Goldstein, sergeant-at-arms, Miss Louise Wilcox, sponsor. Linda King was elected class historian for the 1923 Annual. Two boys and two girls were selected for the pep squad. Now, that we are Juniors, we have a record to be proud of. Many of the various school contests have been won, and are still won, by our group. The officers elected during the fall term of IQ24. were: Annie Bradshaw, president, Elaine Mitchell, vice-president, lVIary Perkins, secretary, Gladys Mary Rob- ertson, reporter, Hugh McDaniel, sergeant-at-arms, Mr. I. C. Roric, sponsor. Our sincerest Wish is to leave this school a little better because our class has been in it. .L ' C1 Page Fifly-:even i F Sophomore Class V orrroms FOR 'JANUARY ug AND JUNEKUS --'Tresrdqnge --' - Dorothy Rinehart ' . Vice-Tresident, - Kathleen Carter N .Segretarym - - Marie Morrisev so fRkefo'rtefr".u -j 'QE,10i5e Ati-ferr A Spvmb? o - Mrs. 'r.sw. Dial The So homore Class of this ear is a ver lar e one, and its man mem- P ' ' y lg gllh l f 'h Y cl bers are very actxve rn all phases of school 11 e. e Qc ass' urnxs es a .goo quota for every contest held, and usuallyits entrants Win awards and honorable mention. Due to the lack of business, the Sophomores have had no regular meetingybut there is no lack of class spirit. Look for 'the leaders-they're Sophsl - ' - 1 OFFICERS FOR THE YEAR OF 1923-24. Tresidenl ---------- Fred Poston Vice-'President 1 Catherine Metzger ,V Secretary-Treasurer - Jack Scott- Slrfgeant-al-ufrms - - M. Moncrief -Reporter A - E 1' rl Seymour Margules Historian - - Kathleen Carter Sponsor - Mr. W. H. Butler R Q , J L D :L ' I Page F ifty-eight W V . ,.,,if,qf ,gyi 1 .L.1, - Q CLASS MORE SOPHO A II 'U sr. VW rr. 21 'Nl 53 1 5 3. rn 1 Page Sixty SOPHOMORE CLASS IIB D :U Freshman History Coming to the "Big Woody School," the Freshmen knew at once that there were many trees, and that the Forest could never be passed through with- out knowledge. At once they decided to go through together, and chose as their leader Florence Bates. On through the outskirts of the dense Forest they proceeded cautiously, learning many valuable things. At first, there were a few unnoticeable stumps in their path, which the unobservant stumbled over, but most of the members watched the road care- fully so as to avoid these had places, which occasionally ended in failures. Byi. most of the slight falls, the members became more cautious and really bene- fitted. ln this Forest there were many different kinds of flowers-some were fragrant and beautiful, but there were also some wild flowers. N When these Freshmen of the Forest had passed through one-eighth of this walk, they were compelled to leave some of the members behind to welcome the new newcomers. But now the trees appeared much larger, and they had a few more branches and leaves. At this time on their interesting tour, a great wind came, and in among the many trees they whispered that another troop of eager learners had started to march through the Forest. The pilgrims then asked the able Naomi Hendrix' to lead them. The newcomers soon learned the ways through the large Forest, and there were very few who were as green as the trees along their way. Their observation and wisdom taught them to take ad- vantage of the worthy things offered them. An important part of the space of the Forest path has now been traversed by the Freshmen, but they will never be content until they reach the very goal of their ambitions. Already they are planning big things-how to improve the Forest and how to improve themselves. With all of these big plans and only one-fourth of the way traversed, what may we not expect of them when they leave this great Forest to go out in the big world? Nothing short of the best that has ever been accomplished or attained. U V In Page Sixly-one x aff, 1 M232 f,QQ7'4"9-'Rita' 52. . ,, ' ,gw Wfxy-X ' -,zu , , ,.,..,,,w,qw 3 1 fb ,YE Page Sixty-two RESIIMAN CLASS F 1 A 5 SS FRESIIMAN CLA hu R CN 02 21 R, N Kd . 5 Us 2 .--,....,.........,.,-,,........,.........., .A....,.....,,,,.. VW. .Y,. , ..,,. .4 ...,.,..,,.......M...,.-,...b. .,,.,...n, www ..,, ,...,....,,,. .f,.K..,.,..N ,,...,.. , MW ,..,, ..m......,. .. . ,..W .. ,,, .:..T.1lM. .Fw W ku JIM MM IW K ., ..,,., ...,,... f..,,.:. .1, ....,..--. .,..,..ww..-.-,.. WWW.. ,,,,.-,.,,..m-- ,.....h,..W......L,Q.,,-...,........n ..,. ..,.f,,.....,...,.,.....F.-.,.,w.,w. MM. V ,. ., , ,...,.,.,...u..- ,,..,...,, M., ,, 1- 1 -A L .X ,-3.5.3-...,..u-x .Q :.........,., Q,-wugzwu ,.,.-w. . .q....A,,..f f na.w..1w..-w,.,kw.g,,L,....,mA-..2m..M,...ww.NQ-k.A..,w..Mn,u-,. ...www- L 1 I 4 R 1 1 r M IE LM Z? Qi if Ei I H A li Y is 22 V 5 52 if H Sa. ly 1,11 Y 13 74 W 15: H5 ik : 5: gl 22 fi ff ii 52 ea 53 Z is ig 1 Q9 3? ii E 4' 5 ii if if H 5? Qi fi 4 L .-1.13 if Mm... . Page Sixty-fo ur -1, Q21 u. Qs 54 9 mf ,x ,J ,XG ,ww 'Q i w w s 'I 32 3? an fi Ei if Ei 5 E ji Ei Ei Q ,H H lil 1- 'I N1 1 ug ii' ,. N ,H 5 11 5: it gl Si ZH vf'E fi .Q 1 5 if is if E i 4 5 325 ll I, Ei 'S 5 Q 1 fe Ei lf 22 32 as 5 is fi ii 'Q 24 QE! w , ,. ,,,,.,. .,.,.,,, .f WA., - , -., Ahmf, , A , .,.....m,f..,..,A-.......k.,.MG1w,-mi KX, 4:.f.1gw..V,.,,, .,... .-:Hua 5. S X ' TWA4 V - " u f YL ,cfm A 1, X I ,.,, , 1 . 5 , I W E E xr A .. fx U I Xp f -x X. I A XX u - -7-1.2 - . . 443, W f ' g . , 5-T 1-"' I ' , 'L 2' . X 2 -? 5 ST if S r g' 52' f. 1, 5' if ,Ml V 3' ff ' ,x N' Z ? E T.,-ff Pr tax 1 x yy. S -1 -- - ., - A 1a . , --1 - ,1 , 5? -. X 5 55- 5 - .R . lv X. -12-. , V. .. L x f x .v-.fl .N - 1.3 fi? mf Otis Dozier' J- C'tiVi4iiGS 2 X L S i ii N Nuke I7 G cxNX Qs I Jos '1'rAL,olvE., ss' W ' 3- iii' Y il lil? ills- f V x S- . X 1X - 4 SX , X , N Trincipalha general Sta J? Since its organ'zation in 1923, the Principal's General Staff has been increasing, both in numbers and in enthusiasm. lt has grown from a member- ship of three hundred to the present membership of approximately a thousand. The purpose of this organization, to encourage students to raise their grades and thus to raise the standard of intelligence of the entire school, has most surely been accomplished. This plan has been so successful that lVlr. Parker has had it copyrighted and published in book form. While he was attending the meeting of the National liducational Association, Mr. Parker visited a number of high schools of Ohio and explained the plan, and it was received with interest everywhere. Many schools in and near Dallas are now uniting with us in this plan to increase the standards of scholarship. :Xt the end of each year, Nlr. Arthur .-X. lfverts gives specially designed pins to the members who have increased their averages for four successive times, and also to oflicers of the Staff. After each report, orlicial rosters are made out. The roster for the divi- sion ending ulanuary go, 1925 is as follows: Commanding Officer-Wylie A. Parker, Principal Chief of Stalf+VValton Rhodes Assistant to Chief of Stall-Reaves VVilliains Executive Officer-Dorotliy Kelly fxdjllt1lllfTlVlIlI'g'lll'Cf Brown Assistants to Chief of Staff: G-1 Plans and Training-llubbard Cllllk G-2 Operations+lNlildred Nletzger G-3 Intelligence--lVla1'y Allen G-.L Nloralef-Raymond Gillliam Gi Communicationsgj osepliine llax ley G-6 Supply-Joe Nlandelstam G-7 Finance-Louise Glass G-X Publications-Nlae Lichenstein C-9 Public Spealcingflnlnier Bell G-IO :Xdministrationflfred Collins G-Il Hospitalityffirace McMichael fl-Il Organizations-Duexvard Fulwiler Grounds and Building-Morris Chertkov G-1: G-1.1. Puhlic Health-Foy Burke G-I5 Social Activities-Irvin Bt-ren fl-I6lfIll'Ull!IlL'I'1I and Attendance-Ira Fonsliee C-I7 Student VVelfare-Vivian King G-18 Athletic Activities+Syble Cox C-I9 Student Co-operation+Velma Dodd Aides to the Commanding Officer: A-1 Counselor for +A Class-'l'lietis Lemmon A-2 Counselor for 413 Class-Mildred McWilliams A-3 Counselor for 3.-X Classglileanor Williams .-X-4, Counselor for :B Classgllertha Christie A-5 Counselor for :A Classillflay Martin A-6 Counselor for :B Class-Katherine Voss A-7 Counselor for IA Class-Minnie Wyll Page Sixty V 1 i l 5 1 2 U iff' 'wn" C "W Y , 'Lg-,fff'Vf ""' "Qf"""f'Q,.gQfg,,,,QQff,,T1flflfff.T1ffffQl1fT1f.TQTIlfQffWJA V. 'E rf, ,jj'Qf M ' 'T' ',,1,g,,,:Qj1,,1 ' :f'.Q.I..'.TlIIlT'.IIZIXZ..'I."'f.'ff.llfZYLLTI'ZLTT"1ff 1 gi . - ---- 1 Q . sl fl 5 I is ' l 1 gi , . . I -W If orest H z gh 'Parent-Teachers Jssoczalzon i y For the Tear IQ24-5 q l l, l li I l' I. Open house to new members. 2. Sponsored lecture by Professor VVillia1n Sandoz on Vision: of JN. 3. Game Tournaments 4. Entertainecl -lan. '25 graduating class with banquet at Y. W. C. A. 5. Decorated tables for Alumni Banquet to graduates. il 6. Sponsored "Circle Theater' Show. 7. Originated plans and sponsored collection of funds to send Mr. Parker 1' 5 to Cincinnati. ' f 8. Furnished towels for teachers' rest room for year. 9. Furnished properties for play given by Mrs. Coble for the library. I IO. Filled the ollice First Aid Case. H II. Entertained football and basketball boys. l 12. Sponsored picture show for general funds. ll I3. Sponsored play given by Mrs. Coble for general funds. W 14. Entertainment for June graduates. 1 15. Donation to Life Membership in National Congress of Mothers for Dr. F. Kimball. gl K Mrs. Sol Israel .............,... ........... A cling Prexidenl Mrs. M. A. Read ,.,,.... ......... F irxl Vice-Preridenz Mrs. Paul Harris .,........... ....... T liirci Vice-Prcxizleni ll Mrs. C. C. Pollard ....., .. ............ R5C07'Lii7lg Secretary ii l Mrs. S. C. Green ........, ......... C orrerponfling Secretary 5 Mrs. S. Burns ..... .... - ..................,..,, T reasurer l Mrs. W. S. King ,..,...... ...................... R eportsr if 3. Mrs. E. Rheinlander .... .. .......... Parliamenlafian W Mrs. H. L. Peoples ..... .. 9 ' Wylie A. Parker ,Ad-virory Board i Mrs. Albert R. King -5 if to .. .... C tt .... . .g E Ji, V 'Y " ""' ' ' "'MI'fl.,'IfflQ".IfffQQQ1l""x"QQZf1flf'mlflflillillfffi -". f7AllfliZffTflQl 5 Page Sixty-six Maud l Les Beaux JMS Club The purpose ol' Les Beaux Arts Club is to stimulate interest in the work of the department and to increase the appreciation of the line arts as well as to bring together the members of the art department. Some very talented work is being produced by the members of the club. Les Beaux Arts is a fast growing and enthusiastic organization. lVliss ltlnsor is the sponsor of the club and is developing the future leaders in the world of art. ll'r4'.rfzff:11l - Vfre-T1'e.virfe nf Seurelary yll'lY:I3llI'c,'l' - St-rgrfanl-lit-U41 wr Reporter - 'l're.ride'r1l - VXCU-lPrl,'5f1fz'Ilf Sl'rn,'Ia1'y - Treasurlrf' - Sl'1'gea11l-al-effrvzx Repurier - - Bertha Fischl Bernice Langston Adele Mays La Velle Terry Helen Parrish Nell VValker Allen Egan Autry Hensley WValton Rhodes Guy Shaw GROUP 1 GROUP 2 Thetis Lemmon Joseph Malone Florence Kelly Nladge VVolsey - J. R. Storey Edwin Butters - Nlary Allen La Velle Terry - Velma Dodd - Loretta Reynolds MEMBERS Mary Allen Nerine Baldwin Mollie Brewer Roslyn Goldsmith Alberta Moore Loretta Reynolds Lois Shepard Lula Mae Wheeler Loyan Hall Gussie Champion Velma Dodd Evelyn Kramer Horace Hill Julia Haas Harriett Douglas Thelma Drennan xVLlfillllll Johnsen lflorence Kelly Marie Kynerd Bernice Thompson - Lovan Hall Edwin Butters Edna W:1ldx11z1n joseph Malone Stanley VVilkes Madge Wolsey klosephine Mimms Sophia Ryan Nlozelle Mays Bessie Waldo Otis Dozier 'l'hetis Lemmon Page Sixty-sewn cr., - IU . +- 1 l--- .r Crestha Club The Crestha Club is one of the oldest clubs at Forest Avenue High School, and since its organization, it has always endeavored to uphold its motto of "Ex- cellence," ' The past year, the ninth successful year of the club, began with the elec- tion of new members. The initiation was held at the home of Mrs. Miller, a sister of a member of the club, and this was followed by a delightful luncheon for the new members. The club decided, as its course of study for this year, to take up the study of foreign countries, their customs, and dress, but a great deal of the time was devoted to social functions and work on the Crestha Capers. On December 12, the annual Crestha Capers was presented, and was unanimously acclaimed a success. With the proceeds from this entertainment, the annual banquet for the football boys was given in the junior ballroom of the Jefferson Hotel. At mid-term, the club reluctantly gave up the following members: Eliza- beth Rinehart, Adelyne Rowe, Helen Lynch, Nellye Tosch, Frances Berger, and Ruth Ferguson. Honoring these girls, Marie Kynerd entertained with a lovelyi bridge tea at her home a few days before commencement. Only members of the Crestha Club were present. Miss Plummer, our able sponsor, has given her untiring aid toward the success of this club, and to her we extend our grateful appreciation. OFFICERS Fira! Term 'Prexideni Vice-Treririenz Secrelary Treaxurer Tresident Vice-Treridenl , . I reasurer Secrelary Spa nr o r Helen Lynch Adelyne Rowe Nellye Tosch Marie Kynerd Elizabeth Rinehart Wuanita Johnsen Dorothy Rinehart Josephine Read Nellye Tosch Eleanor Devine Marie Kynerd - - Miss Lottie Plummer Second Term Gethrel Brown Ruth Ferguson Anne Peoples Thelma Bailey Pauline Mills Beatrice Blakeney Margaret Moore Linda King MEMBERS Mildred Moore Hazel Price Lucile Braly Kathleen Carter Catherine Metzger Evelyn Duke Florence Kelly Bernice Langston Marie Kynerd Josephine Read Dorothy Rinehart Wuanita Johnsen Miss Lottie Plummer Mary Frances Bohannon Elizabeth Moncrief Frances Berger Inez Tabor Telva Wright Mae Dell Brown Maxine Maxey Alacia Mann -+- Ell' - .Ln Page Sixty-eight Page Sixly-nine 3- j , , ,tm W cf, 7 Y, ,, ,Q M i i l The Symposium Club The Symposium Club was originally organized and conducted under the name of the "Greenwich Villagersfi but later changed to the Symposium. The club underwent a reorganization at the beginning of the IQ24-25 term, and on account of the reorganization, the pledges were elected for membership in the club later than usual. The Work of the club is the study of etiquette, and under the capable direction of our enthusiastic sponsor, Miss Wickam, much good should be accomplished. During the Christmas Holidays, the club entertained with a box party at the Majestic theatre for the members. After the theatre, refreshmentsrwere served in the Junior Ballroom of the Adolphus Hotel, where tables had been reserved. 'President - - Wuanita Johnsen Vice-Treridenl - Dorothy Rinehart Secretary - - Gethrel Brown Treasurer - Lucille Braly Sergeanz-at-.ifrms - Ann Peoples MElN1BERSHlP Wuanita Johnsen Beatrice Blakeney Dorothy Rinehart Linda King Gethrel Brown Doris Barnes Marie Kynerd Hazel Price Josephine Read Mildred Moore Kathleen Carter Elizabeth Moncrief Maxine Maxey Telva Wright Evelyn Duke Gladys Short Clara Mae Pollard lvlae Dell Brown Thelma Bailey Gladys Wall Margaret Mann Mary Blakeney Ann Peoples Inez Tabor Lucile Braly Loraine Rich Pauline Mills Mary Frances Bohannon Florence Kelly Edna Waldman Bernice Thompson Bernice Langston Beatrice Thompson Alacia Mann it be U t- 1 Page S efventy Page Seventy-one V- -T Tn' l l sl l l l l . .3 Qzrl Reserves l "To further the cause of Christ in every Wayi' has been the purpose of the Girl Reserves for the year 1924-25. The Forest Girl Reserve Club is a junior division of the Y. W. C. A., and works with a fourfold program. This monthly program consists of service, business, social, and program meetings, and is made by the girls themselves at a regular setting up conference held each fall. A club for Mexican girls has been organized and the work has been successfully carried on by the members of the Girl Reserves. The Girl Reserves' banquets are held the first Friday night in each month, and these are always a success. The club has enjoyed several hikes, Wiener roasts, and swimming parties during the year. A Mother and Daughter banquet was held during "Gir1s' Week," and a formal candle service in honor of the new members of the club. In June 1925, three club representatives will be sent to Palacios,,Texas, for the Annual Conference. THE OFFICERS AND MEMBERS OF THE CLUB ARE AS FOLLOWS: - CABINET MEMBERS 'President - - Algene Bale Vice-Tresidenz - Alacia Mann Secretary - - Edith Goad Treasurer - - - Ruth Stcere Social and 'Program Clzairman - Gladys Evans Service Chairman - - Leona Harmon Council RE17ft,I67lfdff'B'6 - Marjorie Ernest Sponsor - - - Miss Bertha Jackson MEMBERS Jewel Allen Lois Jean Medley Mary Allen Alacia Mann Algene Bale Mary Gene Owens 4 Mary Blakeney Margie Pinkerton Constance Burnham Ruth Steere Hallein Burnham Minnie Dee Turner ' Edna Bilger Grace Williams Bertha Christie Augusta Zapp Marcel Daniels Dorothy Michaelson , i Sue Davis Hallie Smith ' W Helen Dent Sara Bronstein . l' Gladys Evans Marie W00df0l'd Marjorie Ernest Sylvia Kleinman W Edith Goad Lula Mae Wheeler V' Leona Harmon Anne Peoplgsg Ethelyn Holland Nellie Hicks li Cordelia Hilley Clarice Parker N Marguerite Harrison Katherine Shivers li Kemp Lindley Louise Tobolowsky l Anna Lois Lewis A l li l s..l l .L s All . L ...L D W, Page Seventy-lwu Page Seveniy-tlzrce The girls' Tublic Speaking Club The Girls' Publie Speaking Club was organized live years ago under the leadership of lylrs. Tura VV. Dial. The purpose of the club is to promote an interest in public speaking. lts growth has been Very gratifying, and in addi- tion to a maximum membership of fifty, there is a large waiting list. The members have Won honors in debate, declamation, extemporaneous speaking, and oratory. .Xnnie Bratlsliaxx Sara Bronstein Gussie Champion Ell7IlbL'tl'l Edwards Marjorie Ernest Claire Flood Pauline Goltlhaum Clara Goldberg Nlary K.. Heimple Lillian Green Vera Isbell Sarah Goldberg Nlarie lVIcClanahan Lihhye Nlinzer Florence Ryan Alice Steinberg' Frances Shor Pa ge Sem nty our M li M BERS Virginia NVyatt Sylxia Kleinman Nellie llicks Ethel Isbell Anna Rae Leon Silyy Oppenheimer Mattie M ae Madden Beatrice Myers Minnie Shtofman Cecyle Charninsky Vivian Wright Ruby Allen Esther Cohen llortense Landauer Roberta Miller Mary Gene Owen Cortlelifl Hilley Helen Nathan Grace Williams Lucille Bryan Ernestine McCantlless Claudia Sieratl Louise Byrd Corinne Tillery Nlarie Tillery Amelia Rosenblatt Willie Nlahel Taylor Georgia Vineyard Ruth Speiser Natalie Levine llenriette Fechenhack Gertrude Turner Lorene Swift Q4 may The S taaaarol Debating Society The Standard Debating Society has progressed very much during the term of IQ24-1925. Many new members have been initiated and much Work has been accomplished. The club had two of its members on the debating team, one on the declamation contest, and it anticipates victories in numerous other activities in public speaking. The success of the Standard is due largely to the loyalty of its members, and to the splendid Work of its enthuiastic ollicers. The Standard furnished both the editor-in-chief, Neel Warfield, and the business manager, Gerald McNabb, for the IQ25 Annual. OFFICERS First Term 'Prexidenl - - - Charles Waldman Vice-Tfesirienl Daniel Rosenbaum Seereiary - Neel Warhcld Treasurer - Harold Slaughter Sr'l'gea11Z-:lf-Ufrflzi' Spovzxof' - 'Y'rc.tfafe1Lr - Vice-Tre,rizlc1z1f Secretary - Third Term Max Rudberg - Miss Brown Daniel Rosenbaum William Pierce Charles Waldman Treasurer - Joseph Rosein Surgeani-at-Vfrvns - - - Max Rudberg Sponsor - - - - - Miss Rowe Second Term iIJ7'H.Yfll't3'VLl - - - - - William Pierce Vice-Tresifzbnl - - Max Rudberg Secretary - Daniel Rosenbaum Treasurer - - Joe Lerer Sergeant-af-Uffmr - - Herbert Berkman Sponsor ---------- Miss Rowe The following are members of the Standard Debating Society: Charles Waldman, Herbert Berkmang Joe Lerer, Edward Marcus, Daniel Rosenbaum, Max Rudberg, Seymour Margules, Abe Goldstein, Robert Andress, Zelma Brunoff, Byron Sachs, Jerrell Garonzik, Abe Berger, Dave Weinstein, Henry Bromberg, Sid Mogul, Clarence Elrod, Willianu Pierce, Irvin Beren, Iras Fine, Sam Bock, David Lefkovvitz, Godcheaux Levy, Nathan Donsky, Jack Robertson, Lankford Shaw,' Leroy Branch, and Reginald Ennis. Page S evenly-,five ,1 is 'i ji il il if gi 2 i 2 ll li ii Q? Zi 1 Page Sz'-zwrzly-.fix '1"14',vfffi'f1! lifu'-'l'f'f',ffift rl! Sf'i'f'i'lilf'X' I 1'mz.f11f'rr' Rvpoffi 1' 'l'1'i'.viffm1l I'Zu'-'l'1'i'.viifwr1! Si'cn'fi1r'y Tn'a.f1z1'rr' Nrf'gmzr1f-11!-- If Rt' pnrlrr Clziirc Baum Rust BLTQICI' Plizillva Birdwvll lllimhstli Bl11kt'mm'c R710 Bruudc Idzl Butk ,Icnuiu Buck I-llmtencv Culi I1 Flossic Nlziy Dui' Claire Flcmd Knthlccu l"rL'Ul:11id Forest Literezry-Dramatic Society OFFICERS Fnff 'frrrzz DA Sjvrffzg Tvrw 11 .v Iniugriic lfrry Exclyn Uxiinvs vrvvtliy M110 Hurt Anna Grvldstcin - Ruth VVnlkcr Anna Guldstc-in - Gladys lVlnry Rolwcifson - Vziii MEMBERS EX ulyn Gziizivs Mary Gaines l"iClitl1 Grand Amin Goldstciii Norma Harris Drurotliy lvlillw Hurt Riitli Aim Hntl'l1t'iv klusrpliimf Israel Lux eine King Wlimietto Kimmvll Tlwtis Lunmum NUI' Lutilc Nlllflillillll Miriam lNlz11'gi1la-s Sadie Moscsmxm Mclx 21 lVlCC:ilL'ln Nlildrcd Mrtzgcr Tlifiddic Mitflwll Silvy Oppviiliriiiiris Nladeliuf Frivdmzln Riitli Reynolds .lzliwt Reynolds Gladys Robvrtsmi - Ruth YVL-il gl1Zll'lCltIl Sl?lPl?U!Il Norma Harris Fda Ruscntlizil Rcva Shapiro Fmnccs Slim' Lottie Simcm Vziuglmnettzi Staaplt-tim Katherine- Stciuvi' Inez Tzibm' Virginia VVy:1tt Ruth VV6il Edna VVzildm:m Tclvzl VV1'igl1t FcliCC Ylbllllfli fndvi' tliv dircctiun of Nliss Uilsmi :ind Miss Elder, our spmismxs, tht- Litcrxlry llrzlm zitic Socivty llllg studied during tlic 1,"IlSf your tlic lives and works of Z1 few great :ultlii emphasizing' tht- uxliic of good litUi'11ti1"n'. urs, 5 I 1 3 f i i I r Q , 1 i P HJ ,vi- I . Forest Hz-T Club The Hi-Y Club is eontluetetl untler the auspices of the Y. Nl. C. fl. antl is alliliated with the Secondary School Boys Christian hlovement ol- :Xmeriea The Club membership is composed ol' high type young men ol' the unior and senior classes of the high school. The purpose of the club is to ereate, maintain, and extend throughout the sehool antl community, high stantlartls ol Christian Character. Several Hi-Y members attentletl the thirteenth annual Ultler Boys' Conlier ence, held at College Station. lVlr. YV. H. Butler, teacher ol' Soeial Seienee and Commercial Geography, has been sponsor of the elub for the past llour years THE OFFICIZRS DURING 'l'IIl'f IIIQICSICNT SESSION JXRICZ 'f'r'r.riJe11f --------- Robert Burns l'fm'-'l'f'e,riift'r1f llarolcl Dean Srr1'f'lf1r'y - - Paul Alelfers T1'm.r11z't'1' ------- Olix er Rayner S Nl r. XVylie .-X. Parker Ilrlflrlfuzm' 1l1r'f11fn'1r ' lVl. ll. B. Yates I Nlrs. VV. Il. Butler Eugene Alexantler VV. A. Biggs Allen Black Fny Burke Rubert Burns Ralph Darnall Harold Dean Allen Eakin Frank Estes W. Graul ME M BERS Oliver Holt Edgar lluckaby Paul Jeffers Leslie -lones Blames Lee Yancy Lindsay Marius lVlcLean Clay Malin xlfisepli Malone Oliver Rayner -Iames Roots A. lVl. Sanders George Siehenhausen Walter Smith VVilliam Snsen Ben VVatl1en Robert YVehster Richard Wilkins Frank YVi1liams Page Seirztrzly-.rfriifn i E S f ,ts get 'li thi :gi 25? ,gi 9,5 tsl :Eg rl! fl QE! 1 Page Seventy-eiglzt High Scholarship Club The High Scholarship Club was formed in IQZI for the purpose of en- couraging good scholarship in Forest. lt is composed of those students who receive the annual Linz awardsg in other words, of those students having an average of ninety, and no grade below eighty for the year, The club has a regular course of study, the present course being the life and works of Rudyard Kipling. Semi-monthly meetings are held under the leadership of Miss Rachel Foote, the sponsor. The High Scholars are always ready to proffer their aid as a club, or their service as individuals, to Mr. Parker and the school, and to fulfill worthily any duties required of them. OFFICERS FOR THE YEAR 1924-25 'Prcxidrnf - Vice-'Pfesidwzl Secretary - Trnam1'r1' - Sergeant-zz!-U41'11z5 Pm'liaf7zs11tarian RL'p0I'fi'I' - Spa VLSOf Evelyn Oppenheimer - Annie Bradshaw - Pauline Goldbaum - - Frank Estes - Frank Autry - Joseph Malone - Jewel Allen - Miss Foote Pauline Goldbaum Joseph Malone Annie Bradshaw - Irvin Beren - Byron Sachs 'lll'lL'tiS Lemmon Hurtense Landauer - Miss Foote E Tau Delta Epsilon Club The purpose of the Tau Delta Epsilon Club is to arouse and maintain an interest among girls in practical health subj ects, to develop a line spirit of sports- manship, and to inspire a high standard of conduct and scholarship. OFFICERS-SEPTEMBER, 1924 Treridenr - ----- - Vice-Tresidsnl Secretary - Treasurer OFFICERS-JANUARY, 1925 Tfusidenl - - - - - - Vice-'Presidwzt Secrsiary - Treasurer - - MEMBERS Pauline Mimms Dorothy Kelly Elizabeth Potts Ada Dashner Virginia Ruble Alacia Mann Katherine Mimms Doris Jones Nlary Katherine Heimple Charlotte Hollotick Pauline Mimms Dorothy Kelly - Ada Dashner Elizabeth Potts Elizabeth Potts Mary Perkins - Telva Wright Bonnie Mae Zumalt Ruby Bell Gethrel Brown Catherine Metzger Flossie May Day Nellie Hicks Telva Wright Evelyn Duke Erna Lorenz Beatrice Mimms Elizabeth Edwards Page Sevenly-nine Page Eighiy Juditores aesczris Since the year IQIQ, the Auclitores Czesaris Club has endeavored to carry out, by ineans of entertaining programs and intensive study, the object for which it was organizedfthat of keeping alive interest in Latin and in Roman eusioms and Civilization. This year the large number of active members have made it possible for the club to rapidly improve and steadily progress. All of the mem- bers have been instrumental in this year's sufeessful work. Under the leader- ship of Miss Miller and the Very capable staff of oliieers, the Auditores Czesaris takes its place as one of the largest and best Organizations in Forest. Fall, i1ll'E5ftfL'7lf - - Viet'-'flahtirfeizf Sewrnlary - Y'1'ea,vzzrer ' St'1'gai171l-af-1411115 Rt'p0l'fL'l' - Imniffr' - Sara Bronstein Zelman Brounorf Claire Flood Henriette Fechenback Catherine Harvey Mary Gaines Ethel Isbell Gudcheaux Lex i Elsa Lipstiz OFFICERS 19:4 Spring, 1925 - Harald Slaughter - - Elsa Lipsitz - Claire Flood - Joe Nlurray - Byron Sachs Libhye lylinzer - Miss L. Miller 'l"1'tr,tIrfe11I - View-'l'1'cJirie1zI S vrrelary - I-1'4'll57H't'I' - SL'l'g6'IZ7Zf'KIf-eff! 111 .r R if pn rfer - Lmifw' - MEMBERS Byron Sachs Helen Schwartz Harold Slaughter Minnie Shtofman Claudia Sierad Margaret Vineyard Virginia Wyatt Flossie Mae Day Maurice Rosenfield Irene Lindsay joe Murray Dorothy Metzler Seymour Margules Frank McCarnmon Libbye Minzer Silvy Oppenheimer Clara Mae Pollard Ullman Rust-nfield - Claire Flood - Byron Sachs Virginia Wyatt Seymour Margules - joe Murray Hortense Lanclauer Miss L. Miller Ruth Ann Horfheimt r Inez Taber Phalba Birclvyell Naomi Aronoff Hortense Landauei Roberta Miller Irvin Beren Florence Ryan .ri V, ,, H.-5 E " 'iii ""'i F " 3 n 5 I 5 E pl li. ge ill l. iff Kei lli ll' pl lil ill yr SV lil ll, rt 5 2 ll F ga .E EE fl ls ll ir gi is ll li il EE fi is il ii I rl 5 li if ii FT fi le ls si 35 li ff Ei .. is T! ll 1 l i,....,.,..,,...,........- .....,.g- . ... ,ff-if-,,,, fd- . iff- The flee Club The past year has been a great year for tlie Forest Higll Glee Club. Never before luis such wide-spread interest been manifested by its members or by the student body. Composed some really good work. Under t Miss Linda King, pianist, it luis Mariy programs have been gr broadcasted from Station WFAA George Siebenhausen appeared in wonderful music from a connnon preeirrted, was conclusively proved different states. James Lee also I ot about tbrrty young fellows, xxlio take tllCll' singing seriously, tlie elub bas aecornplrslied lie leadersliip of lVliss Louise VVilCox, director, assisted by more lurrrnony tban ever before. iren, possibly tlie most enjoyable being the radio prograin during tlic lirst semester. A prodigy in the person of tlns program in the most unique ot roles, as be coaxed band saw. 'flint it was wonderful, and also greatly ap- by tbe number of Congratulations lie reeeix ed from many lrls Qiven many beautiful Vocal solos thus oemonstrated his singing ability. The Glee Club has become lirnily established at Forest. During during tlie year, and tlie lrrst year ol its existence, it was not accorded xery liearty support, but at last it has come into its onn, luis been recognized for its true xalue, and aciepted as xx Forest institution, an organization of mutual benefit to iis numbers and to tlie seliool. Ifimf ZYVIIOI' Alden Armstron g 'l'l1 omas Brooks Samuel Bryant Frank lVlCCammon EllVYZll'Ll Koller Noel Lyle Harold Riddell Justin West Q-,f......,-,.......,-....3., Y ..-SY rlllu Robert Andress Leon Colien Abe Goldstein Louis Glaubergg Bzrily Morris Kerlin Bragdon J. W. jordan Jerry Rotrekl Roy Harrison CLEE CLUB ROSTER Xwrnirf Tenor C. L. VVebb Reginald Ennis Zellnan Brounofil 'l'lieodore Bartli Sam Morley Zedric Nloore A. C. Buchanan Olx in Birewell jim Breeding' Henry Harris Barflorze Bert McLean Reeves VVilliams Earl Morris Fred Haas BHJX Oliver Holt Paul Harris Odell Miller Herman Herrington ,lilfk '1'lWmPS'm Robert Freeman Raymond London james Lee Thomas Allen Connie Henry Isadore Prax orne Lam son Harper R. lJ.Cl1atldick Bennie Kerley Raymond Stroud Willard Morrison E i. 5 stir ...M F33 il li Y 1 ,I fl . il I :fl Lg. lr? eff , i 5 li? lil ig? ill fi? gs: .si Eli E? lii .az Est ?5 I 55 ' ass iff 25? gr: E5 3 lfl aug 5:2 si- S52 wa 223 sig is? 2 all n . iii r Zi? E . Fld ir? W. Iii QA: . Y i . iii z'f .53 515 .. , 55 7? ,, , ,L ,V .L,,,,,.,,,W,,e,,., e ....,-.,,--..e.,,,.M..Ls.-ee,-. ---. . .-E Page if Eighty-one s : SP Page Eighty-l-wa KX Oti,slXDozier -'7 It has been said that Uoratory may be symbolized by a warriorls eye flashing from un.ler a philosopher's browf' But why a warriorls eye rather than a poetls? Because in oratory the will must predominate. For a young American, looking forward to citizenship in a republic wherein the people rule, and personal ability is the unfailing key to public office and acknowledged leadership, whzgt could be of more importance than training in public speaking? When affairs demand action in the people's behalf, when an industrial crisis, or a political or a social crisis, is at hand, and something must be done, what in fact is ever done until a leader steps forth from the excited but impotent mob? And when this leader appears, how is he recognized as such? He is recognized as Patrick Henry vi as, as Calhoun, Clay, and Webster were, as Lincoln was, and Bryan, and Wilson, by their ability to articulate the popular demand, by their public speaking. Indeel may oratory, or public speaking as we know it today, be symbolized by a 'fwarriorls eyef' For does it not develop the characteristics of a warrior-courage, persever- ance, the ability to push right on in the face of terriffic punishment from a strongly en- trenched opposition? And does not public speaking develop also the characteristics of the philosopher-clearness of vision, thoughtfulness, open mindedness, far-sighted tolerance? Best of all, public speaking develops the will. How often has the awkward beginner longed to flee abashed from the platform, to hide himself from the laughter of his amused classmates! And yet, if he is properly taught, how firmly is he held at his post, and en- couraged to compose himself, to master his emotions and his fear, to concentrate upon his thought, to forget his embarrassment in his devotion to his message, until at last he says what he got up to say, and sits down rewarded by the applause of those who had before derided himl VVhen he next arises, he knows what to expect. He knows what he can do. He knows that the circumstances, the difficulties and embarrassments, will not inevitably control him and make him ashamed. He has had the experience of controlling them, and now he means to do it again, and to do it henceforth continuously. He has developed his will. He has established a relation with mankind. He has been listened to. Henceforth, he will strive to be worth listening to again. He is becoming self-confident, self-controlled, self-reliant. He begins to read more widely. He seeks familiarity with sentiments and thoughts worth while. They awaken his ambition. They nourish his mind, his soul. With these considerations in mind, public speaking has been taught during the session in Forest Avenue Hxh School. Our pupils taking the subject as regular class Work, our student speakers, our declaimers, our debaters, have done well. It signifies little what they may have done or failed to do in competition with other schools, for in actual life, the test for the speaker is: VVhat has he to say Worth listening to that is helpful and inspiring? If he has these blessings to bestow, he will never lack an audience. C. W. HILL. NC Ula r 1 r l l FLORENCE RYAN CLARA GOLDBERG S ophie Newcomb 'Debate ln 1924, Forest Avenue High School was honored by being the only school in Dallas and one of the two schools in Texas which were invited to participate in the southern inter-state debate held in New Orleans, Louisiana, under the auspices of the H. Sophie Newcomb College. By virtue of the success of the Forest representatives last year, Misses Goldina McFarland and Evelyn Oppen- heimer, in winning over all the teams from the high schools in the southern states, the great honor was repeated. By bringing back to Forest a magnificent loving cup, as well as by winning an inter-state honor for Forest, for Dallas, and for Texas, these girls set up a reputation and a precedent which this year's team, Misses Florence Ryan and Clara Goldberg should strive diligently to uphold. Much is expected of the Dallas team and we feel sure that they will do their utmost to win a second loving cup and thus maintain the record that was so auspiciously begun. The debate this year will be held April I8 at New Orleans. Misses Ryan and Goldberg will be accompanied by Mrs. Tura W. Dial, who coached last year's championship team. The question for debate is "Resolved, That the Child Labor Amendment should be ratified and made a part of the Basal law of the land." The states west of the Mississippi will uphold the ailiirmative side of the question and those east of the Mississippi will defend the negative. Fol- lowing a series of preliminary eliminations, a team will be picked to represent the rival sections. The teams thus chosen will debate in the final contest. Be- cause of its national significance, the Sophie Newcomb debate is perhaps the most important event of the year in the high schools of the south. 'r U . F I Y-um-as-uv Page E i ghly-lhree FEI El F- 'fav P 1 ... 4 i,: lx, ,N 13 l l HOWARD ANDERSON MARY GENE OWEN girls' Debate For many years a knowledge of public speaking has been considered nec- essary for men, but it was not until their entrance into politics and business that Women needed to study the principles of public speaking and to become well versed in current affairs. Wvomen, as well as men, must be able to stand before a body, present their views forcibly and concisely, and discuss questions of im- portance. The girls of Forest, realizing the value of public speaking, are being trained to become the leaders of tomorrow. This training can be acquired in the Girls, Public Speaking Club and in the public speaking classes. This is the third year that our school has been represented in debating by a girls, team and each year the interest in debating is noticeably increasing. This year Howard Anderson and Mary Gene Owen were chosen as the representatives of Forest in the Girls' City lnterscholastic Debate. Howard is a student of public speaking, and Mary Gene is a member of the Girls' Public Speaking Club and is also active in all forms of public speaking. She Won thc state declaniation contest last year. On Nlarch 18, in the Forest auditorium they defeated the girls' team from North Dallas High School. They upheld the negative side of the question "Resolved: That the United States Should Grant the Philippine Islands Their Independence at the End of a Period of Five Yearsf' We expect these girls to defeat Bryan Street High and Oak Cliff High as they did North Dallas and then continue to win honors for the school in the district and state contests. They are working hard and enthusias- tically, and have the support of the faculty and the student body. Mr. Hill instructor in public speaking, and Mrs. Tura W. Dial, sponsor of the Girls' Public Speaking Club, are to a large degree responsible for the excellent Work of these girls. Mr. Hill is the coach of both the boys' and the girls' debating teams. i - l Els' g g 1- lu Page Eighly-four UI LU C. L. LUNDELL DAVID WEINSTEIN Boys' Debate Public speaking has become a requisite for success in almost any phase of life, and the students of Forest, realizing this, have taken a great interest in the subject, especially in debating. The boys are trained in the art of speaking in the Standard Debating Society and in the public speaking department. These two organizations are largely responsible for the development of public speaking in Forest. The city debates this year Were conducted in an unusual Way, being held in the assemblies at the diferent high schools instead of at night as they were formerly conducted. Ten cents was the charge of admission, and although at- tendance Was voluntary, more than a thousand Forest students responded in the hrst debate. This year, Longworth Lundell, a student of public speaking, and David Weinstein, a member of the Standard Debating Society, were chosen to represent the school in debating. They defeated the boys' team of North Dallas High School in the preliminary debate held March 18, and they Were awarded the decision by a unanimous vote. ln this contest they upheld the negative of the question, "Resolved: That the United States Should Grant the Philippine lslands Their lndependence at the End of a Period of Five Yearsf, A loving cup is being offered this year for the Winning boys' debating team in Dallas, and if We judge from thc successful beginning these boys have made, We can depend upon them to Win this cup. mf be HJ Page Eighty-fi-ve Clit- rf--, ,A v i ......,,-.M-. fx:-...sfs-1, ..-Y-aa...,.xL, .,,,..,,..,..,.,...,-.,.......m..,.......-m-W-, .M ..,. .na ........,,, ...W ,V ..-ram. . .ls ANNIE BRADSHAW CHARLES WALDMAN Declamation Contest Much interest and enthusiasm was shown in declamation, and a large number of contestants entered the contest. It was evident that each selection had been carefully chosen, as the declaimers proved themselves very talented. Each speaker showed that he had carefully studied the arts of public speaking in enunciation, clarity, emphasis, and delivery. judges taxed their ability trying to decide on the winners. Never before in the history of Forest Avenue High School has such interest been taken in declamation. The following students entered the elimination contest: Claire Baum, Sarah Goldberg, Cecyl Charninsky, Elizabeth Blakemore, Anna Rae Leon, Howard Anderson, Annie Bradshaw, Ruby Allen, Gussie Champion, Charles Waldman, Abe Goldstein, Herbert Berkman, Lankford Shaw, and George An- derson. Annie Bradshaw won Hrst place in the girls' contest, and represented Forest in the city Declamation Contest. ln the boys, contest, first place was won by Charles Waldliiaii, who also represented Forest in the City contest. Second places were won by Howard Anderson and Abe Goldstein. Charles Waldman and Annie Bradshaw hope to win in the city contest, and go to represent Forest Avenue High School in the district contest of Denton. The winners at Denton will go to Austin to compete in the state interscholastic contest. Last year Mary Gene Owen, now a member of the debating team, won Hrst place in the senior girls' division. Forest is ably represented again this year and we expect great, things of our declaimers. T ffl .u..u..,.f,a.-.,---f-,...w.a....,,.f......m-x il ,dw ' aL.,l! , 1, l X l 1 i l ii ,, 1 H 1' ll i l .1 I l tl l ll iw l t...... D. L, Page Eighty-.tix HTL-1. , 71 .W-..-.... .,,...-,.f .......4e...t..,....... ,.....,.-. -if wr: L, - til? P! 'I lx .xg . 5 7 t X i l , 4 ,f f Q 'if f,ifiist f . W WR l ,fi llrl QW X "f yfii 'il ll KX' will I X ii fl . iw ' l , . l gift L My 2 ft KEMPY A delightful comedy' by C. and lflliott Nugent was presented by the klanuarj' 325 graduating class as their senior play on the night oli klanuarv 17. The story is about a l'hight'alutin" daughter who, in a lit of pique, marries the young plumber-architect, who comes to lix the water pipe in the house, just because he Uunderstandsll her, having' read her book and having sworn to marry the authoress. Hut in that story lies all the humor that kept the audience laughing every moment of the time. The play was directed by Mrs. Nlary Ross Coble. CAST Ruth Bence ,,,,,,,, ,,,,,,, .... "Kempy" ,. "Dad" Bence ,,,,, "Man Bence ,,,,,, jane Wade ..,,,,,, Ben VVade ,,,,,,,,,,,,,,, "Duke', Merrell ,,,,,, Kate Renee., .Y,.. ,Y,, YYYYYYY,YY, Y,,,YY YY,YYYY,YY,YYY,YY,Y, , Y IVA PARTY , Edna Adams ,John Singleton ,,,, Ray Tosch Elizabeth Ford , lIUO,f1L'l1CFI'j' ,Harry Phillips Leon .-Xlexander , Elsa Starr At last the class had decided to have a partvl Nliss lfvelvn Gaines kindly offered to have it at her home, at 3521 Holmes street, and the date was set for Vifednesdav evening, glanuarv 8, 1925. All of the lV.-Xls were saving, "Be sure to come to the party, because we certainly' are going to have a good time." And we didl VVe did not know what a line class we had until we got together at a social gathering. Everybody was gay and happy, and dancing and games furnished entertainment throughout the evening. Candy and llsliimo Pies were served to about seventy guests. Miss McClellan assisted the hostess in entertaining. lilvervbodv had such a delightful time that they were all clamoring to have another class party real soon. "THE SENIOR PRO M" Are you going to the Senior Prom, or is it too cold for you? Too cold? l should sav not--nothing could keep me away from that daneel So everybody came to Forest, warmth, and -iazz on December IQ, 1924. The jazz was furnished by the Midnight Nlelody Men, an orchestra composed of Forest boys, and the affair was unanimously acclaimed a success. Page Elgbly raven East I 5 W est "East is VVest," a play with a prologue and three acts, hy Samuel Shipman anil ,lohn ls. Ily- mer, was presenteii as the senior play hy the june '15 g'i':uluating class. "East is West" is one of the most striking' suceesses in the American theatre of recent years, It tells the eternal prohlem of the Orient and the Occitient. It is made dutlhly fascinating' hy the treatment of Messrs. Shipman and Hymer. lVIing Toy, il heautiful Chinese' girl, is shonn in the prologue heing sold on one of rho con- ventional Hovter hoats, according to the immemorial custom of the Celestials. The father hargains for the sale of his daughter and is ultimately glad to let her go at a low price to an American merchant. So the girl goes with him to San Francisco where Nling Toy finds a civilization more to her taste. We find her turning into a genuine American girl. As a matter of fact she hecnmes so amusingly American as to learn the shimmy, and to refer to herself as a chicken, and in other delightful ways she reveals the advantages of a VVestern education. As she is again on the point of being sold to a Chop Suey mngnate at the demand of a mission, she is saved by a young Amer- ican who falls in loxe with her and takes her home to his family. In order to extricate himself and the eirl from an embarassing situation, he declares his in- tention of marrying her. As :1 complete surprise to everybody, it is finally discovered that Nling Toy is really the daugh- ter of a Spanish missionary. The comedy, Uliast is VVest,'l is a remarkahly clexer piece of playxiriting. ,fXccortiing to a cr1t'c of the New Xork Herald the theme is quite novel, the action is unusually rapitl, and the scenes are xery picturesque. By JOHN HYMRY and Saxirii. SHll'l'I.'XX fl cofzzsrfy in llzrre nuff nuff a fvrnlngzle MRS. lylam' Ross Coniii, Direrfor CHARACTERS fln order of their appearance, Attenclant on Love Boat ,,,,, ,.,,,, B en VVathen Proprietor ot' Love Boat ,,,,. ,,,,,,. F rank Estes Billy Benson ,, ,s,,,,,,,,,,,,,..., .,.,,,,, P Iugh Moore Lo Sang Kee .,., Y, sssss Stanley VVilkcs Customer ., ..,, , ,,,,,, ,Robert VVchster Hop 'Foy ,,,,,, ,,,,,, H erhert Berkman Ming' Toy ,, ,s,,,,,,,,, Marie Kynerd Chong Lee ,,,, ,,s,,s,s,,,,, I rvin Bereu Servant ,,,,,,,, ,,,,,,,,,,,,,,,,,,.,.,,,,, A lex Fisehhack James Potter ,,,,,,,,, ,.,.,,,,,,.,,,,.,,,,,,,,,,,, G ilhert Carter Sing Song! Girls: Elizaheth illoncrief, Katherine Stephenson, Alma Lee Hausa, Inez Kretz, Effie Nichols. Page Fofly-two Charlie Yong ,, ,,,, ,, lililclrerl Henson ,,,,, Mrs. Henson ,,,,,,,, 'Ilhomas ,,,,,,,,, ,,,, Andrew Benson ,,,, Miss Fountain ,,,, Escort ,,,,,,,,,,,,,,,, Mrs. Davis Mr. Davis ,,,. ,,,,,, ,,,,,,,,,,.,, 'Fong' Men: lieu XYathen, Jack YVEl'illL'il'l'lCl' .. ,,,,, Claircnc Rogers ,,..,,VVuanita Johnson Alex Fischhack ,wmjoseph Taylor ,,,,,,, ,wlncz Kretz ,,,,,1NIelvin Samuels ,,,,,,Alma Lee Hause Thomas Sargeant. - Otis Dozter' FOREST AVENUE HIGH SCHOOL NEWS The two journalism classes furnish the news for the Forest .avenue High School seetion of the Dallas Journal every Friday. The ,lournal has given space for six thousand words, and, as there are ahout sixty students taking xlournalism, eaeh one is required to hand in at least one hundred words a week. Un the whole, the getting together oli a news-story is a hig job. Besides running down the news, the reporter has to have the news censored when the story involves a person or a poiiey. Stories are handed in on Tuesday, and re- turned on VVednesday for corrections. VVednesday afternoon they go to press. Frequently, photos are run to illustrate the news stories. Some of the students have gained the valuable experienee ot editing a real paper. The journal is printed each year in the Fair Grounds, and selected staffs from the Dallas High Schools and the colleges of Texas take turns editing it. The staff from the two Journalism classes of Forest were: Editor, Dollie Westhayg assistant editor, Doris Cameron, reporters and feature writers, Anna Harding, Lillian Green, Pierre Fontaine, Clara Goldberg, Pauline Green, Gerald lXfleNahh, L. B. W'eaver, Fdna Adams, A-Xlex Fisehhaelt, Dorothy Knight, Ruth Wvalker, Herhert Berlcman, and Harry Phillips. THE FOR ESTER The editors of our school magazine, the Forester, have made it one of the hest ot' the Dallas High School publications. All the activities of the school appear in this magazine, and its merits have won for it the whole-hearted sup- port ot' the student hody. The suceess of the Forester this year was due to the eflieient worli of the stall as well as to the high standards of the editors. The Forester stall for the fall term was as follows: Sarah Abramowitz, editor-in-Chief, lVIalcolni Kerley, business tnanagerg Evelyn Oppenheimer, The- tis Lemmon, Ralph Darnall, Pierre Fontaine, Pauline lVIimms, Lihhye Braude, Pauline Green, Anna Harding, Gerald lXIeNahh, joseph Rosein, Ruth lVallier, Rae Chotnisliy, Frank Autry, Annie Eradshaw, Byron Sachs, Sylvia Kleinman, Joseph lVIalone, Otis Dozier, Harold Slaughter, and Herhert lierliman. Page Eighfy-nine :, A T... 'S i It I .,..,W.t..a.............,...u,...,..,. Ii ei il gs gl if li EE E? Y 52 52 Zi I3 E? 5? E5 52 'I is ii as ll 53 EE if 55 Si S2 si Qi il 3, il Ei ti I ii 5? Ill is ies: A ,,.....-,.,a.... .W....,.....,,,..o.a.a...I..,..,....s-...,......... ...,.,.........., .-..- ....,,........,,.,s.a.,.....,.....g..,.,e,t. N ., ,.., .. t.. I.,..,. I..-,-.,e...,. ..,...l....,..-,.,..- . , V 1 1, I I as-4.1, I l, If ,, I IIE if-fi new 1, I I 5 L.1I...' 3:,u.I.s...,..I.a...M-a.ma..f.,.........,,......,...w... s.f..I ,i,,.,.,,..,.,.,,,,,...,.,. ,,., W A Ns.Is-Mfm--awww-M-M-M-MMM-W-WWW gl I I I , ' I " 5 2 l T lp IQ 2 ' , 'I ,. 3 L3 I I 1 ii gg ig ii l . 1, 4 I1 1' is ffl In I -I 5 Q S 1 2 E I 5 If I 2 i i i , N 5 Q 1 I 1' fi I ' ' I qi , X I I 5 X Y l I li The nnual S tajjt I ,I ll li 'l If l- EDITORIAL I 1 Neel Warfield ---- Editor-in-chief Frank Autry - ------ Assistant Editor I I l l' : 5 1 1 I, I lg ASSOCIATE EDITORS I I y Us Hallie Randaii - ------ Literary Editor lf l I I I Marie Kynerd - - Literary Editor I ' Evelyn Oppenheimer Literary Editor lu l Z E ' Kathleen Freeland - Literary Editor Q Q Ralph Darnall - - - - Athletics I l N I W Eg james Lee - - - - Athletics Q 11 Clara Goldberg - Secretary to Editor-in-Chief ll Annie Bradshaw - - - - - Faculty E ' Evelyn Gaines - - - Organizations Jeannette Spencer - - - Social R2 xl lk Thomas Sargeant - - Picture I ll i N Ruth Reynolds - Humor 1 E ' Katherine Stephenson - - - Humor I 1 Q Frank Estes - - - Military ' I S ' W Pauline Goldbaum - - Class Associate Il I 2 Alacia Mann - - - - - Gym ill ' I! Willie Mabel Taylor Special Departments 1' W Otis Dozier - - - Art Department Q l S Thetis Lemmon - - Art Department 1 1 Q , N I Joseph Malone ------- Art Department X QE I l , Ii I BUSINESS MANAGEMENT I . N g Gerald McNabb -------- Business Manager Yi l 'Q Dorris Apple - - Assistant Business Illanager fl Q " gi I1 Chad Starks - - Assistant Advertising Manager f if II I, I? Elizabeth Moncrief - - Advertising Manager 'I Edward Marcus - Assistant Advertising Manager if 1 15 Inez Kretz - - Assistant Advertising Manager fk 1 I :ff Dollie Westbay ---- - Secretary to Business Illanager li li 1 1 I A l 1 El Ii 1 y j, iq FACULTY ADVISERS YEL I gl Miss Harriett McClellan ----- - Literary is i I5 Mr. F. E. Norton - - - Financial li lx, if it lf FI I I .,e, isr,r, ,,,,, e ,,,,oir,.,, e ,is,, ,I,ei, I, ia,Q T ,iVeii, ,S I so We I ,,eIc H ., e.., - ii- T ,,,.TX.,s,,,W.. Y e., -TW,-r,.., .W-itmewmw.tg:,eeefzeanvawfsiimeemvmawmmmmemwwmeagql E-Slllxviiqft-efwwtaa-,xa.f..s... It ..I. ..t, . ,. .. I ,.., N ,, ,WI ,III , f.,,,,, W , I,,I, ,M ,.., ..,, ,.,..., ,. .,.,.-.,..,...s-,.t-c.......Nt..,..W..sa2.-.f.a.u.w...taz.gs,.E,2 pg W I '-vw-'M-we-vaww-v-I-if--fa--4...I...,.o........:.......,.......,,.,...s,,.I,M,,,,,.,,,, ,,,,,,,,,,,,,,,,,,...,..w.,..I,..., -1,,,-.....Jve..-eerie,-,-IA-ff nu- ---f ----- que- ,--f mls. Page JVinety ,I I l Url lm rpg V, P I in Ill l w Closing Word The school has slowly ceased to hum and be noisy and a peaceful stillness is settling over the building. The last member of the staff has departed, and I find myself alone and strangely depressed. I tell myself I should be elated at the completion of my task. I try to shake off my depression but it clings to mc, faint and undennable. I see from my desk a little brown bird. He has been building a nest for a long time. Now it is finished. How proud he is of it! Unconscious of my scrutiny he struts and preens his feathers. He sits in his little doorway, and his little throat seems bursting with song and happiness. He has deprived himself of many hours of leisure while building the crude little home, and now that it is finished he is happy. He cares not for other nests, though they be more elaborate, for this is his own. He knows the satisfaction of a task well accomplished. He is innocent of envy and heedless of criticism. I, too, have had a task to perform and a goal to reach. As editor-in-chief of this Annual I was entrusted a sacred duty by my fellow classmates of the june '25 Senior Class. I was to compile a year-book of memories and achievements. The class is judged by its Annual, and I have given my all to make it a success. I can see now where I could have done better, I see where I could have improved it. I marvel over my past problems and wish that I could go through them again. Before me lies my work. It is finished. Why can't I rejoice as does my little brown friend? Why is it that I feel strangely depressed? I, too, have done my best, but I am not satisfied. Would that I might have done better! I take the finished dummy to the printer. Within a short time the I925 Annual will be distributed to the students of the school and will be subjected to frank criticism. Will they like it? Will the senior class approve of it? Will it be worthy of the senior class, and of Forest Avenue High School? I can visualize it as it will be. I hope you will like it and approve of it, I have worked faithfully on it, I have sacrificed many hours of leisure to make it a success, and I conhdently leave the judgment to you. I wish to acknowledge the inestimable aid of Miss McClellan, my sponsor, who cheered me when things went wrong. I want to thank those who have helped me in any way, and especially do I wish to acknowledge the tireless efforts and help of Frank Autry, my as- sistant editor. He has been an inspiration to me. The entire Annual staff has co-operated with me in a very pleasing manner, and I wish to acknowledge a lasting debt to each mem- ber and to assure them of my appreciation and gratitude. My dear friends, here is the 1925 Forester Annualg take it, it is yours. "Be to il.: virtue: 'very kind Be to its faults a little blind." NEEL WARFIELD, Editor-in-Chief. ul I t Lu Page Ninety-one is A ' 2 Il 'I f, ' 5 5 ll ll an sw ll 5 5 Page Ninety-two Otis Dnzicr Tha-tis Lemmon Joseph Malone VVilliv Mabcl 'Taylor Anniv B 1':1 dslmvv Drmlliv Westbzly F 1'z1 nl: Autry Elizabeth Moncricf Pauline Goldlmxum Kfltlulcvn Fmclaml Frank Estes Ruth Reynolds Ralph Darnznll Katlwrine Stephenson Evelyn Oppenheimer Inez Kretz Alacia Mann James Lee Evelyn Gaines Marie Kyuerd Ivanette Spencer Chad Starks Thomas Sargcant Clara Goldberg Hallie Randall Dorris Apple Page Ninfty-lfzrcg l TE l P I l Miss ELLA J. MURPHY FLORENCE RYAN CHARLES NEISLAR MR. GEORGE C RORRE Faculty Adviser Editor-in-Chief Business Manager Business Manager Forester Stay? Florence Ryan - Editor-in-Chief Clara Goldberg - Assistant Editor ASSOCIATE EDITORS Wilanita Johnson ------- - Literary Hortense Landaucr Poets, Corner Frank Estes - - Athletics Pierre Fontaine Military Alacia Mann - - - - Gym Beatrice Myers' - Organizations Willie Mabel Taylor - - Activities Charles Waldman - Personals Inez Kretz - - Humor Daniel Rosenbaum - - Exchange Lillian Green - - - Music Longworth Lunclell Public Speaking Catherine Lively - ----- - Secretary CLASS ASSOCIATES Algene Bale - ------ func '25 Norma Harris January 126 Annie Bradshaw - - Junior Sylvia Kleinman - Sophomore Anthony Strange Freshman w 1 N! w ...as L if Page Ninety-four F0 res ter Stay? i l Clara Goldberg Gerald McNabb Herbert Berkman Beatrice Meyers Wuanita Johnsen Otis Dozier Willie Mabel Taylor Lillian Green Norma Harris Pierre Fontaine Thetis Lemmon Charles Waldman llortense Lzindauer Frank Estes Sylvia Kleinman Joseph Nlulonc Algene Bale Anthony Strange Inez Kretz Edgar Huckahy Catherine Lively Longworth Lundell Alacia Mann Annie Bradshaw Page Ninety-five -4 1 2 1 's is 1? Q1 ii ii if QE ii it 55 fi . is f: as fa fl if 1? A5 54 gf Q! ii gl I Page Nifzelyfsix Ot 3512 LITIQUCS 4 Citi I :im Hccroiz B. YATES ALFRED J. Loos HERsc1-1121. FORESTER RACHEL M. Foo'rE ATHLETIC COACHES Miss RACHEL M. FOOTE Coach of Tennix Miss Foote has turned out some very worth while tennis teams at Forest. We are proud of the record made last year, but watch the team of 1925! How did Miss Foote learn to do it? By winning tennis letters at Texas and Chicago University, and also by being a real woman, a real sport, and a real coach. Foresters feel that it would be hard to End another coach like our Miss Foote. MR. ALFRED LOOS Head Coach of Football, Basketball, and Baseball From almost raw material, Mr. Loos has formed a winning football team, the best that Forest ever had. On top of that, he has created basket and baseball teams of the highest type. Not only on account of his ability as a coach but also for his manliness, his squareness, and his sportsmanship, Mr. Loos has won the respect of every Forest student. He has won letters in football, basketball, and baseball at Beloit, and he is a graduate of the coaching school of the University of Illinois. MR. HECTOR B. YATICS Coach of Track Mr. Yates has developed some of the best trackmen that ever pounded the cindcrs. He has always shaped a real track team out of his ungainly candidates, and it has been repeatedly said that he is the best track coach in the city. Mr. Yates came from the University of Tennessee. We Foresters like him because he is a real track coach, because he is quiet, because he is sincere, because he is a managr de luxe, and well--just because we do. MR. HERSCHEL FORESTER Coach of Football, Basketball, and Baseball Mr. Forester is exactly what his name implies-a Forester. He came to Forest in 1924, and has showed us something to love and admire in the form of coaching. He and Mr. Loos have worked shoulder to shoulder, polishing up the athletics of Forest, and for his efforts he has received the unbounded respect and confidence of the students. Mr. Forester is a "reg'1ar feller" on the gridiron, on the court, and on the diamond. , U 1. - L Page Nznety :even UI or I CAPTAINS MELVILLF "BUD" BROWN Foofball A great deal of the glory that must ever belong to the Forest W'onder Team of ,24 is undoubtedly due to Captain "Budl' Brown. A giant both in stature and heart, he led a faltering team from a place of uncertainty to a place of dazzling heights, from a place of bitter defeat in the beg'nning to a place of supreme achievement in the end. That he Was a valuable player was proved when he was chosen all city man for two consecutive years. Because of the wonderful part he played in defeating along vvith the other teams what the World called the "State Champions," his loss will be deeply felt next year. J. C. "ABE" BARNETT Basketball Old "Abe," every one's friend, led a green and inexperienced team through a very successful season. To the splendid floor Work and defensive ability of this big center We attribute a large share of the success. We are extremely proud that he will wear the green and white again next year. OLIVER BRECHT Baseball Oliver was unanimously chosen captain by the letter men, returning for the ,25 baseball squad. Although a good third baseman last year, he has improved Wonder- fully, and seems to be the outstanding candidate for all city honors. But this tiny captain's ability does not end with spectacular fielding. At bat, he is a terror to Veteran and urookiel' pitchers alike. Forest loses this splendid baseball star after this season. HENRY PUCKETT Track To Henry Puckett, star track man, falls the duty of leading Forest's track team this season. A more capable leader could not have been found, for Henry is a hard Worker, keeps in perfect condition all through the season, has lots of natural ability, and cheerfully shows his men the mysteries of the track. The outlook for him and his team is very bright. 77 Wearers of the Lion MTD Melville Brown Albert Brecht J. C. Barnett Henry Puckett Sammie Reed Bennie Messina Ray Tosch VVilliam Schaerdel L. B. Lagow Walter Ewell Elmo Green E Q gcNQ sf ' ml 5' I Q, I mf 5 1 A0 Mp, in M 0 .Jinx - ia ini' Harry Phillips Victor Sauiiey Carlo Messina Jimmy Collins Oliver Brecht Willard Morrison John Singleton john Cooper Jack Duckworth S. T. Jones L. Cooper Nizzcly-eight ,- ..g l W.. 7 l LLM X M Jos 'TTALONE V 4 f if 2 ' -W "uri 1 - Q. ! , . -f ha f' i wr QQCQJ ,gt jf K M IJ yy If A- ff , J f - A M, 44 .aff Seczsozz Review Forest stirred w'ith the initial activity of- the scholastic year when the call for foot- ball practice was sounded. The vvorlt-outs were naturally light at first, and all the regulars were not in harness, but by September 15, a squad of some fifty men had settled down to a steady grind, which was to last until the first of December. liight letter men from that "Grand Old Team of' '23", three of whom won berths on thc, mythical all-city eleven, formed the nucleus of the first team, with the prospect of' several ambitious youngsters from last ye:1r's cubs. Captain hlelville Brown, an all city tackle of college calibre, Ray Tosch, a scrappy all-city guard, lfagow and Nlessina, mainstays of that impregnable line of' 323, Reed, the passer perfecto, and a hard man to stop in a broken-field, .-Xl lirecht, a capable triple-threat quarterback, Barnett, rangy encl and brilliant pass-receiver, and Phillips, a wonderful defensive end, and another all-city man, stepped into their old traces to malye football history for the Green and White. They were boosted by the following members of' the '23 cubs: Collins, Puckett, Nlessina, Seely, lVlorrison, lirecht, Faufley, and Singleton. hlanv of' these veterans are playing their last year for Forest, and the grand climax of their brilliant high school career was the glorious victory which they won from the Oak Cliff Leo P- ards, the bitter opponents of all l"orest teams. Grzrlfmd Forest o ened the itz, football season bv defeatin the Garland all-stars an P I . 3 1 exceptionally Strong early season team, 11 safety in the first quarter being the only score in the game. Captain "Bud" Brown and Sammy Reed were the outstanding player! for Forest. Page Nimfly-nine 5 ...V . ,..,,., ,a. ,,.,,,, .,..,, , W.. , .,... .,e.,,...a..........,..,...,,,,.W.,.,., l.,,.,,..w.a.,.......-,,..W. .,,,,.,.i.,-,-,----W-N--M-M' 7 i f 2 x fi i 1 5 3 3 r i i i , i s 1 e i i Q 5 i i 5 i 5 li J ii li i l i ll 1 WN Wm, W ' 1924, FOOTBALL TEAM li li To the Team fl H 9? l i il We may sing and we may cheer, It's the Fight, tight, Hght, .5 VVe may praise from sun to sun, From the kick-oil to the close, But We'll never hnd the words to tell It's the try, try, try, , F . . . il The half of what you've done. ,Till the last shrill whistle blows. Itls the pound, pound, pound, lt's the grit, grit, grit, On the staunchly-standing foe, Of the battling boys in Green, Itis the hold, hold, hold, It's the everlasting pluck of you, When they've one more yard to go. Our Fighting Forest Team. 5 2 ?HOIl'I'IlNSE LANDAUER. i THE FGREST SPIRIT i i ' fD6IfiL'dfEli I0 l 2 Behind the teams at Forest, i, Behind the class and drill, Flames high and unrelenting The joyous Forest Will, The will that meets and conquers Each team and task with vim, And lifts Old Forest's rafters With Forest,s honest hymn. i e One splendid boast We'll leave, me Behind when we are gone, That Forest, never quitting, Fought on and on and on, And Forest men tomorrow, i 1 Inheriting our might, Like heroes shall continue To fight and ight and fight. Z 1 ii ii the Forest boys everywherfj Behind the pines at Forest, The sky turns gray at night, Where Forest colors not The dauntless Green and White, A sky-vast flag they flutter Wide areas apart, And flame more sacred, splendid, In every Forest heart. n, As long as Texas sunset And sunshine shall unite, Above the smiling compact With Forest's Green and White, So long may Forest foster, And in her love unite, Brave sons deserving roster In glorious Green and White. -RAY W. Tosca. New b-2-1-ff-ft-Vw., -Mmm, M. .a ...,., , . .W ,W-Wk.-....,.,,,e..e...,, , .,,. ,,-W..-...,, -.amy---4 .w.-..,.-a..,..aT,.4f-......,..f,.f,...,..P..-.a-f,.a..a.--.., Page One Hundred 5 ,,..,. ea,-My z Q., 53 i gi 5 S 2 is V e 5 7 ls R E . 3 yu: ini ii l 'i it l V x i I 1: li ii Qi il iii if 1.5 is if i i . i I ' 1 Z F il 1 it 4 5 5 x ii I 5 2 fi 52 gl ii f L . ii it .ei Qi il 2 is E Z ii 9 U g J Qlrlinglon The green and white experienced little diiiiculty in turning back the highly- touted Arlington team with an 88-O shutout. The game brought out I1 number of spectacular plays. Jimmie Collins ran a kick-off back Q0 yards for a touchdown. -lim Seely added another in a pretty side line sprint of 70 yards. Shorty Morrison tore through the line for 50 yards and a touchdown. Tosch, Ben hdessina, and Phillips deserve credit for their Gne line playing. R ockfwall The Lions, revealing a marked improvement in team-work, defeated Rockwall 25-O in a hard-fought game. The Forest supporters were given a treat when Albert Brecht, a star quarter-back of previous years, returned to play his last year for the Green and White. The first two markers were made by passes to Barnett and Phil- lips, the last by straight line plunging. The stars of the game were Brown, Recd, Phillips, and Barnett. Hfaxahacfzie The Forest "Fighting Lions" suffered their first defeat in one of the hardest fought and thrilling games of the season. The Indians scored first on a plunge after a long punt returned by Cason. Puckett plunged Forest's first marker and after a brilliant run by Reed, Barnett booted a pretty drop kick between the posts for a field goal. Forest had the game on ice when Jones snatched a long pass from Heeley, and raced for a touch-down in the last few minutes of play. "Bud" Brown, Puckett, Reed, Lagow, and Ben Messina starred in the I2-IO defeat. Sherman Forest lost its second game of the season to the scrappy football team from Sher- man. With it went the hopes of a state championship team. The Lions were out- played and outscored in the first quarter when Sherman, taking advantage of Forest's slow start, scored a touchdown with direct plunges by Hume, Belden, and Lassiter in the first ten minutes of play. A few minutes later Estes tackled Brecht behind the goal line, thereby concluding the scoring for the game. Then snapping out of their daze the Foresters began a splendid drive that ended within a few yards of the goal with a bad pass from center. At no other time did either team threaten to score, and the game ended with the ball in midfield. Reed and Brecht were the stars of the 9-O defeat. North 'Dallas Forest's City Championship hopes faded considerably when the Bulldogs trotted home with a victory in their hands and many rabbit feet in their pockets. ln the cleanest fought game of the series, the Orange and White defeated Forest by the scant margin of a field goal, a perfect drop kick booted by Haskin Cobb a few seconds before the end of the first half. And yet, in practically every quarter Forest flashed a superior team-work and attack to their opponents. Forest simply failed to score when her chances were brightest. A drive earlier in the game swept the ball to the eleven yard line, but a fumble ruined the chance to score. ln the third quarter the D l J Page One Hundred One n - 45? Lions flashed a brilliant driving attack that threatened-but that was all. Twice, drop kicks were missed by inches. Ir was truly a heart-breaking defeat, but every man fought splendidly to win and we can say without boasting, they lost only in score. Brecht, Barnett, and Ben Messina starred. T Tolyzecfmic The Forest Lions hit their top stride in the game with the Parrots, and after overcoming a slow start, they opened with a dazzling attack that scored at will. At the end of the third quarter the score was tied I2-I2, and by then Coach Loos had chosen a scoring back-field. In the last quarter the Green and White, led by the diminutive Sammy Reed, broke with ease through the weakened Parrot defense for repeated touchdowns: In this game, though Captain Brown was out with an injured knee, Forest showed a lighting spirit and team work superior to any heretofore dis- played. Bryan ln the second game of the city series Forest met Bryan High School and for the fourth consecutive time "skunked" their old rival. Bryan's wonder team fell before the terrific drive of the Forest backs and their backs were unable to penetrate that fighting Forest line. In the second quarter an effective passing attack placed the ball on the 9-yard line and elusive Sammy Reed slipped completly through the Bryan line and back field for the only touchdown of the game, and another coat of white- wash went to cover that 62-6 defeat of bygone days. Ewell, Messina, Lagow, Bar- nett, and Phillips on the line, and Brecht, Reed, and Puckett in the back field starred throughout the game, though we must not forget the men who made this possible- the interference runners, the backbone of the team. Oak The Forest Hi grid machine began the 1924. football season with a poor start, but slowly and surely gathered strength and momentum, till in a spectacular flying finish, it trounced the Oak Cliff Leopards, who for five years have humbled the best Forest has had to offer. Then let every loyal Forester honor the memory of that magnificant team, who in a splendid 60-yard drive, fiercely contesting every inch of the way, drove the Blue and White back to their goal line and despite the frantic efforts of the Leopards to stave off defeat, scored the lone touchdown of the game. The game was Cyclonic and bitterly fought. The proud Cliff dwellers fought fiercely to win, but the little wonder team was not to be denied. Forest assumed the defen- sive after the touchdown. Only once did Oak Cliff come within the 20-yard line and that was in those last gripping, tense moments when Lynch, the Leopardls scin- tilating quarterback, was hurling caution to the winds in a desperate effort to score by long passes. It was easily the greatest victory ever won by a Forest team and we honor and pay tribute to the boys in green who would not acknowledge defeat, and who gave the haughty Cliff dwellers a bitter white washing. The whole team starred. The backs were elusive and they possessed a powerful drive. The line held the famed Leopard front wall and opened holes for the backs. But to Albert Brecht, the sensational young quarterback, who was playing his last game, must go the credit for scoring the lone touchdown of the bitter conflict. U i Y VVYYV Y a-W-llfiv. T' "if" , , l E ll F T237 'U Page One Hundred Two . .s J t r J. C. BARNETT, End Seann! l'ear-.4lZ-City "Bashful Abef, with his brilliant pass snagging and general line playing, landed a safe berth on the coveted all-city team and won the respect and admiration of all who have seen him in action. Quiet, unassuming, but always doing a little more than his share, Abe has gained the friendship of every man on the squad from rookie to fellow-star, and these traits, together with his grit and fighting spirit rank him high as a prospective captain of the 1925 team. MELVILLE BROWN, Tackle fckzpzczinj Fomfh Year-All-City "Bud," thrice an out-standing all-city tackle, ends a brilliant career in high school football, having the satisfaction of having beaten Oak Cliff. He has starred both as a tackle and a full back and is an experienced, aggressive player. Never show- , ing his authority without cause, "Bud,' has made an ideal captain, and Forest may well ' mourn the passing of a star gridster and an all-round good fellow. ' ' I l l l I.. f 1 D ---Y V . in Page One Hundred Three 1 .i R ,, i f Tiff 22 t I U F . V, QU ,T , , l t l i l l E F. li 5 1 I l F i CARLO MESSINA, Half-back First Year "Zola" is another cub who has materialized into first string material. He is a good plunger, hard to stop, and a dangerous threat to the opponent's goal line. As a constant ground gainer, he will decidedly be welcome back next year. BEN MESSINA, Guard Second Year-All-City "Firpo,,' a husky son of ltaly, has for two years been the mainstay of a Well-nigh impenetrable line. Hefty, with big hands and feet, and the ability to use them, and a smashing effective type of play, he Well deserves his place as an all-city guard. "Firpo', hit his stride in the Oak Cliff game and often stopped the Blue attack behind their line of scrimmage. He will be back next year. ALBERT BRECHT, Quarterback Third Y ear-All-City "Hook" possessed all the requisites for a star pilot with plenty to spare. His heady playing, his sportsmanship, his powerful punting and plunging, his Work as a safety-man, and his exceptional ability to snag or block passes, all mark him as an ex- perienced player and a constant threat. Barely missing all-city honors last year be- cause of injuries, "All, was almost a unanimous selection this year. To our sorrow, Al has probably played his last high school football game. lr g.1Tl"1 Imffff'Ti-Llfil'""lfQ.1I.lQ'ffifTf:Qf":'M""f'"M "" RT" 'W' i'f4i'f'Kif 'iii ifmwf f'M'"''1iffZ"1'Qff"'ffff"""' . .......... ai . iii' " :V ML"'a'h""""""fl.i i 'f' Page One Hundred Four U H 3 WILLIAM SCHAERDEL, Tackle Firft Year "VVillie', Was the only rookie that made the team. Although he was handicapped by having his collar-bone broken early in the season and in spite of his inexperience, he developed into one of the best tackles on the team. He is av splendid exponent of that smashing, low-charging type of linesman that Fights every second of the ganIe. Forest sincerely regrets the passing of such a promising player. HARRY PHILLIPS, End Second Year "Sheik', turned in a ood ame throu hout the season and is a fine tv e of ath- S g S v J P lete a headv thinkin ulavcr always in trainin . He runs at a stead consistent ait 1 J S l . 1 J S Y S v plays a Hne defensive game, and seldom misses a tackle. Though he failed to hold his all-city position of last year, "Sheik', was just as dependable a cog in the Forest ma- chine as ever. He Will not report for the IQZS squad. SAMMY REED, Half-back Second Yam'-Sammi All-City Sammy started the season at quarter, but Was changed to a half-back position, Where, untroubled by the calling of signals, he proceeded to play a Hne game. He is the passing threat of the team, a shifty broken-Held runner with a ready stiff-arm, a fair punter, a remarkable plunger, considering his size, and a popular, Versatile athlete. Sammy graduates in January. ju...k-'W L --1 l 1 I yew: III't' I' 1 Page One Hundred Fwe u l-,LJ Ei., ' i , El 4, ll l l l i 1 L. B. LAGOW, Guard Second Year L. B. plays anywhere in the line, but settled in a guard position during the city series. He filled a scrappy, aggressive position in the best line in city, and probably l the state, with the fighting spirit and dependableness of work that is so essential to team-Work. L. B. will be back next year to uphold the honor of that brilliant line. WALTER EWELL, Tackle - Firrt Year This handsome young football player hails from last year's cubs and has devel- oped into an excellent line man, in spite of his inexperience. He broke up passes, spilled runners, played a fine defensive game, and in general, carried himself like a veteran. This is his Hrst and only year. i f VVILLARD MORRISON, Half-back i Firrt Year l "Shorty" plays every position on the team and does a good job of it. Diligence and constant hard Work won 'KShorty" his letter, and in spite of his size, he could W 1 substitute for any man on the team. He will be back next year. 1 i i ' l i l ls +L, LL, f of - fp Wg ' ' , Y' " rv ,L m he so gr J Page One Hundred Six A U me le l t VT QU i l v l L 1 I l l l w lr fl Wi i El ,, lil! lr' 32,1 VICTOR SAUFLEY, Center 1 1, F int Year 1 5 ,1 1 ,N 5 "View is an accurate passer and aggressive pivot, whose inexperience alone hin- ' 5 dered his best playing. What he lacked in knowledge of the game, he made up in 5 H 1 -E 43 J v A 3 fighting spirit, and was always ready to jump into the middle of the hght. "Vie" will E robabl be back next ear. 9 , P Y Y E, Wg u e l HENRY PUCKETT, Half-back Firft Year ' ' 1 Henry, another product of the cubs, developed over the summer into a fast, U if smashing half. He is adept at skirting ends, fast enough to make his holes in the xl 3- . . . . . . . l vi ii U llne, and once in a clear held, he is a streak of lightning. He is a bright prospect for l ll the backheld of next yearls eleven. il ' ll li 2 55 RAY ToseH, Center if Q Fourth Year-A If-City l fi sf l i 1' Ray has the honor of having tasted all-city honors for four years, a record equalled by few, if any, athletes in Dallas high schools. From an excellent guard, H li Ra has been converted into an e uall excellent center. With few bad asses to his 5 1 3, 1 Y fl Y P , E fi 519 Credit, he has shown his ability as a heady aggressive pivot. He is the fighting spirit lf li of the team and leaves a big gap in next ycarls line-up. l 553 li v 3 t U ii Q LQ, sgmmN,,e,mc.WQ.lQitiii ft Y wif ,e ff? --i e Y' YAfggQefiifftfeflllfljif Page One Hundred Seven .E v if H-- me, 1 D r-if - ee lil Z l JIMMIE COLLINS, Half-back Fin! Year "Senator,,' a second team letter man, won l1is spurs this year with a season of steady, consistent playing. He trains hard and gives the best he has for the team, leaving little to be desired. He is a popular chap and will probably be an important factor in the 1925 team. JOHN SINGLETON, Guard Fin! Year ' "Plumber,' also hails from last year's cubs. Unfortunately, he will not be back next year to carry on the fine work begun this season. He sat lightly on the bench, ready to go in any minute, and always made a creditable showing. ELMO GREEN, Tackle F int Year ' Elmo is a sterling line man and will be of inestimable aid to the team next year. He is only a rookie, but he has great prospects for development in the next two or three years of football. He is a hard, consistant player, and trains hard. He will don the green and White again next year. OLIVER BRECHT, Quarter-back Firrt Year "Ollie" was an understucly to his brother Albert who directed his team to a win over the mighty Oak Cliff Leopards. "Ollie" is a brainy and exceedingly elusive quarter-back and if he is back next year, he will be a regular. We regret that he failed to have his picture taken. 'Qfnf' ",,, L -.-,.r1..- 1 D Page One Hundred Eight 1 x C ,Je 5 li ? QT 'V I Jos, m'A'..orwE ' it E Ml fi" ,-1 1 S 861500 Review Considering the severe handicap sustained by Forest when no letter men answered the call for cagers, the IQZS Basketball season has been very successful. The men who have made up this year's team have fought hard and tried consistently, and we of Forest could asli no more. The team spirit has been marvelous. The spirit of the student body has been better than that of previous years. Forest has had the kind of spirit that deserves praise and laurels. Mr. Loos has Worked wonders in developing a list of green boys into finished basketball players, and he surprised the other schools of Dallas when he did this Ustufff' Mr. Forrester helped the Hrst team by developing a fast second team. Among the early games of the season were three practice battles with the Dallas Power and Light COI11P1l11f'iS team and a tussle with Sherman High. Then came the City Series, and along with it a game with the Stickle Lumberjacks, in which Forest received 3526 for shooting I3 goals on the professional quintet. THE CITY SERIES The City Series opened for Forest January 20, IQ25. The score was as follows: F ores! 1 4--Qlfrymz 1 0 Forestis bitter enemy was Hoored for the count when 'Ktirnew rolled around after a hard--fought game. The game was rough, and tested well the strength of the men, if not their skill. Charlie VValdman was the high point man of the fray, with 3 field goals and Z1 free toss. C. Barnett and Oliver Brecht also played a hue game. Page One Hundred Nine gy Um' 1lIHIJl'z'xf Ten CAD 1933 SQ LL l4.XSKli'l'BA U I U January 21 Forex! 12-Hifortlz Dallas IQ 1 Forest showed very good basketball training by consistently playing for position under the goal. Forest completely routed North Dallas in the First half-the score being 8-6. The Northers played harder in the second half and Hickox, by placing three field goals, ran up a large score on Forest. The game was give and take from then until the end. Barnett's playing was outstanding. February 3 Forex! 7-Oak Clif 22 The first half ended 7-6 in favor of Forest. The boys could not get the ball into the iron hoop after that, but they did a lot of hard fighting for the Green and White. Five men, not the regulars, were interchanged during the last half. Walter Ewell played the best game of the Foresters. He made good in this game by his ex- cellent guarding. February 6 F ores! 12-Bryon II In a fast game, Forest and Bryan ran and fought neck and neck through the first half, and ended with a tied score. The second half was even faster and closer, the game ending in a tie. ln the extra period, Fink scored two points, thereby giving Forest the margin. just as the whistle blew, a Forest man committed a foul. Bryan received two free shots-enough to win or tie the game. . All was tense as the Bryan man threw and missed. Then again he threw and--missed. A Hood of noise broke loose and Forest won the game by one point! February I 3 ' F orenf 1 9-.Norllz Dollar 1 7 t Forest led the series by winning from the Bulldogs in another fast game. The score was 7 to 7 at the end of the Ist half, and IS to I5 at the end of the game. ln the extra tive minute period, Charlie Waldman shot a goal 20 seconds after play started, and then Abe Barnett cinched the game by looping another. just as the game ended, Miers of North Dallas scored two for the Bulldogs and made the score IQ to 17. February 24 Forest 11-Oak Clif I7 The City Championship automatically went to Bryan, because of conditions, when Forest lost the last game to Oak Cliff. Forest battled hard and was right in there all the time, but Oak Cliff emerged eventually with the IHOSt points. Forest led 8 to 7 at the end of the First half. Fouls were frequently committed by both sides-Oak Clillqs grand total being 13. The third period was the best exhibition of basketball ever played on Dallas courts this year. Forestls. players and student body deserve credit for the wonderful fight and spirit which they showed at this game. It was typical of Forestls standard. ci f 6 1 in Page One Hund rl Eleven U I 1 Team of 1925 J. C. BARNETT, Center, Captain J. C. has shown remarkable qualities as a basketball player. He has played hard all season and held position as captain in a way becoming to the most conservative. He has made good in his first year and he will play again in 1926. He made the All- City Team. CHARLIE WA1.IJklAN, Forward Charlie has tried hard for two years and this year he made the team and starred "to boot? He repeatedly emerged from games packing the high point honor for Forest. Charlie will be absent next year because he will graduate. VVALTER RYVELL, Guard "Hoss" did not know the difference between a basketball suit and B. V. D.'s when he came out for the team this year. But if you want to see a good guard and hard playing fellow who can give and take, and smile and fight all the harder when he is losing, take a good look at Walter before he graduates in June. He, also, made the All-City Team. R012 SIMPKINS, Center I Roe battled like a war-horse every time he was in "there," He played well and hard all season and handles himself well for his height. Roe will be back to show us some more real playing next year. OLIVER BRECHT, Forward Oliver was the pocket edition of an iron man on Forest's 1925 team. He al- ways played his best and fought hard and clean. He deserves the place he holds-a berth on Forest's basketball team. Oliver will receive his diploma in June ,25. I THAD WHITE, Forward Thad is the fastest player at Forest. He seems to be all over the court at one time. When a "clumsy,' would rush him, lIe would almost dribble under "it,' and side-step to his back as though he were not there. Thad will wear a green and white basketball uniform in 1926. WVatch for more speed then. HOYVARIJ FINK, Guard Howard was the shark of medium basket shooters. He had the gift of dropping 'em thru' the hoop from the side, center, or anywhere. This is Howard's first year on a Forest team. He is the brother of Frankie Fink, Texas and Mexico lightweight champion. ' ROBERT lVl12ITI1, Forward Bob showed plenty of real skill during the season and shows promise of becoming a future star. He is a good sport and does not ask odds which he will not give. A clean scrapper and a good fellow is what Bob has demonstrated in his first year on the Forest team. He has some more years, too. S. T. JONES, Forward V S. T. has played cleverly, and given a whole lot of lighting for the Green and White. He is very fast, and very agile. He will be back at Forest next year. Second Team of I 925 THE LION CUBS 1' A. M. Sanders Raleigh Brooks Mike Goldstein L. B. Lagow Rollin Burns Charles Shuey Allen Eakins Bert Hatzenbueler J. C. Reed Frank Parrino Henry Hodde Byron Black Lonnie Parks James Roots Marcus McLean Abe Berger Barney Solomon Debs Hayle Cll IU Page One Hundred Twelve l i ,r li lil 1.1 i . P i fi-7 Ji. YY,ifffQl.Q..Q.Q'flinf"., ,elif A fig- A' X , 3..........e.,......,...m..-..,,.m..,....:,. ,,,, ,.,,,,,WM,,,,,,L:,,:,M, .......,-.-1 , i U ji il r i E l li 5 i . Q 4 it . FI f l r ' lt 2 3 ' V lr ill ffl il ll fl UW l 1 P il ff'-3 0 5 H r. li 5 Q Dy J' H rl t ml if it l me Am li 2 Y! 7 I T F " 3 ll 1 i 1, y , i 1+ 3 f f Y 'i E l sf 1 ll l l fi ' 3 'lui S Josfwntonrfg. X Q5 f ui ' i P p Mimwiilfuljlli l Q i ill it ,I , li ff , it 1 i 'R+' l i V ai it ii .2 1, it The Season l The baseball prospects for Forest were very bright this year when the coming of i g spring revived interest in our national sport. In fact, the chances for a winning team i looked better than they had for some years. The fact that six experienced men from i last yearls squad answered the call made Mr. Loos and the entire student body very V optimistic over the outlook. Those men returning were ,lack Duckworth, catcher, ll ll lil C. Barnett, pitcher, John Cooper, hrst baseman, Oliver Brecht, third baseman, lf ' ll S. T. Jones, outfielder de luxe, and Jimmy Collins, outlielder. r W W At a meeting of these letter men, Oliver Brecht, a very capable and brainy in- Q fielder, was elected Captain. He at once showed a natural tendency toward leader- , ship, and soon had the complete confidence of his men. i Q l Mr. Loos, with beautiful weather favoring him, immediately put his squad into 'l If training and in a short space of time had a formidable team lined up, with .promising Q rookies lilling the vacancies in a very pleasing manner. ln the early practice games, , V the team showed nice form, especially in the lfnnis game which Forest won 3 to 2. i The most promising rookies in these early games were L. Cooper, VVillie Schlie- pake, Marcus lVIcLean and Travis Crabb, inlieldersg and Alfred Behren and lid Mc- Donald, out-Helders. With their help, Mr. Loos had material for a fine defensive team, and one quite above the ordinary on the offence. Z l 3 5 VVith the city series only days in the future, interest is becoming intense among li 55 supporters of the high school baseball. Never before have the four teams appeared il so evenly matched. The coaches, and other persons in a position to know, predict a bitter fight, the equal of which has never been seen in Dallas. We -are-wondering sg 53 at Forest, what the outcome will be. The Lions seem to have good pitching, which, ff working with a great in-field and out-field should more than counter-balance what they lack at bat. These facts, coupled with the never-dying determination to fight li to the end, make the school as a whole, optimistic over the prospects. The men are i experienced, and eager to fight. We believe they can and will win for Forest Hi. l s ' it i i Q 5 ELF- Slifer:-:e-1,.,..-..,. ,ifrm .,,.., ,... -YW -.1-Z Y Y- .. W 77,7 M777 ,in W ,. -CQ., . , Y DT. . E Lg-7IflIl1T.ZlTS..'T'fLZTl1'I1illlL.QQiQ ' Lllfffv' TTLTL'Zglgf1f...laa2ee--f,..-f -felifl JJ B Page One Hundred Thirteen ig f ii zz E gf ii ii is Qi is si 55 Q5 5? P? if if is ze if fi ggwwwmw Page One Hundred Fourteen I S CITY CHAMPION 925- BASEBALL SQUAD 1 3 5 i 5 3 z 4 i 5 5 3 2 U H- JU I adifvidaals OLIVER BRECHT, Captain Oliver is a third baseman of unusual ability. His fielding has improved a great deal over last year, and he is a dangerous batter. The team has, in him, a real leader. JOHN COOPER Johnnie is one of those first basemen one likes to seevplay around the initial sack. He is very dependable, both in the field and at bat. He is the best sacrifice man on the team. ' JACK DUCKWORTH Although Jack was not given much opportunity to work behind the bat last sea- son, he has showed up nicely this year. He is a hard worker, with lots of fight, and a good arm. J. C. BARNETT Dear old Abe, the mainstay of the team, is undoubtedly one of the outstanding stars of the city. As a pitcher, he has a fast delivery with a dazzling change of place, a line hook, and rare control. He also bears theburden of the attack, being clean-up man. He is a great player with a major league future. JIMMIE COLLINS Jimmie is one of the out-lielders from last yearls team. He has improved won- derfully over the past season, and has been one of the big surprises this year. He is fast, and has a good eye for judging Hy balls. He has also developed into a good relief pitcher. S. T. JONES S. T. Jones is the outstanding flychaser in the state. Never in the history Of For- est has such a wizard been seen. It is next to impossible to drive a ball over him. He is fast, a heavy-hitter, and is cool under fire. L. COOPER This young man is One of the rookies who made good this year. He plays second base in a really wonderful manner. TRAVIS CRABB Short stop was hotly contested this year. Crabb likely gets first call, for he is a classy fielder with lots of light. MARCUS MCLEAN Marcus is another new man who looks particularly good at short stop. He is a flashy fielder and a good batter. WILLIE SCHLIEPAKE Willie is the third rookie who fought for the short field job. He is a good fielder, and fits nicely into the teamys play. ED MCDONALD Big Ed is a capable Hy chaser, and covers a great deal of ground for a big boy, but his batting is what looks so promising. He swings a mighty bat from the left side of the plate, being of the slugging type. He is the only southpaw on the squad. ALFRED BEHRENS Alfred is another new man who showed up well. He is a fast out-Helder, and a fair batter. Mr. Loos has developed him into a reliable pitcher. He has a fast ball with a real zip, and a bewildering curve. He does relief work along with Collins. Cll C L lg Page One Hand ed Fz teen Page Om' I1ll7lLiI'6'fi Sixffwz 1925 IJ SQUA TRACK 1 l l s--..,-. f-N. , ., j L . 1. J 'i i ' ' it em M it ff? i ii il f , ix j -A' i 1 if 1 i . , 1 9 if , fr g s k X I T, i Xirifjl 1W,'f',fa , ' -I 'V Theirs I-emrnon 1 ll ,ll jf ' . . I . f lVlr. Yates, our coach, called nrst pract ce aoout the mddle it' of February. Onlv two lettermen were back, Henrv Puckett , . l , . 1 . xl and Thad VVh1te. At a meeting ol the team, Henry Puckett ' was elected Captain for 1 2'. , J 'li The team Went to Fort Worth and entered many events in W M the track meet held during the rodeo. Experience was gained ggi by most of the men for next year and on the whole they did 255' well. During daily workouts, many showed up as promising material. Henry Puckett, 1, a tvvo-letter man, besides running the quarter and the relay, does well in the half-mile, 1 1 1 the 220 yard dash, and the broad jump. Thad Wvhite, flashy sprinter who won a letter , i last year, has blossomed forth as a crack relay runner and also sticks by his old events, I W 5 I the 100 yard dash, the 220 yard dash, the high and low hurdles, and the javelin. 7 l i l Others who showed up well were Frank Estes, Raleigh Brooks, Carlo Messina, lx ' , Alec Fischback, Bancroft Biggs, L. B. Lagow, Robert Peek, William Simmons, Allen ' Black, and Clarence Burroughs in the sprints, Rollin Burns, W. A. Biggs, and Emil . T Kilgus in the mile and the 880 yard run. ln the 4.40, Puckett, VVhite, Messina, E Moore, and Estes ran Well. As Weight men, Messina, Lagow, Greene, and Estes are , excellent. Thad VVhite and Roe Simpkins throw the javelin, while Raleigh Brooks ' and Frank Estes toss the discus. Walter Smith, Raymond Gillham and Arthur Sulli- van take their places as high and low hurdlcrs. These three show up well in the pole l vault, and Smith and Sullivan are also good high jumpers. Moore does well in the 1 high jump. Puckett, Smith, Sullivan, Nlessina, and Burroughs are broad jumpers. I Sullivan, Smith, and Keenan are good in the hop-step-and-jump. ' March 26, the relay team went to Austin to take part in the Texas Relay Games. , 1 j They did well against strong competition. The team saw Osborne break his world's A I record high jump by leaping 6 feet 8 15f16 inches, Scholz ran in a special dash, and , Kinsey of Ohio, fastest hurdler in the world, ran the 120 yard high hurdles. xg ' l At II p. m. the team left for the Southwest Relay Carnival at Rice Institute, , ,I il, Houston, Texas. After a night on the train, the team won second place in the half- 1 mile relay, and Won the one-mile relay, defeating Cleburnels crack relay team of three if I' ii years, standing and experience, which had defeated Forest at Austin the day before. f T , i Only two events were open to high schools, Forest Winning second in one and Hrst 3 Q 1 7 in the other. The team saw Scholz, Osborne, and Kinsey at this meet also. Butler ix 1 lx College won three major events and was the star relay team of the two relay con- ferences in the college division. 1 E ji jf Much credit is due Coach Yates for the victory, due to his coaching and strategy 1 ti ,QQ in placing his men. The team will also enter the Dallas City Meet, Denton District Meet, State ' j Meet, and the S. M. U. Meet, and the relay team may enter the Oklahoma Relay l 35 Games. H il mr, ..,e M we F .M r ,Log Mm, W 23.1 23..- s me, ,,,, ,,e7,.,e---,E--..-.-e....,.--aH. Q , ,, - U ..-q,.,.- Page One Hundred Seventeen f. .- W W .., .mee...W,,,,Ms,M,,,.,,,,.,,..-M,,.-.-, , e...,e.e.-... ,. ..,, - .,.e. ,,,e..,..,,.,,,m,g.j is F' fs----A-if Y ' ' -'il 2.2, s, lid. U 1 U 'R F A l l i Individuals HENRY PUCKETT Puckett is the captain of the 'team and the individual star of the squad. He was a star ,half-back on.-the football squad and is a fine type of athlete. He is modest, hard- working, and the kind of- a player to delight a coach's heart. He was high point man injthe intra-mural meet an-d-will be hard to beat in the city meet. He runs the 4.40, 880, IOO, and 220,yard,dash and is a member of the "little wonder relay team," champions at the big field meet at Rice University. He has made an exceptionally good leader and has the respect and admiration of his team-mates. He is a coming sensationin track and will be back next year. M I RALPH DARNALL "Rudolph" is a hardworking, quiet track man who loves the game and trains hard. He has been a member of the squad for two years and has now come into his own. He has a very even and beautiful stride and is -exceedingly fast. He runs the dashes, but is best in the 440 yard dash, and the relay team. He is one of Puckettls team-mates on the crack relay team which is winning so many honors for Forest this year. Ralph is a January '26 graduate, and the X926 track team will miss him greatly. CARLO MESSINA "Zola', is surprisingly fast for a big man. He is a big powerful athlete and was a half-back on the football team. He has been out for track several seasons and has just Narmedf' He can jump, run the distance, and is no mean sprinter. He is an- other member of the crack relay team of Forest this year. He graduates in January '26, and his loss will be keenly felt. THAD WHITE Thad is Puckettis rival for individual honors on the squad. He is a small man, slight, but well built. His specialty is the dash and hurdles. He does the loo yard dash, the 220 yard dash, and the hurdle in record breaking time. He is almost as- sured of first place in the hurdle in the city meet. Aspirants for honors in the city meet will have to watch this quiet, unassuming youngster with the streaming hair and flying heels. He is also a member of the relay team composed of Puckett, White, Messina, and Darnall. He will be back next year and may lead the team as captain. The relay team is the only one which we can write up, as the others have not been in a meet and there is no way of estimating them. The Annual goes to press before the city meet and we cannot give a write-up of all of them. Some rookies who are showing up well are C. Barnett, Raleigh Brooks, Rollin Burns, Clarence Bur- roughs, W. A. Briggs, and Bancroft Biggs. 4 A kiwi--. t. H milf, ln Page Om' Hundred Eighteen , , tk, at lit JM M55 N sa t 1 1 , Q ,f F 1, ,,X,mxX.,,eJ,, fp I: i gllilllllllllllllllllll M llllllmllllllllllll I l . ll llp f f - ,wegl 2 ff Q e Theirs Lemmon l An unusually large number of boys came out for tennis this year, about twenty reporting. :Xs none oi' these were seasoned players, keen competition resulted. Har- old Dean won the school championship, xlames Roots was the runner-up, and Irvin Beren was third. Others who showed up well were Byron Sachs, Dimon Vratis, and Howard Fink. ln the eity tournament, Harold Dean lost the singles to Frank OlBannon of North Dallas in a hotly contested match, 6-3 and 7-5. James Roots and Irvin Beren lost the doubles to klimmie Quick and Bert Barr of Oak Cliff. Not so many girls came out, and of those who came out, all were very inexperi- enced. Bessie lX'lae YVoolbright won the championship and the right to represent Forest in the city seriesg she lost to Mary Zita Hale of Oak Clifl. Of the other girls, Thelma Galloway seemed to have a little the best form, so she and Bessie Mae played North Dallas in the nrst draw of the city tournament and won 6-4, 6-2. They played the winner of the Bryan-Oak Cliff mateh. Nliriam Nlargules, Willie Mabel Taylor, and lfyelyn Oppenheimer all played well. Page One Humifni Nindccn - 11- 1 ----M1--'- "- - 1:-:f::1:l1,...::'1Q 11 1 11 1 1 1 1 W 1 1 11111 ,1, 1,,,,,,,., M,-1N.1,.,,..1-1W.....1111....H..,.w11-M-J--3 ,T V H hir-1WY,TjW YY jr " 7 44. Y Y, , 9, ,W ,1a:,:,..H.-A11 -1.9.11- 1:1-..w -mm 1 1' ' 11 1 1 1 1 A 1 1 E 1 11 1 1 1 ' 1 3 '1 f 1 1 1 11 11 ' 1 1 11 1 1 1 1 N -1 1 i v1 1 1 '1 1 1 11 '1 1' 1 1' 1 1 1 ' 11 1' 1 1 '11 1 1 1 1 1 11 1 I 11 1 1 11 1- 11 ' 1 1 1 ' 1 1 1 11 1 1 11 1 1 1 1 '1 11 11 I 1 I1 1 1 ' 1 1 1 1 1 1 I 1 1 11 1 I ' 11 1 11 1 1 '1 1 1 '1 1 1 11 Q: 11 1 1 1 5 5? 111 1 1 1 1, 1 1 1E .E x 1 11 1 ' 1 1 51 1 1 E 1 1 1' 1 1 1 Q 11 1 1 ' 1 1 1 1 1 11 11 , 11 1 11 1 11 1, Yi 1 1 1' 1 1 1 1 1 2 a 11 1 k1'11 1 M A 1 1 11 11 1, 1 1 5 1 115 11 1 5 1 111 T 1 E11 1 V1 1 1 ' 1111 11 1 511 1 11 11 1 1 1: 1 11 11 1-11111--1111 ...W W--. ,1... 1, ,KVA ,,,,,d,, 11,.1 1,.. , 4 S:---1---v.1.----.,M-1. .1.1. 1 H., 1,1 ,,,, W w,.m1,,1.7, ,,,1 .fm .,... M 1,,.11A 1 ,K -,-..,,.,M,,,,wv F.: Q 1i ..g,.Q,-,..,,, ,,.,.,...,..,.,.. Wf,?:l'f"NiafIllff7f"ig '111 fQ1LLfLfIfff"f'lA'lQ'x "" Page One Hundred Twenty , W if E SS X , V X , NNW 1 A K l wwf 'snmfb X NX U My N W.-Kf3" " 5 ' ' , W Q H, A L W Qiyyfff QNX 1' 1 A If., ' J HW ku lx A g if K m i v fx ,V Q . oo o SL Jfgvlw wfsf, X11 , lvl.: HH' I fy 134 ,fyy 1 w , Q,- lxffh, :nM q nr1M N ' O 2' M y 411' ,H Q if f, 6 , W ' X" Wfv, gi- fwflgggfl: --f .l- Otwfbuacvf epartmenfs X. fjpvyf x highs rj V' ,, -5 - was I :W . .fw1"--1. -. ' av- 1-..-.: . --were , -ssfrX"r s . 2. ,If 4: . , ,H X N .6-K T. Q. h ef: ' K if is. The Dallas unit of the R. O. T. C. has just completed another very worthwhile year. Mtich credit is due to lVIa-ior Deschler Whiting, professor of military Science and Tactics in the Dallas High Schools. ln our own school, gratifying progress has been made toward thorough elliciencv in military work. As an example, we point with considerable pride to the achieve- ments of the crack company. Un October 24, 1924, the crack companies from a large number of North Texas schools met in competitive drill at Fair Park Stadium. While Forest did not win first place, a very creditable showing was made. The conduct of the cadets may well be remembered with pleasure and pride. ln the daily routine work, the department is to be praised for its elliciency and veteran-like procedure. The routine of duties is carried out faithfully by everyone, insuring attainment to worthwhile goals. The rifle team is made up of splendid boys who work faithfully for efliiciencj' in that department. The companies are well drilled and are really accomplishing a great deal. The battalion parade twice each week demonstrates the high quality of work being done. Two men are to be thanked for this high degree of success. lVlaAior R. li. Cole- man, commandant at Forest during the lirst semester, did much for the building up of the unit. Wle deeply regret that he was forced to leave, but are equally pleased that we were able to procure the services of Major H. F. Carrico, a man who has very ably carried on the work begun by Majcnr Coleman. VVe welcome him into our school, and feel assured that the position could not have been more ably filled. Page One Hfzndrcd Toenty one 3 Q qs. . L. .sw ,. i.,..-..,..i....,.......N....,..,-f......,........-..w..,:.......Q f.,..--..,.,.,........,.......,t,.,,. ..,......,,.t .t,....,,,..,,......,.N ,W ..- . -4:-r -2-Y -A i 2. , ,, , ., , ..,,,..--.-,... ,. ,Q ,,,-, .Y... .... ,g,,, M,,,,,,,.,i.,.,,,7,,, . ,..,,,..... , X ..,.fsx...-.,.--,...fb..-.,,,..,,:.:L,,,,,,,,.. MMW,,,AQM,m,,, 5,K,,,,.,,,,,,..,,,,,...,.,,,.,,,.,.........,.,.aW..e.m...m..:..f...-. .a,,.....,- .:.Q t..,a-.,..5 5, V ' 2 2 1 1 1 , . r Y- : rr - if 5? if Li: il '33 ii fx ii rf, U is get lf lil .lg 'll if ii 5 US Y ri rg 322 r 5 l lil gd Llri I' ili T' l ll? ll 3 if It ll li M if , ', i 1 rl '- il 1 g 1 i ,I ll 1: 1 YI , s ' xl, lr I MAJOR HOMER E. CARRICO it 41 i . , N, N . Major Homer E. Carrico was stationed at Forest in the absence of l Major Coleman, our commandant who was given a three months' leave of rx 3' absence. During the short time that he has been here, he has made some 21' changes, which have resulted in a marked improvement in morale and an in- crease in the eliiciency of the cadet corps. His hearty co-operation with proa 5 jects other than his own, his appeal to his oflicers to co-operate with him, and the thoroughness and tact with which he executes his plans, all mark him as an ideal military leader. His method of handling boys has won him the re- Q spect and support of the entire battaliong and his courtesy and graciousness g Z2 have won for him the admiration of the faculty and student body. Forest has li indeed felt the influence of his short stay, and all wish him unlimited suc' E cess in whatever school he may be stationed. 1 Ee il all ii , We Lic'-Tr:-v3.51 .7-'mpgs Kiz: Z ':Q"""""""N""":7:'TQ"'--"'e"-'1-TJ'Y-11iK?!e'371f-f:wr'-.ff.,...-, ,,., -- ,cm H, .:1xu,-a.,--,...-.....,,..,-,,.a ,,.., ,.,,. ,.,.,.,...a,.,,,.a...,...,,,-v,4f.p,,.:r, ,..,vY..,,,,.,,7,evA-apm:n.,.. ., ---f-- K ir "'ff ' --i' new Im---5Y-fW-mwmz.J.FamQ1lfQlflQfif,,,.Ql,,QmsWmawww-...mwsmmfq 1., .,ws.mam.mm,m..t,.,,,,....::.:,T.Q2,ffQ,,:.f,f,l1i sf. tfil-fillfl.fl1i2flfQffQ1Ifl211':Q"""m"'?"""w "H' 'm""ct"""U'Wr:"'-w"'- '"ae'M'""rc'-m"'c"'-'M-"NWc--'cm""K"+-r-ueewfeew-efwfu-an "' -f---15 I fi .,.....,,,mqxba,Qmwrmuwa:apmplw,,.,,,,,,2,gM,,,,,,,,,,,,,,n,N,,,,,,,,,,,w,,,,,,,A,umxvmmMn,S. Nmwm Page Ons Hun1ife'1l Twenty-MCU . f .N .,. ..,. --,....., -fi , i1 15... x 1 .1 t S ta jf Roster R. O.T. C. EDXY.-KRD IlIcIcs - - - - Senior Major RICIIAIIII WILKINS - - - ' ' ' ' ' - Junior MIlf0l' NI.-xjnk PIOIVIHR E. CARRICII, Crmlmnmfzzzzl B.-XNCROFT limos CIIAIILRS W,iI.ll3l,iN JAMES MCGIIAIII JOSICPH TAvI,IIIz L. VV. JONES AIIIHN WIARNPZIA CI.II-'FORD BAI.I,AuIu WII.LI.-X31 SIMMONS EUGENE I'iANII'I'1-LR JOHN IYIAXXYI-1I.I. Jon LERER - Fifzrf Lienfemzfzlf Semin! Li8IlfEIIlZlIf.V S ergennzfx - lfaflalion I - Hallalio n II Prmzvuxl llflarshal - Baliafion IV Range Ojicer Fifmrzuf OWCEI' Sergvrml Majvor Color Sergeant Cofor Sergeant Supply Sergeant Hatlafion Clerk Page One Hundred Twenty three If l l i i amp Dallas 'ln the summer of 1924, the fourth Camp Dallas marshalled some five hun- dred boys from over the state of Texas, gave them the treat of their lives, sent them home with a vivid remembrance of a month of beneficial enjoyment, and then passed into history as by far the most successful of all the summer camps. Like all public-spirited institution whose purpose concenters in the development of the Amer- ican youth, this camp has experienced a remarkable growth, and its success in the past is but heightened by the plans for an even more successful future. The benefits derived from Camp Dallas are both manifoldiand far-reaching. No phase of youth's development is omitted. From first call at 6:00 in the morning, until taps at foioo, he is constantly employed in some exercise or duty whose under- lying purpose tends ton healthful habits, both mental and physical, and character de- velopment. As soon as he steps from the train, he is under strict, yet kind military disciple, and there is none more conducive to a proper spirit toward authority or es- tablished law. He is under competent military officers, whose purpose to make the in- struction rnore interesting is futile because it is already vitally so. He forms friend- ships with boys and men of character and understanding-friendships that will not cease with the breaking of camp. He gains confidence in himself and his abilities, he learns to associate with others, to have complete control over mind and body, and in every way to strengthen and equip himself in the requirements of a well developed, successful young man. The pleasures are not less numerous. From the first night of creek-dumping and night-gown parades until the last sleepless night of camp breaking and tents, the very atmosphere holds an unresistable attraction, and the cadet experiences but few mo- ments that he would not joyfully live over again. Instructions in the machine gun, hand grenade, automatic rifle, gas bomb, and trench mortar, and the lecturers on their history, nomenclature, and use, are attended eagerly. Map-making, scouting, pa- troling, and out-post work, though productive of long marches and weary muscles, make a real appeal to the cadets, an appeal which is second only to the week of record firing on the rifle range. There is unrivalled sport and every cadet enjoys it fully. Forest, with a company of forty men-almost a hundred percent increase over the former year-under captain Edward Hicks, was well represented in camp. She won the track meet by a small margin from Oak Cliff, and Carlo Messina, a Forest Hi student, was high point man. Due to the inexperience of the Forest company, only one man qualified on the range, although the instruction received was of in- estimable value. All in all, Camp Dallas is the ideal logical vacation for every type of boy in school save one-the slacker. For money spent and value received, no better or more paying investment could be made than a membership in the 1925 Camp Dallas. l.',, Y 1 ll: Us sum, lim Page One Hundred Twenty-four The Band 'l'he Band of Forest Avenue High School was organized in 1922, with only a few members, under the direction of Mr. Moore. lts membership has increased year by year until there are now thirty-two members. This organization has become one of the most prominent and attractive features of school life, both to the members who proht by the daily rehearsals, and to the entire school. Walter liwell, with the aid of Truett Alones, has erliciently lead the Band at all military parades and at many football and basketball games. We may attribute the unusual progress made by the Band this year to its carefully planned program. The Band practices every day at the seventh period under the able direction of Mr, Herzog. Thursday evening, and two mornings of every week between eight and eight forty-hire, are devoted to ensemble practice. At one assembly the Band gave a delightful program, which displayed hard and faithful work on the part of its mem- bers. The Band furnished the music lor l'The Man of the Houru given April 3, 1925. Messages were received from dillerent parts of the United States and Canada complimenting the Band on its excellent programs broadcasted from Whi-XA. Much interest has been aroused over the Band contest to be held in Corsicana, April 20, IQZ5, in which Forest is competing. The Forest Avenue High School Band is striving to be the best High School Band in the state, and lroin all indications, in a short time it will certainly hold first place. john Strange Cecil Worley Harold Clem Frank Crow Cecil Floyd Yale Griffis MEMBERS OF THIC BAND Eugene Smith Francis Peeler Sylvan Garonzik Robert lVlullin Bob Harper Pembrook Davenport Frank Parrino Clarence Burroughs Walter Ewell Richard Baldry Marcus Gendel Lawrence Cook John Fawcett Francis Goodman Paul Harris Charles jones Clarence Payne Clarence Elrod Olan Reed james Hiett Arthur Sullivan Donald Phares Truett Jones Paul Dillard Gilbert Carter john Brown Page One Ilufziilfrf Twenty ve s I 1 452 H! WWFPU 1 Page' One I1Il7I1i7't'Lf Tfc'm1.fy-fix A N Y A In COM El g I ROBERT BURNS PVERRE FONTAINE SIGRIUND SEGALL EDGAR iiUCKABY MARCUS MCLFAN Captain Robert Burns First Lieatenanls Pierre Fontaine Marcus lWcLean Second Lieutenanix Robert Webster Edgar Huckaby Sigmund Segall Firxt Sergeant George Curtis Conwy f' Sergeant: Fred Poston Allen Black William Thomas Foy Burke Corporal: Roy Lamb V Max Einhorn Wendell Sorensen Joe Murray Price McCarty Robert Burton Sol Minzer George Finley Privalex Morris Cohen Mike Cohen Issie Frauman Curtis Bond Jarrell Garonzik Isadore Green Frank Levene J. M. Moncrief J. R. Story Carlos Kruegel I I Page One Hundred Twenty seven Page On ll! Z' X If 55 m A YT s iiiwille if e Humfrfwl' Tfwnfy-right CON PANY B ff U.: i 1 C K-fx' 4' JIH CHARLES SHUEY ' JAKE FAIR , 'V 4 qw 'll' ANCY NDSEY OLIVER RAYNEP. ' f CCA 7 Company T3 Captain Oliver Fudge Paul Harwood Oliver Rayner First Lieutenant Charles Shuey Second Lieulenanix Zedrick Moore Jake Fair Yancy Lindsey First Sergeant J. W. Graul Sergeanl: LeeRoy Branch Joe Corman Billie Dillon Hugh Dodd Max Enkowitz Maurice Kay George Anderson Joe Collmer Weldon Turner Elmo Green Corporal: Leonidas Burney Robert King Dale Lindsay Frank Russell Williams Keith Harold Reynolds Clyde Norman Privates Adrian Baker Theodore Barth Leslie Caldwell Cameron Carroll Albert Cassell Leon Cohen Jean Day Elmer Davis G. C. Douglas George Dennis R. J. Fowler Thomas Franklin Abe Fox Edgar Els Nicholas Grissaiii John Holeman Hubert Heiner Jack Hamilton Tom Henderson Joseph Horton Loyd Hicks Fred Hester Howard Johnson Lee Littlepage Iuda Levi Clifford Main Kemp Moore Alex Mandel Robert McGrady William Mann Morris Mosesman Joe Meador Frank Pizzaro Gardner Parker Ullman Rosenfield L. D. Riley J. C. Sullivan Eugene Simpson Max Starks Jack Shirley Jack Shell Joe Terranella Tom Wood Earl Wills Howard Watson Samuel Yonack Israel Zeitman Frank Green Homer Forshee Ralph Langdon Olan Shipp Edward Haehl Norval Hexamer J + - L.: Cl . A Q C J S LQ Page One Hundred Twenly mne Hi ll li lil-3 -'13 2 Ima Q pil '1 Ll ,.. Pagr Om' Illzmfraui Thirly C NI PANY CO P4 IU l L. B. LAGOW CARLo Mzcssm.-x W. A. BIGGS LEONARD ARC!-ue STANLEY WILLLS 7 Company MC ' Captain Fred Bethurum Willie Ivy L. B. Lagow Alfred Isaacs Ira Fooshee Buell Piper Neiman Gendel First Lieutenant: Raymond Gillham Kerlin Bragdcn Leonard Arche J. R. Benton Carlo Messina Corporalr R. D. McNeil W. B. Wilson Howard Jones Second Lieulenanzs Edwin Wood Godcheaux'Levi W. A. Biggs Leonard ,Lipman Debs Hayle Stanley Wilkes Teddy Lipman Jack Morris Robert Ragsdale Sol Rosenbloom First Sergeanz Howard Fink Paul Mertins Henry Lyle Morris Chertkov Privates Barney Simon Sergeanls Howard Miller Hershal Heisiger Alex Singleton Winston Wilson George Wassell Henry von Pein Kermit Knight Walton Rhodes John Van Slyke Edward Goff Fred Garner Neid McGown John Smith Robert Vasek Harold Riddell Earl Jones Jesse Bodiford L Page One Hundred Tlnrly one Pagf One Hundred Thirty-two .gk www 0,3 71 W Q W Q Lf ...IM , fl.,!7" ig: Ti KN' gifilfx " v W ., . ,NZ A Q X KK ,R X N5 1195 1 -g . K ,,,N.., 2' OMPANY D 1 c FJ.: JU FRANK ESTES CHARLES NE1sLAR EMIL KILGUS RoBER'r WEBSTER Captain Frank Estes Lieutenanls Emil Kilgus Charles Ncislar Scrgcanls Leon Dozicr Abc Berger Lonnie Parks jack Saunders Alex McKnight Louis Moskowitz Corporal: Carl Bennett Bernard Meyers Clyde Dickard Marvin Ford Nciland Loyd Company WIT' Sylvan Stone Paul Bolyn . Privates Otto Newland Reeder Holiman Harold Herman Clemie Klein George Ballou joe Berger Haskell Bcvers Emil Bilger Doris Boyer Henry Bromberg George Brodnax Odys Castillow jack Collins Johnnie Collins Clyde Hooke Frank Cosnahan Clark Chrisman Leonard Dunagan Neal Gagliardo Jim Hall Louis Hamilton Max Harbison Sherman Johnston Otto Jones Kenneth Langran joseph Lenzen Sam Malcolm George Martin Grayden Moore Daniel Rosenbaum Raoul Rosenthal Stanley Spencer Claude Smith Niels Sorensen Roe Simkins John Sticksel George Ccarlcy L. Page One Hundred Tlufty ilu-ee Page One Hzmrircri Thirly-four I-1 .XXX ONII' Q, EJ ll-1 WILLIE SCHLIEPAKE XVXLLIAM SINGLETON JOHN WARNER CCE77 Compcm M I Capmin Privates Edgar Marder William Singleton Firm' Licufcmmt Willie Schliepake Firsl Sergeant J. B. Stark SUI'gFH7lfS Joe Lagow Seymour Margules Richard Watts Byron Sachs ' Lawrence Cook Louis Foreman Idell Tennison Corporals ' Morris Willis William McDaniel Nathan Corman Donald Ennis Sam Bock Milton Abramson Dc Witt Davis Bernard Sampson Louis Arche Albert Green Roy Castillow Gus Levene Hugh Sticksel Edward Brisendine Ncilon Womack Harold Elfenbcin Arthur Bumpas D Sherman Kaplan Jack Robertson Clarence Teasley Ellwood Barrett Herman King Woody DeFace Eugene Woodside Percy Baron Frank Felton Curtis Kelley Laurin Blaydes Leslie Mitchell Everett Warner Gail Lane Kemper Zercher Ernest Switzler Samuel Frankenstein Sel Levine Rufus Pribble William Egan ' Wesley Everhart Henry Nelson Homer Miller r Simpson Martindale Archie McNeill David Lefkowitz Roy Justus Travis Newton Louis Ravkind Neal Stevenson Murray Sharp , Oscar Utay- Herschel Jaffe , U ' ci Page One Hundred Thirty J? ff I W J 5 to 14h 'X kk X -1.65 E ' d f Dt gi T ' tt . .ewan au A 5 In up JY' ,t . ,W , i Jn O, Heavenly Art, hovv oft in lifels dark hour, l When faint with heaxy heart and gloomy care, Hast thou revt-aletl thy soothing charm and power And drawn me forth into a vvorltl more fair R For this I give thanks, O art divine, I give thee thanks. SCllOlll'fR. Room 16, harmony, melody, and good timesl VVhat student in the Forest High music classes this year but will always look back upon the hours spent there with feelings of genuine pleasure and profit? livery class, though dillierent in the subject matter taught, is alike in enjoying a period of good fellowship and actual profit. In every class, the major part of the course consists of learning a large number of beautiful songs, but each course contains certain other very definite facts and rules about music which must be learned along with the music itself. Beginning in the freshman year, scales, chords, time values, rapid sight reading, and music appreciation are studied for two years. After this course has been completed, Music "5" and "6" are offered to the upper classmen. This is an advanced course in the history of music which receives full junior or senior credit for graduation and is accepted for one en- trance credit at the universities. lt deals with the development of music from most primitive stages to our own time. The evolution of various instruments, the devel- opment and present meaning of musical forms and terms, the lives of the great com- posers, and, above all, the music of the great masters are here studied. ln almost every assembly or entertainment of any kind held in the school, the management has looked to the music department for help. The Armistice Day program, Thanksgiving, Christmas, the Flower Show, Dallas Open Forum, Parent- Teachers, Association, Cross VVord PuZZlc Contest, Commencement, and several plays and picture shows are among the special occasions when the music students have had a part. The music students also gave a musical assembly and two radio programs broadcasted from VVFAA. ln the spring term, they plan to give a concert compli- mentary to the parents and friends of the school. Perhaps in no other subject in school are individual talent and ambition given more opportunity to develop or so closely linked with team work as in musicg and this year the music students have co-operated as nexer before. Always ready to per- form individually when called upon to do so, they have also shown a line erjrrif Me corju which is very gratifying. Iagt Om Hzultfrril 7'hirly-.tix U.: S L F. 1 . H. S. Orchestra One of the most interesting and important features of the music department, and of the entire school, is our orchestra. Starting about five years ago with a few vidlins and cornets, this organization has grown in size, variety of instruments, and musical skill, to a point where the entire school may well be proud of them. 'They furnish the music for all school functions either as an entire body, in selected groups, or as soloists, and they are an important factor in the musical life of Dallas, for they are frequently called upon to play for functions down town, or in our own south Dallas community. ' Mr. George A. Lake, Hgrandfatherl' of Forest High, offered a prize tothe high- est ranking boy and girl in the orchestra at mid-year. The following seven points were consideredby Miss Wilcox in deciding upon the winner for these honors: Q11 ability as a player, Q25 attendance at class every day, fgj attendance at every W concert or public appearance of the orchestra, Q4.j co-operation in class, Q55 improve- ment as a performer. John Strange, having a high grade as a musician and being IOO Z7 on class and concert attendance, won the boys' prize with a total of 96. Pearl Smith, a new player on the clarinet, won the girls' prize. Her grade was 92, and this, together with her remarkable improvement as a player, and IOOZJ score for attend- ance made her the winner among the girls. Personnel of the F. A. H. S. Orchestra l 1st Violin: 1 Iras Fine Robert Mullin Sarah Abramowitz Maydell Brown Ernest Seitzler Ruth Walker Bertha Fay Brown Hubbard Cook Helen Clifford French Horn Lula King Hussey Frances Hill Clarence Burroughs Bernice Parker May Martin ' Zelman Brounoff Mary Alice Craddock Alla Frank McCammon Alfred Bloom Frances Peeler 'S Herschel Martin Rosalyn Goldsmith C Melody Saxophone Trombone: Mary Perkins Charles Henry Kelley Truett Jones Eli Shapiro Clifford Ohlson Cecil Floyd Clifford Ohlson W Lois Charninsky E Flat Saxophone Drums Emmett McClain Charles Cave Charles Jones Ruth Combs Flute , Louise Johnson Linda King Piano , Maxine Maxey 1 ll I 2nd Violin: Trumpets Reva Shapiro Pauline Agnew John Strange Cecile Charninsky " Frank Crow V 4' c D . e - a .Lu Page One Hundred Thirty-seven Page One Ilunflrani Thirzy-aighz ORCHESTRA 3. l we-'L S, if , f , C 3 -wi. t..,T21'-if Z i . 5, 'lihe physical training department has made ex- ceptional progress this year under the direction of Nliss Shaw, the instructor. 'llhe department has enrolled a larger number of regular pupils this year than in the preceding three years. The girls are very enthusiastic about the gymnasium work under way at this time of the year, and they evinee a keen interest in the new method of grading that has talien place this year. A Contest for the winning of points, based upon the six weeks scholarship and attendance is Watched closely. The student gaining the greatest number of points will be the winner ol' the prize offered by the physical education department, a silver loving cup. Among the year's activities were an inter-class volley ball tournament and series, won by two classes-the tiormer by the l.-Ys and the latter by the ll3's. Tactics, formal and corrective exercise, the interesting tallcs and personal atten- tion given to hygiene, and stunts directed by athletic captains, whose business it is to arouse and stimulate interest in this line ol' work. Rope climbing and bar exercise, volley ball, basket ball, lawn and indoor tennis, drills and dances formed a varied program. The dances include athletic dances, the interesting character dances, clog, the important national dances, and the beautiful tiollt dances. ln the spring ot' each year, the gymnasium classes present a public pageant to dis- play their knowledge of gymnasium work. Physical education in its Various forms helps to develop the valuable qualities of team work, fair play, generosity, courage, initiative, and judgment, and promotes health and hygiene--in short, general physical and moral welfare. The girls organ- ize and manage their teams and squads. The department furnishes the defenders of the green and white with volley hall teams and also strong class and school baseball TCLIIHS. Page One Ilundrsd Thzrly 111112 'H VOLLEY BA l,L '1'IC.fXNl Pagz' Om' 111l7Z11I'1,'tl Forfy BASEBALL TEAM DUMB-BELL DRILL A'I'HLE'1'IC PAGEANT DAN C15 Page Om' Ilf411.'f1'wf Fariy-one WAND DRILL Page One Hundred Forty-Iwo INDIAN CLUBS E W J W 1 3 5 E W 2 ? W W 3 W 2 W W W W W W W W W W W W W E W 3 1 Z W W W 5 W i 5 W z 2 5 W W W W I I . W W W I W Z P W 5 W W 3 5 W W I W I 5 1 W W W ...W. N.: hm... WL E W ,..Q.-,,,.........:f-.W ----1--Ti W -ff,,,.....,-,,, , W, W ,H Af- W H if Y ' 'W' Y M5454 'W gp W, W W W Y-, W, W. Y W. T, rg W W Y N W ,A.... W ' W W W W ' W W W W W W W W 1 W W WW W WW ' W W W 'I W W W ' W W 3 W W A W W W W W W W 'W W W W W W W .W W W W W WW ' W W W ,J W W W W I I W W W - W W . W WI W W W W W ' W W W W WW W W WW W WW WW L WW , W W 1 I' ' W W W . W W W W W , W4 W, W 'W WW IW W WW W' 'W WW 1 W W 2 W W W W W W W ' WW " W W W W WW W W WW W W! ix IW -W W 'W W' W' ,W E WW WW WW 'N W W W W' 5' WW W W' W WW W . W W WW W We WW W WW ' W WV W, W W ,W W W W W WW.WW.,-WW,.,...,,, WW W W WWWWW WW ,WWW W WA M WWW W ,Q WSW 7 ---A-H -4----W.-.-,,.-,..W--..-W,....w-. - Af-e,,a,W....,.-.-....,.,,,,,Y, ,W , W, ........W.. ,, , . ,W ,,,W..W. ,-A ,,.-.W.. ..6. OJ i,,.W. .h.W-.W..,,,..m.. ,W . , ,. W , ., . . .. , A .. . W :Wi WWW W 'VW if -. M,,,.WQW- Wu. LM. MHZ W..W W ""A'.fW1,.,,-W-Wl,.--N-lQ,Q.l-,W ,QU--TLA.Q-3Ql1x,-Q1-.,,,.-Q-f-at-19,----JW -QW Page One Hundred Forty-I hree EEOWSE Horne' Ecwmmiffr elppliezi To Life The purpose of home economics is to improve the home standards through applying the principles of art and design to the hottie problems. Since the home is the center of all social groups, hottie economics will, more or less, play a part of fundamental importance in establishing community ideals as well as home ideals. ln a way, the statement that education will progress only so fast as education in home economics develops, is true, for progress as a nation depends on home standards. We are emerging from the view that home economics is a subject dealing only with sewing and cooking, and are coming to realize that these courses are of import- ance in solving some of our larger educational problems. lt is strange that we have waited so long to realize the value of giving training through the channel of greatest interest or experience, the home. lfducation trains one to express one's self. No- where may a girl express herself more artistically and usefully than in the work in home economics. Nowhere is science more busy than with the problems of con- serving health and human life. .Xlmost daily, something new is added to that body of scientific facts which make the study of food and nutrition, of sanitation and hy- giene, of tremendous importance, as well as of vital interest. Home economics is the meeting place of the sciences and arts. It is the medium of carrying into the home science and art, and thereby establishing high standards of living. This will create a healthful demand for everything that makes this world a better place to live in. YVhen any vigorous force is untrained, society is eopardixed, when guided, it lays a foundation stone for social P1'Og'I'CSS. Page One Hundred Farly-four I -- use gf,-f, , ... - ,AL -,gs-ll:-551 .1 .N . . , -J ,.,N ,,,': EQ ' 'va' Pl"V'lfiai,'i1,"r ' ,ff 1 f ft . if Fl. 'T . '- t M f Q eytstffedf-s ag . 4, , , 1'!'fX'l,-," M13 IV' -4 fl- 021.1 . if-mrHAf' J , . 1 S . fm, 1 Oti5CdDozner' 'Tap .f 3- ' --24- ' --i -A Q ' ' JH Depcz rtmmt Someone has said that the modern high school is a veritable little city and, if called upon, is absolutely surhcient within itself to carry on its work, it has in its organization the resources for its functioning. This is true of Forest Avenue High School. When Forest wants something, she usually has to go no farther than her own domain to get it. Perhaps the most evident proof of this statement is embodied in the art department, which not only serves its purpose in offering a certain course of instruction, but furnishes advertising matter for the entire school. Forest would very probably feel the loss of her art department far more keenly than that of any other. To whom would we turn for all the posters advertising our various plays, entertainments, games, activities of all kinds, to whom would we turn for the art work in our publications? The practical work of the art department in supplying the school with illustration work can hardly be realized or adequately appreciated. Miss Rettie K. Fnsor, in charge of the department this year, declares that the results have been very successful. An exhibit of the art vvork of her classes proved a most interesting feature of the yearls schedule. One of the greatest debts that the school as a whole owes to the department is that it has served to train two of the most valuable students in Forest Avenue High School. Thetis Lemmon, Joseph Nlalone, and Otis Dozier, whose talented wielding of brush and crayon has saved the school hundreds of dollars yearly, besides making a name for us in high school art work all over the state, through the medium of our school publications. Their contribution to the school, during the years they have been students in Forest Avenue High School can not be praised too highly. They have given willingly and unstintedly their time, energy, and talent, without any hope of reward save the joy that comes from generous giving. The excellent quality of their work sounds their praises more loudly and eloquently than any words could possibly speak. VVe want them to know how sincerely we appreciate their labor, how very greatly We will feel their loss, and how earnestly we wish their success in what- ever line of endeavor they enter. The climax of the entire year in the art department is the art work in the annual, for that represents the high water mark of local talent, the best efforts of the hest artists. The art work in this year's annual is of especially high quality and achieves the double effect of beauty and significance. The story of Robin llood and his "merry m,-nn in th ir lite unler the Greenvvootl tree, the fascinating foresters clad in their suits of forest green, offers a most appropriate theme for the I925 annual of Forest Avenue High School, our own school of the green and white. Throughout the entire book, this charming idea is artistically portrayed. Scenes connected with the story of the old classic ballad are represented on the insert pages that introduce the various depart- ments. The theme is most appropriate, ertective, and well presented, and is a monumental example of the work that is accomplished on the easels in the art department. Page One Hundred Forly of Closing Word What shall we say of the work in Forest Avenue High School for the year now coming to Il close? That is a difficult question to answer, because there are so many high spots in the life of our large school family during the session of 1924-25. I mention only two or three matters. Among the matters of first moment, I unhesitatingly name the beautiful spirit of co- operation in our faculty. Not only are our teachers ever mindful of their obligations to one another, but they guard well their influence among the pupils. On one occasion this year, a visitor invited one of our men to smoke with him at the corner drug store, where- upon this teacher informed the visitor that our men prize their influence too highly to smoke in sight of Forest on a school day, or in the presence of pupils wherever they may be as- sembled to engage in school activities. That is the spirit which makes our school what it is. Pupil co-operation has advanced to greater heights this year. An incident in the life of the school will illustrate: On the third day of school last fall, after two days had been spent in enrolling the school, our school family tested the new schedule of classes for the first time. There were several hundred new pupils in Forest who were to learn their duties and responsibilities to the school. With not a suggestion from principal or teacher, the pupil guards were found on duty everywhere-they were posted on all sides of the yard, they guarded the lockers in all parts of the building, they supervised the lunch lines, and they took charge of the lunch room as they have been doing every day of this session. It is this beautiful spirit of voluntary co-operation on the part of pupils which makes Forest the best high school in the land. The progressive and the aggressive spirit of our school family has been advanced to greater heights in all fields of endeavor. Our football team came from behind at the beginning of the season of 1924. and proved' to be the most formidable eleven in this city or State. So perfectly was the spirit of determination and fight aroused in the team and the entire school that the l-oys played as one man, and they were unbeatable. This same spirit has been in evidence in all school activities throughout the year. It was this spirit which possessed our relay team who, although they were beaten by Cleburne in Austin on March 27, went to Houston March 28 and administered defeat to the same team. With such a spirit as this in evidence everywhere, Forest calmly faces the future with grim de- termination to add luster to every page of what is to be her brilliant record. Your principal, who loves every member of our large school family with all his heart, leaves three challenges to the boys and girls of Forest: fl, Be intelligent citizens. I charge you to understand all the responsibilities of citizenship, and be prepared to meet every obligation. Be sound in thought and l'l"'lll in rction. You are urged to be ri'zlt on the fundamentals of life, to be right in the sight of both God and man. Be informed citizens. Our school will not go far wrong as long as each member possesses the curious mind, the inquiring nature, the pioneering disposition, the scientific attitude, as long as each one respects knowledge, is eager in the pursuit of knowledge, and is skillful in the use of knowledge. C32 Be good citizens, remembering that it is more important to live than to make a living. This means that in times of adversity, do you maintain an attitude of courage. selfrcontrol, and poise? Are you compassionate, gentle, kind, and thoughtful to animals? Are you obedient, respectful, and co-operative toward authority? Do you love, revere, and respect the church? Are you fair, forgiving, and sportsmanlike toward enemies? Is your attitude toward friends and social groups that of devotion, fidelity, and sympathy? Do you live a life of helpfulness, tenderness, and politeness toward home and family? Are you adaptable, neat, punctual, and studious in school? Do you maintain an attitude of cheerfulness, fairness, unselfishness, and self-control towards sports and pastimes? Is your life one of economy, thrift, service, and consecration? Do you love work, and are you faithful, efficient, joyful, and practical in all your work? It requires one of a good heart to subscribe properly to these qualifications. In all such heart matters, I trust that every boy and girl and young man and young woman in Forest will live true to these principles. Let us hang together and pull together to make Forest bigger and better in every way. WYLIE A. PARKER, Principal. U . I Page One Hundred Forty-six XX A - K' xv ' W h' ' ' T5 wf , w ww MU ,, 6310 K, 'Hmmm f 2 Mx Xi S E E gi ls! M M, 'Yixx fL:-L ' M W V YY OLfsADozierfY Sherwood Ur T L iff I 1, I U I 'V 1 I I I i l ll 7 li gr 'L X , I I UI I ' ,ei V A ' I I ' , 1, I The Tear m yme r Q I I r "A ' t dal, ' A 'f I I S f- fWords by Beatrice Blakeneyj XM "Nl Msg I 3 . 'HE' 1 -1 3 If fe . SEPTEMBER 9. 5 l -Jimi-.-T im "Letls go!" they cried in accents deep W ' I - Fe " - , 1: .. -A-fl' When September fifteenth was nigh, 5 " iff- Plas I "Letls fall right in and we will win I ' I - Here we come Forest High!" 1 il l OCTOBER N , I I 5 On October twenty-fourth the school was quiet and l ' still 5 w W For our report cards were ready at last. When I think of those grades my face turns three ,ig W? I shades e. I gl I And my heart beats slowly-then fast. l . 1 fl i Maw 'Ulf I I ,U NOVEMBER .-. t i N IW n m whoop! Bam! Rah! Rah! Rah! g -l I V lx X What's started? Football season of course. "' il xl 1 ' Scream we Will and fight and kill, I l ' ii And yell 'till we are hoarse. ' i DECEMBER v y Christmas Holidays were welcome to all, , 'D For they gained a great round of applause. Q g 5 I ' I I During that time our joy was sublime, fi T N For our dreams were of Santa Claus. -4' y I JANUARY 1 ----gif ts ' P'4 I ll This month brought exams which were final 4 K Q I , ll And the semester closed with a bang. 5, I 1 W The Seniors said goodbye and they made us all cry ' l 'W . 9 nm With the farewell song that they sang. l l I 1.i:a1aN5lB,,L0,,.,.. . g 5 '1 vi FEBRUARY I if With many a shout and many a yell 3 1 -:- Basketball season came in like the wind. 1 l i Twas a month of joy to each girl and boy, , ! And we hope it comes back soon again. Iii N 5 ' 5 MARCH-APRIL ull W1 MQ THE BQY ORATOR These two months brought debaters to Forest High - F' im 7 K And they surely did their best. ,"T?!f:1 'gi H f Us Though things came galore I must write no more NIGHT BUORE THE-HNALL W V For I cannot tell you the rest. , W lr I I l si li ii l " gi MAY-JUNE l if Final exams were over in Ma :I 6,1 I y 1, rl it V ly We left on the ifth of June 3 YQ Some were glad to leave, but you just believe If I That I think it was over too soon. ,1 , mmmmanmmmnwmmzmrmmmznummmm E I ' I: mm W. .ft ... mm ., I V ll Q crvli To LSL 4 5 I I er mtg E by li f . S '. fvlv , , ' H , F l X3 M , I X We as N' M f I aa I I I " , if X lllllbllnlh I 4 mmm Q Q. . g ,, T' X yn G -- nmuigh' X SDM 4 ww if ,E E I l , ,. . Z mm Y I ' moo gg il ,- .1 2 f ,. 'vw mm, , F mdlllllb 5- rr. it Ut ff fl is ll ' ll 'A I ' 1'1M1m- ll' my ,l 12 I FOREST mmrtsrto wma 6-ei Rri A I1 gl vi, F I GOLF BUGS 1: Ya- JUNE 50- 3 il I I I lb l li il 1' jf. , . -fa .c .,a.c,.o,,t- .,.. ,.s..,...,,,,, ,,,, m,..,-e t,Y. -. E, .,..,d,.,..f,m -,,,.,..,,-.m,,,,..m.,... ,.., -.-,,m..,.Ws . O or Page One Hundred Forly-seven MOST POPULAR BOY :ev 4 E", 1' . ng K , 2+ fy tx f K . - ,,. . Q Sw f .V '. , 4' r 5 4 2 p5'X 1 1, , A .V ,. ga. E Q iff X +- v :sa f. tggghggw f ,Lg " X , A f , , .K 2 r, s V fl, ,,af ,,',-5' eng z rv. . . xx 1 bf-, .ff fffi . f Q X 1 X Lu Qs: 1 ' I ' 4: , K S ' K S I YF'm22U1N OST POPULAR GIRL Dir e 1 D ,4Y, CCGrinS77 I f you cau'l laugh at these joker 0 f the age, jurt laugh at the age 0 f there joker. WHO'S WHO IN THE IVA CLASS Our President: Gerald McNabb. Our Married Man: Dee Burch. Best Dressed Boy: Chad Stark. Most Beautiful: Vida Rhodes Cutest: Ruby Ware. Best Dancer: Katherine Stephenson. Sweetest: Ruth Reynolds. Peppiest: Henry Adams. Most Intelligent: Frank Autry. Wittiest: Evelyn Oppenheimer. Best All Around Sport: Walter Ewell. Foolish: Daniel Rosenbaum. Modest: James Lee. Ladies' Man: Harold Dean. Smallest Feet: Richard Wilkins. Modest: Dotty Fowler. Cutest Blonde: Lula King Hussey. Best Lover: Most Conceited: Fred Star. Poet: Frank Daudelin. Most Artistic: Otis Dozier. Self-Conscious: Emil Kilgus. Our Editor-in-Chief: Neel Warxield. Most Bashful: Richard Dathe. Most Handsome: Rex Pyron. Prettiest Boy: Ben Wathen. Sappiest: Hugh Moore. Most Accommodating: Charles Neislar. K- 'K' 'K' The most pathetic figure we can think of is the man who choked to death on a life-saver. -Stevens Tech Stone Mill. di il- 'll- Catherine L.: 'tllve decided to give up stenog- raphy.', Doris A.: UNO! Whyil' C. L.: "I can't bear to have any man dictate to me." I 46 -X' 'le A girl never has her nose buried so deeply in her books but what she can't get at it with a powder puff. -Southern California Wampus. 'lf' AX' 'K' Your eyes are shining, dearest, Your eyes of azure blue, But, Darling, I canlt fall for you- Your nose is shining too! -Penn Slale Froth. l -bf st- as "This is what I ct a kick out of," said old g . man Jones, when he espicd his daughter, Jacque- lyn, on the front steps with a young man. It has been charged that modern youth has made no contribution to science. We offer the follow- ing amazing anatomical discoveries by way of re- futing the charge: A The snake's hips. The mosquito's eyebrow. The whale's wrist. The bee's knee. The chigger's ankle. The gnat's elbow. 4 'X' 4' H' AT A MASQUERADE DANCE Kathleen F.: "When you asked me for that dance I took you for Byron: when you held me so tight I thought you were Alexg and when you kissed me I could have sworn it was Harold: but when you stepped on my foot I knew very well it was you, Frank." 'X' 4 'll' Charles N.: "What do you think of the twelve-mile limit?l' Lillian G.: "Well, they never called me nar- row-minded, but you've got to stop somewhere." '15 'X' '19 Hugh M.: "Do you think all women are talk- ative?" . Alma L. H.: "Well, yes-generally speak- ing." il' 59 'XI' Ruby A.: "How many fools are there on earthil' Robert B: just one more than you think there are." 'll' -7? ir Edith G.: "That tie is too loud." Oliver R.: "Oh, well, I'll put on a muffler!" 4? 'X' '55 ODD ISN'T IT? A match has a head and no face. A watch has a face and no head. A river has a mouth and no tongue. A wagon has a tongue and no mouth. An umbrella has ribs but no trunk. A tree has a trunk but no ribs. A clock has hands but no arms. The sea has arms but no hands. A rooster has a comb but no hair. A rabbit has hair but no comb. Odd isn't it? if if 95 Pierre: "I want you to come to the 4A dance with mef' I Juanita P.: "Thanks. Is it formal, or shall I wear my own clothes." mf' IU Page One Hundred Fifty . I l A negro came before the judge To plead his case one day, For he was charged with speeding, His fine he wished to pay. The judge was taken in surprise, The negro was proud, "That his Ford was going sixty miles." He raised his voice so loud. "Yes, judge, my Ford makes sixty miles, I'se ready to pay my fine, Mars Henry never built a car That's able to pass mine: It's got the pep, and it can get, And when 0I'1C,S got a Ford That makes these miles, it makes him smile, And thankful to the Lordf' t'Now, Muse, tell me how you can make Your Ford run at such speed." "Now, judge, I 'spect my Ford has got The very thing you need, It goes so fast it burns the winds, Right o'er these sunny lands, The reason that it goes so fast, Why its got Packard glands." it dl' 55 Where can a man buy a cap for his knee, Or a key for a lock of his hair? Or can his eyes be an academy, Because there are pupils there? In the crown of his head what gems are found? Who travels the bridge of his nose? Does the calf of his leg get hungry at times, And devour the corn on his toes? Can the crook of his elbow be sent to jail? Where's the shade from the palm of his hand? How does he sharpen his shoulder blades? Illl be hanged if I understand. -lf 'K' -li' There are two questions over which I have pon- dered, Ever since a mere child: Where did Victor Hugo, And what made Oscar Wilde. 'li it -le . Diner at Hotel: "It must have been a tender hearted butcher that killed that lambf' Waiter: "Yes, sir, why sir?" "He must have hesitated about twenty years before striking the blow." 'K' 'lb 'EF Elsie ton the phonejz "Hello, who is this speaking??' Edna Kon the other endj: "If you don't know who you are, how do you expect me to?'? dl' db 5 Jack D.: 'iHow do you get so many girls?" Chad S.: "I just sprinkle some gasoline on my handkerchief. ra il- 'le 'li' Martha D.: K'Oh, heavens, I swallowed a dime." Ruby W.: "Well, don't make all this fuss over a dime. Here's another one.'? 'K' 'PP 96 "Here! Waiter, bring me a spoon for my cof- fee." - "Sorry, sir, but we don't serve them. The music here is so stirring." Byron Mc.: "Mr. Moore, I don't think I de- serve zero on this paper." Mr. Moore: "I don't either, but that is the lowest I could give." X -X' 'll' 'X' Father to thrice-flunkcd young man: "When you graduate I'll give you a hundred dollarsf' Truett J.: "Thanks, dad. It will come in handy in old agef' 95 GP 'lt Fish: "Charlie fell asleep in the bath tub with the water running." Soph: "Did the tub overtlow??' Fish: "No. He sleeps with his mouth open." -79 '15 'li' If you try to please a man, he decides you are in love with him. il' '35 'X' Mary had a little pig, Who being little was not big. He always walks upon his feet, And never fasted when he?d eat. l' if 'X' Dorothy R. went to a grocery store, picked up some cheese, looked it over, smelt it two or three times and finally said: "I want fifteen cents worth please." Butcher: "You've already had it, ma'am.l' K' 'K' 'K' 'tWhat have you got in the shape of cucum- bers this morning??' asked Bertle Skaggs of the new grocery clerk. "Nothing but bananas, ma'am." 'lt 'X' il' Henry A.: "You used to say there was some- thing about me you liked." Maxine M.: "Yes, but you've spent it all now." '15 99 'X' Eve corrupted Adam with it. William Tell set a world's record with it. The small boy risked a whipping for it. The American people extracted the juice from it. Congress took the joy out of it-THE APPLE. 'K' dl' 'lr Florence K.: 'KI hear the seats for the opera are high." Gilbert C.: 'tThe seats I get for the opera are usually pretty high." it HP 'X' Rena P.: "I can tell what brand of cigars a man has been smoking by kissing him." Harold D.: "You haven't anything on me. I can identify lip-stick by the taste." R. P.: "You must understand, of course, that my father and three brothers smoke and I learned from them? H. D.: "Oh, to be sure: my mother and three sisters use lip-sticks, too." if db 5? A darky called at a hospital the other day and said: "I comes to see how mah friend Joe Johnson am getting along." 'fWhy, he's getting along fine," the nurse an- swered. "He's convalescing now." "Well," said the darky, 'KI'll jest set down and wait till he's through." 1 v A U- in Page One Hundred Fz ty one U I Frank Estes-And still they gazed and still the wonder grew, that one small head could carry all he knew. if 'li' ii Ed Hicks-If at first you don't succeed, try, try, again. 45 'H' 'X' Abe S.: "Did you take in the Mix?" Selma G.: "No, I don't care for those cheap Westerns." 'lr '59 '35 Florence R.: "Pvc had a dozen proposals al- ready this season." G. McNabb: "Gracious! Good ones?" F. R.: "Yes, all from Longworthi' 414 -K' -H' Levy W.: "Well, I answered a question in class today." Arthur S.: "What answer did you give?'l L. W.: "Present.l' 'X' 'K' 'll' R. W.: "Pm engaged, Dick." Dick: "Congratulations Who's the lucky man?" R. W.: "Oh, I don't know his second name, but his first name is Ed." 'X' 'K' 'K- Max R.: "So you think it would be foolish for me to marry a girl who is my mental in- ferior." Walter S.: "No, impossible." 'X' 'X' 'X' K'What is the difference between a modern and an old-fashioned kiss?" "About ten mimics." -15 '39 '15 COver the phone, l'Lula King, do you want to go fishing?" L. K.: "Sure." "Al right, hold the line." '19 'X' ii' The Customer: "I thought you told me these red iiannels would not fade or shrinkll The Clerk: "Yes, and have you been having trouble, sir?" Customer: "Trouble? This morning when I got up my wife asked me what I was doing wear- ing her pink coral necklace!" -x- -x- -ie 1935 "Wait here, sweetheart, I'll come right back with the divorce." 'X' 5? ib Maxine Cto singerjz "Your songs took me back to my girlhoodf' Walter E.: "Yes, my voice carries a good waysll if 'll' 'K' J. D.: "Is she a good driver?" Truett: "Yep, she drives me crazyf' Enthusiastic: "She's wonderful. Just the kind of a girl I'd like to take home to my mother." Sarcastic: K'YeahI Thatls the only place I would take her." :fb it 9? Truett -I.: "Ruby slipped on her veranda thc other night? Ed. S.: "Did it it her?" Harold: "Where were you last night?l' Martha: "Itls a lie! What were you doing there?" . 49 il' 'lb FRESHMAN Lurking, shirking, every day, "I'll get through, anywayf' SOPHOMORE Fooling, schooling, getting tall, Growing, learning, playing ball. JUNIOR Fussing, mussing over a tie, Larking, sparking, on the sly. SENIOR Cramming, jamming, hoarding wealth, Driving, striving, best of health. if 'K' 'li' Vida R.: "How did you get that wonderful hair?" Melvin S.: "Sleeping in wai'He irons when I was a kid." -ll' 'K' 'Il' Kenneth L.: "That guy wears Indian neck- wear.', Elmer W.: 'tHow come?" K. L.: "Bow tie and Arrow collar." 41' 'K' 51' IMAGINE Imagine a barracks where rain doesn't leak. Imagine no lessons for even a week. Imagine Miss Board in the 9th hour room. Imagine Miss Rowe to fuss and to fume. Imagine Miss Wilcox with tresses so fair. Imagine Mr. Usry with the hair that "ain't'l there. Imagine Miss Miller assigning no Latin. Imagine Miss Elder teaching English eight. Imagine Mr. Hill with no hair on his pate. Imagine Miss Plummer with a frown on her brow. Imaginc Miss McClellan making a row. Imagine Miss Murphy giving no work. Imagine Mr. Forrester trying to shirk. Imagine the Senior with nothing to do. Imagine Miss Wickham six feet two. Imagine Mr. Butler with a pompadour. Imagine Mr. Parker with freckles galore. Imagine Miss Wolf with locks black as jet. Imagine Miss Carter a rank suifragette. Imagine Neel Warfield with Annual in hand Not scolding his staff to heat the band. .t ,t .L Algen e Bale: "I Want to do somtehing big and clean before I die." Edith Goad: 'KTry Washing an elephantf? if '35 91' Miss Rowe: "For what is Bacon noted?" Evelyn Opp.: "To season beans with." '36 5? it Teacher: "When two bodies come together violently they generate heat." Pupil: "Not always. I hit a guy once and he knocked me cold." UI or at In Page One Hundred Fifty-loco l x Cl l IT'S IN FOREST A. Loos-South's greatest coach. Charlie Waldman-Our modern Beau Brummel. Chad Starks-The answer to a maiden's prayer. Gerald McNabb-The missing link fpage Mr. Darwinj. Harold Dean-Why Flappers Hap. J. C. Barnett--Godls gift to woman. Ruby Ware--Why men leave home. James Lee-Caruso's successor. G. W. Caudell-Ichabod Crane. Roe Simpkins-Mutt. Thad White-Jeff. jim Collins-Another Tris Speaker. Beatrice Blakeney-Our Poet Laureate. Lula King Hussey-A Venus with arms. lol-Sing Sing Junior. Clara Goldberg--A female Daniel Webster. Miss Foote-A female judge Robertson. Truett jones-A Lion among ladies is a terrible thing. Miss Rowe--Worldts Wisest Woman. Vida: f'Why didnlt you laugh at Mr. Moorels joke this morning in chemistry?" Gilbert Carter: "Didn't have to, the world is coming to an end tonight." 'll' if X' Dollie Westbay, such a sweet name, Alas-'tis true, but what a shame, That a girl so pretty, all during her walk, Amuses the teachers with plain baby talk. 45 'H' 'lf Rock-a-bye Senior, in the tree top, As long as you study, the cradle will rock But as soon as you donlt the cradle will fall And down will come senior, diploma, and all. -lb 'lt '35 Ralph Darnall fhurt in an accidentj was taken to a government hospital. He noticed the letters M. D. U. S. A. on his blanket. He was fright- ened and asked the doctor what it meant. Doctor: "Many die, You shall also." 'ff 95 We A small group of words got together one day, and lamented their fate as follows: "If ox," said box, "is in plural called oxen, I'm sure I don't see why I shouldn't be boxen." "And if tooth,', said booth, 'tis the plural form of teeth, then why in the world shouldnlt I be called beeth?', "If mouse," said house, "must be plur- alized mice, ,Twould be simple and easy to change me to hice." "And likewise," said grouse, "if louse be called lice!" "If man," pined pan, "is converted to men, I really should change not to pans but to pen." "Quite so," approved fan, ban and can with a shout, "and we should be fen, ben, and cen without doubt." "If foot,', said boot, "meaning two becomes feet, then I should think two of me ought to be beet." "If a he," said she, "is he, his, and him, I should really prefer to be she shis, and shim." 'K' if if Two little coons on a bridge a-sitting, Two little dice back and forth a-flittin, Hole in a board where a knot's Z1 missin, PARADISE LOST First Lieut. Messina to Second Lieut. Biggs: "Bancroft, come up stairs one foot at a time." Bancroft: "How can I bring up more than one foot at a time? Pm not a centipedef' it 95 it Robert M.: 'lWaiter, Why do you call this Flapper saladll' Waiter: "Because it has so very little dressing on it." , Thad W.: "You look sweet enough to eat." Martha D.: "I do eat, where shall we go?" 9? 5? 5? J. C. Barnett: "What do you think of a fel- low who makes a girl blush?" L. B.: "I think hels a wonder? 'X' 'K' it Walter E.: "I think Abe Barnett is the most modest boy I ever saw." Maxine M.: "Why?" Walter E.: UI-Iis girl called him on the phone last night and he Wouldn't answer because he was in his pajamasf' it 'X' 'X' Martha Dickard is so modest she won't even do improper fractions. 'X' -X' 'Ie Mr. Norton-A man severe he was, and stern to view. I knew him, well, and every truant knew. . 91' if 99 Ruth R. to Oliver B.: "What's your opinion of the modern dress among the girls?" Oliver B.: f'Speaking from a journalistic view point, I would suggest that it is a regular double- column eighteen-inch display." 91' it if Byron Mc.: "Last night I dreamed I was married to the most beautiful girl in the world." Kathleen: f'Oh, Byron, were we so happy." 'If '19 'H' Alice Steinberg: "How much do you weigh?" Ethel Shinder: "loo and 2 poundsf' Alice Steinberg: "With or without your com- plexion?" 'IE M' 41' 'iHello, old man!" exclaimed Dubley, at the Literary Circle. "It's a pleasant surprise to see you heref' "Good of you to say so, old chap," replied Brown. "Yes, you see, I was afraid I wouldrft find anybody but bright and cultured people here.'l 'X' 'lt it Miss Denny: 'fBuer, have you ever done anything to help save your timber?" Buer Love: "I shot a woodpecker one time." Joseph Taylor proposed to an elevator girl and she took him up. ei- it -is Harold Dean: "I don't know what to do with my week-end." Evelynn Opp.: f'Put your hat on it." if if 55 QUOTATIONS Zedrick Moore-"Swans sing before they dief' 'Twere no bad thing did certain people die be- fore they sing. Page One Hundred F1 ly lhree I N k U , Url 41 A A Y I U W QL . E . ff N , f 'f K , fzf Q! f , 4.,, ' , , , L " Szgnaturey Q55 , ,J,'9y p - ,.,,, H f Z , - H " . x ,f XJ If x - , ix- fX17f,QA E xN,N ,gjQi3 -2:72 xg C g , - Nfl ,,- 1 Q - X ,,., ,f ,, . -x, , ,. , u Q f- ' , , x A X' 2 5 - dglgjggsi A - E f 9 19... Q if Q4 Cl V Rx Q 5 NP X A ff ' U 5 'r X' QQ' 1ffwxx ?'N 3 an , w k otLf9fL'A.- 7 X.. . in , C i A by joqquglrvw! A Q 'x Qx F4 i I , x . N- Q- , whiff X - X! Y Www? 6 .MMJ f '. Dk 'Y V , Lx K U, A, 2 ' q ' J ,.-V , F, 5 1 , Q , Q: . Q -- C -fv- W 5, , ,' ,JJ ,, 67 I V W r C I . V N ' X K, gm JV .. A x . , s. I I X3 - 5 , 'L ' -. Y . . 1 N If El ' ' I3 Page One H d d F'fyf ' w "T-E .ie sz., Www. ,... xxxyymxxxiwxh ll Iioresfersz OU come now to an im- portant part uf this vul- ume, the part which has helped make its publication possible. We, the business staff, wish to thank the advertisers for their hearty support and wish to re- mind the students to patronize thfise wha have helped us. Gratefully yours, GERALD NIQNABB, I ' ' wx .-7l'Lfanager. I W Blum K lmlii. 'K' ' 2 JUST 'TWHLONEJ Pugh' Om' 1llHIlil't'l1 Fifly Af-A 495 C E V E R T S Supreme Qzmlily DIANIONDS fBz.'fz11lif1zl in pfzmfzfzca, and Sminrifzg in V 111710 351 5 to iii 5oo AUTHUR A. EVERTS COMPANY KIICWICLICRS Main at hlurphy ............El.............. NGLISI-I LITERATURE abounds in furnace talk, from Shakespeare to Chris- -L1' . . , topher Morley, and most of it is lamen- tation. 'jlThere are plenty of men outside of writing circles who could Write a book on the struggles and griefs of a furnace keeper, but very few of these live in this city. Dallas has natural gas. flThe gas-designed furnace needs no keeper. lt is clean, quiet and instantaneous and burns an untouched fuel. 'Yi THE DALLAS GAS CQMPANY Borrowing from Emerson: "To hafve friends one muff shofw himsehffriendlyv HAT single epigram from our own American philosopher char- acterizes the spirit of this great friendly store-the store that seeks to translate human kindliness and understanding in all of its relations with you, our pa- trons . . . our friends. M FHTCHE-GOETTINGERC0. 9716 Sfzoppurg Cfenlergfpallas The Co-Edlf Very 012171 Jllziiei op ii Our Misses Shop is not rnerelv il beautiful shop in il beautiful 'if .At X1 s. "ig: ew i 'I 1 fait !.1:'i'Qw X 4 . . ' . 122.-2 lx ETL' y store where correct clothes for misses are solcl. lt is more than that , fb 1 1 Sp A J 4 5131, . 1 gc 'Q Q 1 ss Z f 1. . ll 7' , W ,, The f7Nfeimn1z-s9'l4ff11'tfz1s J7Wirrei" Sfzop ' ' 'Q an inttitution of youthful fashion which, while preserving its :- ' i lead gh' " ' " ' c er ip 1- 1 fmhion authority, pleases IIS patrons by :1 moclergite- 1e3: of price uniformly consistent. ,N '- Q If you are 1101 tl patron of our Jlliffefl Shoji N V - H iz .rhoppmg mm' here avi!! nuke you one! ' , --sk ,mill ' f- - . I Illlmflnnlnlln NEIMAN-MARCUS COMPANY nuxugnnnnu Athletic p Equipment -1 'A LS 1 f, VJ El Q11 My E151 1 Q! V WL for Os izraszzrss 'zerxis ' rr 1 t'll is EVERY NEED f CTLENSJEL- 1 , lf 1 1' 55142 " mu. " GH- 3 ln. f. E ifml' x i sl l-M RETAIL-WHOLESALE nnunmum nnmnmuunu num? NVIA-XNUFA-XCTURING training assures cfliciency :intl success. We teach 8 Gregg Shorthand and Twentietli Century Book- keeping, thc systems that business men every- where approve und appreciate. Worlclls champion- ship held hy Gregg writer. Graduates placed in good positions. In successful operation 37 years. Why not capitalize on the reputation and influ- ence of our great institution? Metropolitan Business College Pflnnu X-4569 f0r Calalog IQI5-I7 Commerce St. "The Home that Service Buff!" Dzxllzis, 'l'ex:1s 1 . . Fl aylor Service Station Gals, Oils, 'l'ircs, :ind .-Xcrcssorirs Free Crzmk Czlsc Surxiu Cor. Pcnnsylvxlnizl and Holmes St. OUR DRUG STORE YV. NI. CR1NDs'I'Ar F, P1'nj1rii'lur "The lelifclff Sforeu I'lwm-s ll-o163fL'-1663 Collctt :md Colum -KA- Pgualilq Fig Scregizs . f ACME SCREEN CO. H C.D.AGEE MGR.. s 54'-l.As. TEXA get Your Camp 'Dczllzzr Hlljl' Cnty :lt Service Barber Shop ZQIQ l'l1'v41j' ...H.......................... ...... Post Office Garage GHS, Oil, xV1lSl1lIlg, amd Glmfzisixig' STOR.-XGl'l Phone Y-4.623 1800 Conmnrcc Street ....... ............ .... .......... ......Ej......... BENNINCGQ SC BENNING Ken' ll'ffzvlffierzfiflg-Repailxi' l'lverj'tl1ing pertaining to Plumluing S16-X18 Exposition ,-Mc. DALLAS, TEXAS T. L. Benning A- E- Bflvlillg Phone H-1 1 1 i ln.: CiI'21l121H1,S Pll21fIl121Cy llolmus :mil IR-nnsylx :mill l,lllJllL'S li-:661 X-3183 erlrt Printing Co. Letter lla-urls, Bill lla-urls, Cards, Circiilnrs l"ulders, lfinc Booklets, L-tc. v 3306 llolmws Plxone E-0519 I-I.ininI.innmmmmmmn .-iinm.m...mnmm..n CP ci ' Sh LIVCZ ZSU OPP? NIJXNlfl'RING-l'ERNl.-XNEN'I' VVAVING Ladies' Ri-zuly-to-W1'zl1', Slum-s, L'mlc-rlincry, llosicry, N'lilllllL'l'j', lNlllI'CL'llIlQ', Fzicizils, Sllzlmpooing, Ililil' Dyeing Plninv X-4,128 1800 .Elm Dzillns, 'Il-xzls Wfzvn Ol'lllU7'f7Zg your Brerzzz' Imixt on CGRDER' BREAD G R A H A M Grocer and Market Y Still! Gunter Strcci 'X Community Store xxlxcu- you can get :is lligli il uizulc of ini-rclmmlisc ill :ls low ll rica- for the P nc grzulv :is zinyxxlxurr- in 1 zs. L- curry ut Dllln W ill tm 1 full lin of ics 1 0 fruits and x'c-gi-tzlblvs. Ifrwi' IJi'li-awry Swl'-Firm' In any part uf Ifiul Dalia.: cc U READY fo sorfoo you YVe have been serving the public in Hordfworo and various other lines of merchandise for over 50 years, and on through these h k t r re utation of serving them satisfactorily yC3I'S WC HVC ep OU P ' h ever -day needs YVe are always ready to serve you wrt your 'y Vmzf om from om! foo our many fwomiez ul lzmr o me1ol1o11d1re HUEY PHILP HDW CO ood Furnzture Delmom RIGHT PRICFS 0711 d L g Room 172127 Q01 olmg Furrur 'Vl1d to Order fix Nom 2.172171 F111 Img U71 U1yZ0yH0777L TRHI FL RNITLRI 8. MFG CO 3 ox 'VI io 1,,, EWR IN BOTTLES il Goodness and p t gllx QQIIWEN' I COL A COLA BOTTLING YV ORKS x I 2 ll Buy by the case Klein Bros Company Concrete is the standard by whrch all others are measured for Walks driveways and floors can H 4166 'F 1' X Q if ,- - f' Q .........igl.....................H..H................................................... Z ' n' - ' E Breakfast Room an ivin L E 1 i A c r : e E Upon 1 ,ring . ' g E Rol1u1i1'i11cg E ' 152 , V, E N T ' ' l C ' . . E B9 l nin St. Pl nc U- "' iq ly: ,,,wfMNfs,,x rl eff" Nt I ll ,ff -' . ,Q My f ' yi N fashflty K . f" , 11ganf".'.r vi uri y 2 E l W 4 l are sealed in. 5 4 H I N . X Y 1 Y E ' L L 1 f l l Dal us, Texas E ' N . my ' Qlll , 4' it 73 E E Q ' , 4 ' k J Ll Buy Your MILITARY EQUIPMENT rom The Ofhcial R. O. T C Store We can save you money CARROLL S 208 No Aka1d, Between Elm and PZICIHC Have Your T1tle Guaranteed STEWART TITLE GUARANTY CO Qaprtal 351,000 ooo oo 'I he largest T1tIe Gufuanty Company ID the South INIa1n and Iheld Streets NVM T SARGEXNT Jllgz GEO T BLRGESQ GM Other Branches Galveston Houston San Xntonro EI Paso 9 lunnuulnmllllnlllllnuI Remember: "Il Is Better Z0 be Safe than Sorryn T1 J I , . I . . , ff , L' '. . . I ., o' .. -A . mn CHAS. 0TT G U Temzix Rarrkefr Bicycle: LOCKSIVIITH X-6070 1007 Elm St. Infuifzcible Rebuilt Hpewrzferf 3525.00 t0 5565.00 See us before buying that typewriter, vie will save you money. Satisfaction guaran- teed. Also rental and repairs for all makes, supplies. AMERICAN WRITING MACHINE CG. X-2740 ISOAZ Commerce St. Dallas H..........................,......... ................................ Monerief Furnace and Manufacturing G0. HEATING AND VENTILATING ENGINEERS Moncrieli Top Return Flue VVarm Air Furnaec Installed in Public or Private Buildings Dallas, Texas 3903 lVIain St IlllllllllmllIlllllIllIlllllllllllllllllllllllllll llIllllllllll"l"""""'U""'u TD w7A-XRDVS Orange Crush Jfro Lemon Crush and Lime Crush 1?0fff3ff by ORANGE CRUSH BOTTLING CO. - 700 S. lirvay Phone Y-6833 ........Ei................................ .................................... NUGRAPE B0TTL1N0 00. E1 N ,I seigif A ' CID UL I lVl l CCSHICU IQIOD Nlnstcr P11 t Assocrzmf OSCAR L, WORTHAM PMNTINo-coNTRAc'1'1No-DEcoRATING 3305 Commerce Street Ofllce Phone: Y-1905 Wm. C. HIEGERT Florist Flowers for all Occasions 2712 Forest :xYC.iPll0llC l'l!254I ............E1........... HIGGINBOTHAM-BARTLETT C0 Building eglltlffifffll 2514 Commerce Strcct-Y-6566 DALLAS, 'l'liX.XS . .. v. Hxml...I-vu-vuWup,mm.upuvuluu..,J-fu-v3,U,I-.u-.u..u..uuq..u-.Muunuv.uf-ur1fu1mlfu.,Hnu-,q..qv.u..q-.U I u I H I u H u Ride the Street Car Save the Dijjcerence Dallas Railway C0 BOEDEKER ICE CREAM " ust a Little l 5 ,, Better 6? E. V, SHEANER Cwztnzelor of 'Plzzfterifzg fmaf Stucco Work 4323 McKinney Avenue-Pl - A 48,14 DIRLLASJ rllEXAS ummk Slnels Planmg M111 4.007 Eastmlde Telephone H 0651 Preston Road Properues Loma L1nda -Xvalon PICSIIOI1 Road Estates DXLLAS DEVELOPMENT Co B C L .T lQcpan1ng S IUCICF It leetrle Company M Xlxl IIILIRIC, IIXILRI H DAIT Buy XOU1 Sausages Jlladc mf RUDOLPH S S AUS M114 F XQTORY lx Phone X 1364 Youn Ctomcs Eouumon WILL No1Bt Commit: UNTIL You HAvc wonu A J ' '.Lu.u.Lu.u.L To Tau Realize How essential the Power and Light Company is to your modern pleasure in the theater 5 in the sehoolg homeg in 1 business? il Work with your utility that it may give 1NfH.ELL?m you the utmost in J ' . 1 Elin., mm ' service. r I I ji ,if I P , Dallas Power 81 lgllillpsigla L . Light Company nunnnnnunnnnuullununannunmunulnmmnnnl nuunllnqnununnl nnumnnnmnmmnnumumnnnnnnmnuunnnnmm Qflmwmm Beauty Let's Get Some C O V E R S Hor TAMALES Slade in Dtljfaj Y 'x' specialize A-YT C1111 to rest' n Mvxirzlu :md tzlhlcs for pzlrtl Wei-C used On book. Xnicriczm dishes Ol'giYCA0l4t.ilL'lAS fr picnics They are doing. their part I to help build up 5 uxxfvkl Cook Lilac lvlzl Cooksw Texas Schools E IOS Nlnin Prices Rcnsonahl .................U.................H...............inH..............................Q.......-.... ..............-.................................................-.......... "SweeZeJt I Brown 5 Chocolates in 48 Slam, I5 COMPLETE ASSORTMENTS Containing many varieties of Delicious, Delightful Surprises A Most Complete Line of 5 and IO cent Bar Goods .-1150 "Let7s QU" BROWN'S-Dallas t oMidnight Melody Men Dallas, Texas Phone E-IO3Q ............Eg........... t graduation Tay The one day young men and young Women should look their best. Traditionally it is the time to dress well and begin a new life under pleasant environment. Everything needed for Graduation Day or the day after may be obtained here. Right in Style, Exclusive in Pattern and Colorings. Inwzriably the bmi value obzffzfzzable SEUEQEU9 IEUBQSD I-'RIICD CHICKICN DINNERS tg Q mmf ' I ONE? K Chicken Sandwiches x Beek's Dininv Hall fl if W tj I l Silaieaeaiszxl 3010 Oakland Ave. N 52522296 Phone If-2956 Open I2 11. 111. to I2 p. 111. Ka Q 1 S 45 QQ turn ..........E1............. .............................................................. 1-'te -A4'1" 'j.f -,'x. .,.- -.'. .,.l in .e,,, ,e,e,. .eollg hlll ,1 .eell l unuuunnnununmnnunnnn .........El.............. ......... HARSTON SAND 85 GRAVEL CO. 712 Santa Fe Building C07UPZi7IlEllfI of Hughes Candy Mfg. 1401 South Ervny Street lVIz1nufaCtu1'ers of a complete l 1 n e 0 f CAN DIES Pure ami Wffzolefome O. Tuzz will flzlrl' your l't'?llil'FI2Lt'7lf,I bww' b1'1'f11z.w ferr have fx Million Rolls ol' Paper to Select From flflli Cnrlouds ol Paint in Stock 'l'f'fz'11f'e Parking Njmu' for Our Plzlrnrzx Ford Johnston lNall Paper Sl Paint Co. RETAIL AND VVIIOLESALE " 'Thr Ufflflt' Ilnzzfr' 011 Ihr l'Vhflf' VVzIy" 1.1.01-3 Pacific, just YVL-st of Akzuxl Street Phones X-61165 X-6227 omplatc Ou! tier 1 The Snappy Dressed Cadet an The Qrnmrt Dressed M158 zgher zmlrq Prrfed Lexx Sam Dysterbach Co Illlll at Pearl qt AIDICHDIC Llfe Insurance Company of Waco, Texas IAMES BLAIR HARRI9 ZI3 lVIcd1cal Arts Bldg erreral Jgenl Dallas 'Iems Phones Offzre X 5713 Rerzflerzce C 3183 Dress Well and Succeed You can alwaws appear at your best Wlfh out hlttlllg your poclcetbook too great a blow by Walkmg the short Hlght to econ omv Where guaranteed clothes for men cost 155 to SIS less VICTORX WILSGN Incorporated 161312 lNfIa1n St I K WILSON P fi You Get the Bert at Schhepake Bakery 1710 S Harwood St RSA! ISFIUJ Dodge Brothers Moron cARs 6Zl"8 DEPENDABLE Perry Motor Co Goof! Slreef or Qood Service d ffflvf -Q v 6, for H Q' Z E Qxpnb V - - E VX 2 1 Q Jr + . nm- G I -, X 6- E 3: ', , - ' , , -A 5 I' KC ' - E 3 ' : QL- , E f T " .L : of - . A AS, . . II, ravi cn! E 1 ............................................. .... ..........E-1 ex ' . 5 rc f jc . ' rx Kodaks Pountain Pens Kodak Finishing Om? Day Service E. G. Marlow Co. 1807 Main St. Dr. Sain L. Scothorn Offeopafhizf Thyfizriavz Special attention given to foot trouhles, particularly lint feet, weakened arches, and bunions 513 Mercziiitile Bank Building Phones: Offiae, X-1434. Dallas, Texas Ref., H-8870 Real Estate BTORTGAGES Certificates Bear 6 W-7 24148 QQ: Pardue Investment Company Southwestern Li fe Building ...............f........ ........ .................... ..........,E1....... ALBERT MUN STER The Leading SHOE REPAIRER in Dallas 1707 Live Onlc Near lfrvaj' J. H. Brower HARDVVARF AND PAINTS Lead, Oils, and Window Glass Fishing Tackle 831 Exposition Ave. Dallas, Texas Phone H-OI43 .........E1........... .........43........... Ideal Pharmacy H. P. BELL Store No. I Store No. 2 1640 Forest 4301 Colonial Phones li-5118 Phones X-1434 X-3686 X-6618 J. D. VanVVinkle Co. The Sozztffs 'Bert BOOK STORE Tuyf--Qa71ze.fffKof'cftief-Sff. I603 Elm Street mn Dr. D. Duncan Qllentixt 141 ik lwain Street Phone X-IQOO Dallas, Texas STAFFORD ENGRAVING CO 210 Houston Street I' oR'r WKJRTII School Invitations and Jewelry Wedding Invitations Social Stationery ...............E1............... 1924-25 School 'Photagmphem for FORICST NORTH DALLAS OAK CLIFF GRANVILLE NI. DEANE STUDIO THE BEST TAILORS IN THE BEST TOWN ON EARTH "Look for lbs Big Ref! Bell" BEI L TAILORINC COMPANY 1611 NIa1r1 Street DALLAS TEXAS P1ke and Kramer D1amonds Watches N ovelt1es Qualm -Xlwaws Foremost Flowers for All Occasions The Best Monev Can Buv The Largest Variety to Select from All for Less Money Pe 5 7 W 0 97777 Y j 'Vlan Qt 3024 H-rskdl 31 Ross A near MCK1 ney Eat Uur Charley Bar Wlacle better Wrth butter 1400 Maln Sfmt Cant be made anv better Oppos1 c 'XIT1L1'lC"l1'1 Tx Bank Bldg Dr M1ltOHJ Rosenal 'fffefxor of Hygzeue and P152 elm e MFHZFZIZK Ha ani Um 875713 PastLur17at1o11 does not mjure he qualltv of lmllx 111 am Wax and docs not dl1I11I11Sh 1ts r1utr1 tue xalue It sues l1xes an prew ents s1clxnes That's Why all Tennessee Dany Mllk Is perfectly Pasteuuzed T ennessee Dames, Inc The U wld .v Safer! 'Mzll ., HITE SW HIIE W E COFFEE COFFEE "lP1 'Wmaocv l + Roasted 1n Dallas S014 by Your Grocer WAPCO R ll HE , I ,a V M 2 . 15 You lfntfe hfcani of U5 All Your Life E fl ff? I A bl l 1 E 1214 1 i 1 . 1 - , E 3' 7 vc. .Il - 5 ' t I 5 1 , , ft , A s ' K Ly. K Y . 3 ' ' 5 W AN Y' AN : I I A I ' L L E W FSA m:nGnorElo' W rs- nn I G E Rnnsmas Ronsnns U N X . . . . E f . . v . Y 7 E L 1 . 1' E ' ' 1 f . . ' ' ' d 5 Y, , ' , Q 71 E E x K - S ' 5 1 I 1 Hgh' C, , E . . rc. ,I . y . vw E 6 lr PY Work cmd Play iii Telephone Land THE TELEPHONE OPERATOR Works between rests. Nlost of the time, it is true, she sits at the switchboard putting up the talk tracks for the subscriber, but in between times are periods for recreation, in which she has opportunity for change and relaxation. Attractive rest rooms invite A Variety of diversions-sevw ing, dancing, reading, conversation--or just rest. GRE Illirs Etm Mooiieyhain, Chief Opemloif at the Long Distance Ojice, at 4100 Bryan meet, will welcome your wifi! any afteriiowi from rico to five 0'fl0nfc. P 4' is 1' 2 lzEPum1: 565' UD O CI 'd I 2 on m i 'd F11 W Z UU N F' T' qimavlv 5000: T 'Q .,, 'fi il F-'IE iii: fl' Z!" Y fu l 5' 49060 'owing U1 77' F11 'U T O Z UU CJ O 5 'U DP Z he ., U. ... ... ...F.,,..,!,.u-.u,.,y.u..,x..,Wu:,..H-fu..u..u..u..u..u..,-ual,-,:u.. l..mL,,..u..u u.......,--Wm. . .'u,.u,.u: LuJJ.uJ. , H Q, , !f,p.,, 1-' , --f A 1 yu, m A K2 f V , X YN' 115 5 " 4 V g tm IX. V X fu! K 2 Hi x b E I X X 'X f X NM 4 1 3 RW V9 X Q lynx giiif-Wil" M, ,K ,WI H ,' W "2 xxx, -X rx ,A , ix, ,,r ,mf 'H of U' ' 1' y r..!!.f Che End. by Ot is Dozler

”

Forest Avenue High School - Forester Yearbook (Dallas, TX)

- Class of 1925

Find and Search Yearbooks Online Today!