Fordham University - Aries / Maroon Yearbook (New York, NY)

 - Class of 1931

Page 1 of 444

 

Fordham University - Aries / Maroon Yearbook (New York, NY) online yearbook collection, 1931 Edition, Cover
Cover



Page 6, 1931 Edition, Fordham University - Aries / Maroon Yearbook (New York, NY) online yearbook collectionPage 7, 1931 Edition, Fordham University - Aries / Maroon Yearbook (New York, NY) online yearbook collection
Pages 6 - 7

Page 10, 1931 Edition, Fordham University - Aries / Maroon Yearbook (New York, NY) online yearbook collectionPage 11, 1931 Edition, Fordham University - Aries / Maroon Yearbook (New York, NY) online yearbook collection
Pages 10 - 11

Page 14, 1931 Edition, Fordham University - Aries / Maroon Yearbook (New York, NY) online yearbook collectionPage 15, 1931 Edition, Fordham University - Aries / Maroon Yearbook (New York, NY) online yearbook collection
Pages 14 - 15

Page 8, 1931 Edition, Fordham University - Aries / Maroon Yearbook (New York, NY) online yearbook collectionPage 9, 1931 Edition, Fordham University - Aries / Maroon Yearbook (New York, NY) online yearbook collection
Pages 8 - 9
Page 12, 1931 Edition, Fordham University - Aries / Maroon Yearbook (New York, NY) online yearbook collectionPage 13, 1931 Edition, Fordham University - Aries / Maroon Yearbook (New York, NY) online yearbook collection
Pages 12 - 13
Page 16, 1931 Edition, Fordham University - Aries / Maroon Yearbook (New York, NY) online yearbook collectionPage 17, 1931 Edition, Fordham University - Aries / Maroon Yearbook (New York, NY) online yearbook collection
Pages 16 - 17

Text from Pages 1 - 444 of the 1931 volume:

DRI -p-..- H f I r ffir f COPYRIGHT WILLIAM S. DRESCHER Editor-in-Chief TIMOTHY A. O'LEARY, JR. ' Business Mandger QQ H f' -'ET-XR 1 YQ: 1 - 1 -1 ll ' X 1'N 193 'I MAROON 'T 'ST'-,1.-.' '.:"'I'f3f, L, ,xxx x-r-- T .gr g,l,.w -- , 5 "Ji" I,:. Iflg- lg lthough the pages ol a yearboolc are in- adequate to fully portray and envision the magnifi- cent future that the present promises for Fordham, yet to unfold tomorrow and depict the greater great- ness rightfully Fordham's has been the object of our humble attempt. f - I-.-rv""1f, wg . I 'r?'l.F'l1 F' Pr .-'fi-"l ...ni Q if N' If tl ,5. z. I I hc fr- ' itll lf' . We iff? f all f f J f ETROPOLIS PRESENT GREATNESS AND RIGID NOBILITY OF PURPOSE PROMISE EVEN GREATER THINGS FOR TI-IE DECADES TO COME IOS: .MARX ON I X 'N Publ' h bythe n , . x in Fosen:-IAM UNIVERSITY FORDHAM NEW YORK llflll I III? VM" ll 1 1 11111 ll MAILQQN ... QDEDICATION I I I f -I rw-I' I .- -rg' I Q 5-, ' Ei.-::r: - 1? P 'Q I f To TI-IE IQEVEREISID ALOYSILIS J. HOGAN, S.J., WHOSE INITIAL ACTIVITIES I-IAvE MANIEESTEID HIS PRCDGRESSIVE SPIIzIT AND ABILITY TO EVALLIATE TI-IE POS. SIBILITIES OF TI-IE FORDHAM OF ToIvIo I2I2oxxf, WE, TI-IE CLASS OF 1931, MOST RESPECTFULLY DEDICATE THIS, OUR LAST SCI-IOLASTIC EFFORT xxxkxxxx I 1 I1 1 I I I I I I I I I I GF FORDHAM' 7 11111 11111 L 1 .x -. I, X , fx -, r x A ., X v z, V, f.. 'fy Z .V I v, W. -I i , ' v In . Xe: ' Ta' f Eff- a 'Wu , fx. T ,V .W s, . V1 . 9, . 'EA R. Q Ur., -' iii- ' 'fx A ,I . EK-, -A 'avi' ' E, 5: UQ," ' z . ' x was j ' 1,.- , , Rx. 5?-, Y 1 "QQ r 'fir ri.-5 , J 1 X, V "Tux ':' 'gel A . ,, . Q., . 1,1 5 , 'RQ . M. i . V.'5.rf " Q -sb . .. TI QR E 7 -A5551 E . f: , T F .hh . XJ: T ' 5:92. wx , ., ,' 1 u. Qian 1 3. L N . ,. 3 ' -H 6- ,f,:g:f1f1QLfrf'-"' - ...,4 , ..- .. , . ., . ,- M , ng... S . .. ' iw-H V ,. .,. . . . .Y ., 0' F I I L, hm ,W Q, - - ....,:L ..,. .YM .... W .. ., QR. ,N 4 5 K, w H34 "wr ww me 'K fp... if gg:-,. wp- '-,-wg. wg. 1 5 F' , ' ' 'L xx "gg, Hat! 1.3 'MA -:ml 'mm 'xii 'mu 'Nuff 2 k r 4 , 4 Q 1 4l1..1-11111.l.lf. MAILOCN uv , u' 5 iiilfw A Patrons J J Mas. LAURA F. HIS EMINENCE PATRICK CARDINAL HAYES REV. ALOYSIUS J. HOGAN, s.J. ' 1 REV. CHARLES J. DEANE, s.J. A F REV. WILLIAM A. WHALEN, s.J. - FORDHAM UNIVERSITY ALUMNI ASSOCIATION. ABBOTT J MR. AND MRs. Josnrn J. AMANTB MR. AND MRs. STEPHEN BADoLATo MRs. EDWARD BALI' MR. AND MRs. JOHN J. .BERGER MR. AND MRs. MR. AND MRs. I I I JOSEPH A. BILL CHARLES BOEAN CAPT. NAPOLEON BOUDREAU, C.A.C. , U. S. MR. AND MRS. EDWARD F. BQYLE MRS. ANNA BRENNAN , A I MR. AND MRs. PATRICK A. BRENNAN MR. AND MRs G. M. BUGNIAZET MR. AND MRS GEORGE S. CLARKE MR AND MRs. JAMES F. CLEAR I MR AND MRs. EDWARD J. COLLINS MR AND MRS . PATRICK J. CULLINAN Mxss HELEN M. CURLEY MR. AND MRS. CHARLES P. DALEY DR. E. J. DOLAN A MRs. MARY E. DQYLE . "'OF FCRDI-IAM A. MR. AND MRs. WILLIAM F. 'DRESCHER MR. THOMAS-J. EARLY ' ' MR. AND MRs. NELSON . EDGE, ZND MR. AND MRS.IJOHN J. FAGAN MR.-AND MRs. WILLIAM T. FARRBLL DR. AND MRS. MR. AND MRs A. FAVORINIA . SALVATORB FAZIO MR. AND MRs. Josnpn FBNNELLY MR. AND MRs. JOHN FOUNTAIN MRS. MARY A . GALLAGHER MR. AND MRs.. JOSEPH A. GAISIEY MR. AND MRS. PATRICK GRIFFIN MR. AND MRS. MR. AND MRS. JOHN T. HAYEs MR. AND MRs. FREDERICK G. HELEIG MR. AND MRS. MR. ANDREW MR. WILLIAM BERNARD HEREERICH, SR. A. HEUCAL HEALEY HINE8 MRS. ANNE M. HURLEY WERNER B. GUTENEERG I MAJ. EDWARD L. KELLY, C.A.C., U.S.A. MR. AND MRs. T. FRANCIS KELLY K KKK! KKK KX L, ...MAROON N--awww T39 ilgsgf' Mn. Mn. WILLIAM J. KIIOOH AND Mns. JOHN A. LARKIN Mn. J. GARDNER LAwLOn Mn. Mn. Mn. VINCENT R. LIIIBBLL ' FBRDINAND MARINO AND Mns. JOHN A. MILLIIA Mn. AND Mns. P. F. MITTIIN Mns. J Osnpn P. MORRISSEY Mn. AND Mns. ANDRBWJ. MULCARE, Sn. Mn. Mn. AN1j Mns. FRANCIS C. MURPHY AND Mns. JOSEPH A. MURPHY Mn. AND Mns. JOHN F. PnYOn, Sn. Mn. AND Mns. EDWIN S. QUIN Mn. AND Mns. EDWARD J. QUINNAN Mns. M. A. RAFPBRTY . Dn. AND Mns. Mn. AND Mns Mn. AND Mns Mn. AND Mns. Mn. AND Mns. Mn. AND Mns Mn. AND Mns WALTER A. RBILLBY SAMUIIL F. REYNOLDS HUOO F. RIccA, Sn. ANTONIO ROOLIANO THOMAS F. RYAN CHRISTIAN SATTLBR Gnonon ScnoLzn Mn. AND Mns. Taos. J. MCCARTHY Mn. AND Mns. CORNELIUS McCOUnT Mn. HUGH MCGUINESS Mn. AND Mns Mn. AND Mns. Mn. AND Mns Mn. AND Mns. Mn. AND Mns IMn. AND Mns -Mn. AND Mns. PATRICK MACDWYER FRANCIS B. MACKINNBY WILLIAM A. NEBDHAM ADAM J. NIcoLAUs P. NOLAN WILLIAM F. O'BBlRNB M. J. O'DONAHUB Mns. M. O'DONNnLI. Mn. AND Mns. TIMOTHY A.O'LBARY,SR. Mn. W. V. Snnnnm Mn. THOMAS A. SIANO Mn. AND Mns. PAUL E. SILLIBRB Mn. Josnra SOLANTO Mns. MAnY F. SPALDING Mn. AND Mns. CHARLES W. STRONG Mn. AND Mns. E. F. SULLIVAN Dn. AND Mns. JOSEPH TAVORMINA Mn. AND Mns. THOMAS TAYLOR Dn. AND Mns. THOMAS E. WALDII: Mns. SARAH WALL Mn. AND Mns. CHARLESJ. WALSH Mn. AND Mns. ALFONSO PERCONTI DR. AND Mns. ANTONIO PIsANI Mn. AND Mns. Mn. AND Mns. JAMES F. WILSON Mn. AND Mns. Gnoncn WOLII ALoIs ZILG lllllllll Ill ' 1 x N N N X N N 'X NNN KX 'R K Yi F1 OF FORD!-lAM9" 1 111 1 11111 1 1 MAROCN . . SFOREWGRD WE HAVE ATTEMPTED To PORTRAY THE EQRDHAM WE A HAVE KHoWN..E.A Mon- ERN, PRQGRESSIVE UNIVER- slw. WI-IETI-IERW WE HAVE SUCCEEDED on FAILED IS NOT ,FOR US TO SAY. V V KEKKKKK I VI I I I I I I I 1 I I I I I lf OF FORDHAM'1 1 I-111 III I 1 , , A y ' , ,J CCD MARQON xxx gxyxxx xx NTENTS CAMPUS ADMINISTRATION S CLASSES OEGANIZATIGNS ATHLETICS HUMOR ADVERTISEMENTS for FORD!-IAM ' , S ' XE K ,K K 5 N N N N N E lflll ll VV' -2-,gl YZ? l TQ AMPUS . fu .- Cil- n 1, wg JY' f 'F ' '- , , uf I , J KWH! vw- :rf 7 QQ v -' ' iff 'f- o A-arg, ef. 0 3.45 . ,A 'J F P a3?i1Qf,gggfgw 'i4?1JSi::-IJ, 'J 2 f '. fx .ii J W HQ X X I NA! V Y 5 E I I a DMINISTRATIGN REV. ALOYSIUS HOGAN, l'rc.riflcz1t :gf l'v01'rU7rllll I f11ivcr.fiUf R1zv..Iosu11H A. MURPHY, Prafemor of Pgfcbnlolg-y and Natfmzl Tlveology REV. IGNATIUS W. Cox, 'Profe.r.r0r of lftlviar am! Religion Rlcv. 'Iosuml LYNCH, Pmfmror qf Plgy.ric.r Rlsv. MIcHA15L'I. MAHONY, Prafemmr' of Hiftmy of Pbilomphy REV. Dnmmmus B. ZEMA, Profesmr of Hirtorjy REV. AUGUSTUS B. FREMGEN S.-I. Profenor of Greek Rav. HAROLD MULQUEEN, SJ Prafexsor of Pbilompby Ruv. ANTHONY L. GAMPP, S. Profeuor of Religion Ti ' ,. 1 E K ! 1 T- : 'Hai EA! hy, , T , kim an M M Rm: V335 'H Mx A Mm fe i , M L new Wm ,hi 1 4 M: , ,A 35122 "MS K' A . A-,871 C, 1 M, 1, A JULIUS M. WINSLOW, PH.D. Profemor of Education BASILE G. D'OUAKIL, M.A., LL.B. Profenar of Modern Larzgiiagex WALTER A. HYNES, Sc.D. Profc.r.for of Chmzistry 0 4 MA,IOR EDWARD L. KELLY Profeuar of Military Science and Tactiar ALBERT F. KAELIN, M.A. Prafemor of Greek O FRANCIS A. SCHAEEER, Pn.D. Prafeeuor of Latin WALTER BATTEN, A.B. Instructor in Etbicf .AIOSEPH V. O'NEILL, A.B,, LLB. Amifteznt Profeuor 0 f M atbematicr and Greek P WILLIAM P. HURLEY, B.S. Profeuar of Pl3y.rif.r GERARD CREGAN, A.B. AJIj.Yfdllf Profexmr of Euglixla CAPT. NAPOLEON BOUDREAU, C . A .C. r A.rJi.rta11t Profexmr of Military Science and Tactics IOHN F. COFFEY, A.B., LL.B. Imtructm' in Pbyxical Training GABRIEL M. LIEGEY, A.B., LL.B. Axyixtmzt Profcnor in Latin, French, and Englixh JOHN F. MCANIFI', A.B. I mtrurtor in Pmycbolagy FRANCISJ. BROGAN, PH.D. Profexxor of Qualitative Amzbfxix WILLIAM T. SHIELDS, A.B. Profcuor of Economic: 1 W, LASSES W W egg u W I 1 . X u III ' 'Zi'-i U .AE G.. :fax 1- es I -f .. Q2 I f U ! lil M N? Nl N2 N1 6 X K i 1 'QS 5 e N E N: N5 Ni 'Ni x x x x xg Y we Wi N1 xx? ,.. l -NH S 3 w ,EE V 3 'K M 'i ir Q ,A lf JM !. 5 1 YN Q5 EN 42 if YE A ER fx 5 T Qi Q 3 I SN SENICJRS FO Q W -qw A ll! MA PLO O N v v v Class History, '3 1 ROBERT BOYLE . . PN-Filfwf , ANTONIOJ. PISANI . Vice-Prexizlent GEORGE F. CUNNINGHAM . . Secretary' CHARLES A. MCALOON . . Trmmrcr HE ceaseless onrush of time has carried us through four years at Fordham and is Trevealing to us a vista of experiences radically different from those that we have known during the past few years. But, as a traveller, -about to set out on a long voy- age, turns to take a last look at his home, so also do we pause to hastily glance back and to review briefly our college days. In the panorama there stands out clearly a record that will always be associated with our class, that is-the splendid record cf the football team, the Eastern Champions. In the long list of games, beginning with the one against the Lafayette Frosh in 1927 and ending with that at the Polo Grounds with Bucknell in 1930, the outstanding contest was the victory over New York Uni- versity in 1929. It was in this battle that the team found the power latent within it to overcome a highly touted Violet aggregation and fill the hearts of Maroon rooters with ecstasy. The monstrous rally on the eve of the game is one of the highlights of our college days. We shall hardly forget the cheering and shouting in the auditorium as the last rites were read over the efhgy of an N. Y. U. player, the torch light parade down Elm Lane and thence to the very campus of the enemy with the loud and chal- lenging rendition of Fordham songs enroute, the serenading of the Violet students LlUClCI' the dormitory windows with a bucket of water as our plaudit for each rendition of a love ballad, the pre-victory march around the foc's grounds and the frantic l . -.-Xa CX 'XX X' YCY .X KMYCXC X'YY Y YAY 'KX 4 Q 4 'ri 'ri CD F7 U 11: 12' 3 5 gg V X X N X N X X x x x x N x X . X lttffs' -. V v MA R0 O N N l efforts of firemen to locate the tire that did not exist. Although the season included victories over Boston College, Holy Cross and Bucknell, no other triumph was greeted with as much enthusiasm as that over our neighborhood rival. The celebration con- tinued into the following week with rallies held, all over the campus,conc1uding with the half holiday proclaimed by the Dean in honor of the team's accomplishment. In 1930 the team continued its victorious march by subduing New York University, Boston College, Holy Cross, Detroit and West Virginia before it was stopped by St. Mary's, which was brought on from California to perform a task that Eastern teams had found themselves unequal to. The greatest team that Fordham or New York City ever had closed its career by slaughtering the Bison herd from Bucknell. The Class of '31 took especial pride in the record ofthe team,for the majority of the Varsity eleven were members of the class. In its history the players were outstanding not only as good athletes but also as good students. Fordham can point them out as examples of how well athletics and scholarship combine if only good sense and true school loyalty are employed. So that as Siano, McMahon, Pieculewicz, Hurley, Eclewicz, Wisniewski, Foley, Holmberg, Tracey, Miskinis, Shableski, Bartos and Healey close their careers in football they leave behind them a record which Father Knickerbocker, as well as Fordham, is proud of. Interwoven with the record of the team in our memories are the episodes surrounding the games, the trips to Holy Cross and Boston with the fun derived more than com- pensating for the troubles encountered in the journey. The trip to Boston in '29g the dinner parties held after the games in the city with all their attendant details, and perhaps best of all the recitation of our individual experiences to a group of fellows indifferent to our stories because they were bursting with eagerness to tell their own. There are a vast number of incidents associated with these eipsodes and for years to come they will be narrated as "Do-you-remember" stories, and when there is no longer a group to listen, but only one to reminisce, they will be relieved in the fancy of an old man. Once again the happy events will be clothed with all the brightness and joy that lirst accompanied them and the unhappy ones will be tempered by a phil- osophy that only the aged possess. Along with these memories are those ofthe dances held by the Pennsylvania, Con- necticut, Massachusetts, New jersey, Upstate and Brooklyn-Long-Island Clubs. It is easy to recollect the preparations for the dances, the conversations among ourselves of the merits of prospective partnersg the night of the dance itselfg the meetings of long separated friendsg the music of the orchestra changing from waltz tempo to a fast fox trot with no forewarningg the beautifully gowned young ladies and black- clothed young men dancing in consonance with the melody, and the joyful faces of the boys and the gentle expressions of the girls as they forgot for one night the exter- nal world and lived in an atmosphere of friendliness and happiness closely approach- ing Paradise. In contrast to the dances there were the SophOlT10I'C S1H0kC1' and the Senior Class Banquet to the football team. Both of them were well attended and there was an over- flowing of good humor and comradeship that only an event of this kind can bring forth. i O F FO ll D H A M " " ' l f' 5 MA RO O N V 1, V To counsel us in our conduct at these affairs and to withdraw us for a few days at least from the outside world was the purpose of the Annual Retreat, conducted by Jesuits from the Mission Field. Daily they interested us by narrations of dire results that befall those who stray from the loving arms of Our Holy Mother, the Church, and humbly we listened to them as they pointed out the right path and counselled us to follow it. Perhaps these holy men of God were rewarded for their exertions and sacrifices when on All Souls Day they beheld the Chapel filled with young men who had assembled there to close the Retreat by receiving the Most Holy Eucharist and renewing their Baptismal vows. Perhaps they felt some satisfaction as they watched us silently and reverently go up to the altar rail while within our hearts we repeated the words "Oh Lord I am not worthy" as the music of the hymn flowed sweetly from the organ. The Retreats will ever remain in our mind as the expression of the spiritual current that ran through our lives at Fordham and together with the First Friday Devotions held in the Chapel, the Sodality meetings, and the simple but pious May Devotions held in the Quadrangle, raised our college careers above the mundane. During ourjunior Year the Student elections provided an interesting contrast to the Religious services. Whereas the latter were quiet and restful, the former were spirited and exciting. They provided an interesting interlude in the rigors of our scholarly labors and although hotly contested resulted in the forming of close friendships be- tween every one concerned. Some of us in the future may be candidates for public offices but we doubt that future elections will enthrall us as did those of our junior Year. The first contest resulted in the election of Bill Drcscher as Editor-in-Chief of the MAROON and the appointment of Tim O'Leary as business manager. The second in the selection ofjohn Lane as President of the Athletic Association and of Ed Bill and Tom Hurley as the other officers. The third in the appointing of the Senior Class Officers, namely: Bob Boyle, President, Tony Pisani, Vice-President, George Cun- ningham, Secretary, and Charlie MacAloon, Treasurer. In previous years Bill McMahon had held the Presidency of the Class and had ably guided it through the bitter experiences of humiliations as Freshmen, the tyrannical domination over the newcomers when we were Sophomores and the political combats of our third year when his justice and intelligence helped us to solve the perplexities arising from the choice of new ofiicials. In Freshman year the President was ably assisted by Ray Hurley, Vice-President, Ed Ricca, Secretary and Bill O'Beirne, Treas- urer. The following year Charles Lynch had replaced Ray,Hurley, with Tony Pisani and Charlesjones making their appearances as Secretary and Treasurer. With the com- ing of junior Year, Pisani moved up to the Vice-Presidency and Ray Hurley returned as Representative. The oflicial roster was completed by the addition of the names of Ed Bradley, Secretary, and Tom Siano, Treasurer. Within recent years, through the zeal of the oflicials of the school and of the stu- dents, there has been developed at Fordham a well-rounded set of extra-curricular activities. The student leaders have always been men of sincere school interest who did not hesitate to work sacrificingly and unselfishly for the success of the activities. The coming of our Senior year found many of these positions of leader, vacated by graduation, filled by some of our classmates no less worthy of the trust and responsi- bilities of their positions than their predecessors. it if ri Q9 Fl' l3ORDllA M I1 I I ,., ' X ge: The Band, which added so much to the glamour and color of the football games continued under the fine leadership ofjoe Gatti with Tony Pisani gaily leading the band down the field in his position as Drum Major. The Ram found a highly efficient Editor-in-Chief in John Lane, ably supported by an enterprising staff consisting of Ralph Low, the innovator of "The Interview", Bill McCue, who continued to amuse the school with his "Ramblings," John Field, the Sports Editor, Ed Ricca, the smiling debonair Managing Editor, Jerry MacKin- ney, the ever resourceful Circulation Manager, Angelo Badolato, genial Reference Manager and a hard working news staff consisting ofjohn McManmon and Phil Ryan. The staff of the Monthly, the Fordham magazine, which although it had already won high praise from outside sources,was delightfully improved during the past year, we Hnd Pete Cusack, Bill Cusack, Nelson Edge, Bill Hines and Ed Silliere contributing articles and poems, while Tim O'Leary continued to be Business Manager for the second year and accomplished a feat in handling the duties of that office. In the dramatic field the Class finds itself no less well represented, for among those taking an active part in the furtherance of the work of the Mimes and Mummers are joe O'Donohue, Tom Waldie, George Nicolaus, George Collins,Vincent Carlin, Bill Ciolko, Bill Sibrans and Jack Cawley. In Senior Year many of the above were seen in the excellent presentation of Pinero's "Trelawney of the Wells," given at the Collins Auditorium. One of Fordham's prides in extra-curricular activities is its excellent Debating Team. Again, in the record of this team is shown Fordham's astounding growth in recent years, for within our college career the College's forensic representatives have swept on to victory in many debates and this year, beginning with the triumph over New York University, another glorious record. is being set. A corresponding example of Fordham's fostering of functions for the outlet of student enthusiasm is the development of the Rifle Team, which has already estab- lished a distinguished record and is adding to it with each contest. On the basketball court, the baseball field, and in the swimming tank, the Class has some of its members taking a leading part. Captain Zaleski and Pete Wisniewski contribute to the Class record on the courtg Captain Elcewicz leads Sheerin, Andrews, Aube, Foley, Maynard and Ryan as they cavort upon the field,and in the tank Tom Waldie is aiding the team in compiling a list of victories. Few events rank with the Glee Club Concert in point of interest and entertainment. The night of the Concert has always been a gala one and the Club has always provided a most interesting evening for those who attended. During the past year John Kelly has directed the Club in a series of concerts at which they equalled and even surpassed the nne performances given in other years. The wild exuberance of our youth has been tempered on six occasions by notes of sadness which hlled us with wonder and sorrow as we saw our ranks depleted by the Grim Reaper. It caused us great anguish to lose our chums but we feel that our life has been made richer by their presence even if they were with us only for a short time. Five of our classmates, Frank Dowling, Frank Attanasio, Larry Kegan, Cliff Smith " W fa at fa 'R M iii 'P O ffl VU fi if EX. M 4 4 4 3 P F C C Z lf' if if .y In iiiifiiili P! if gf .Q 5? I f l . l i 5 I I 1 11111111111 MAps00Nv.. and Bob Brierton heard the voice of the Master and were borne in the gentle hands of angels as they ascended into the abode of the Saints. Now from on high theywatch us as we struggle along the path of life, and moved by pity and compassion they intercede with the Divine Saviour mercifully to guide us along the path to eternity. Now in June, 1931, the old Rose Hill gates lie lazily open, utterly indifferent to the throngs that pour through them eagerly making their way to the scene of the Commencement Exercises. A gloriously rollicking sun gayly rides high in the heavens boisterously trying to pierce the shade offered by the heavy leafed elms that line the road. To the sounds of a pompous processional the Seniors march through a lane of friends to receive their diplomas. Engulfed by congratulating relatives and friends we forget to say a last word of farewell to the companions of our college days until we see a lone straggler departing from the campus, now almost empty and leaving us alone with our dreams. The four years of richly varied experiences are now ended as we are swept by the wave offlife from the gentle and Catholic influence of Alma Mater into the bitterness and joy of the external world. The years have been short, very short, but during them we have formed bonds of friendship and loyalty that will never be severed, for nothing can separate in spirit those who are united by the ties of pure friendship. . I I I I XXXXXXXXXX XX XXX XX jf, i I ' ' ' O F FORDHAM S' I 52' I i'if77Q7 FCDRDHAM is u EDWARD F. AnnoTT, A.B. Brooklyn Prep. Sodalig, I, 2, 3, 4: .S'paz1i.rl1 Club, 2: B7'00kb'II-LHIICQ Ixlurld Clul1,4,' l7re.rl1mm1For1m1,'Cla.r.r Rcprexentfltiue, 2 35 Ill ' I , I 5 . . l ll U i lil 1 , f lll ' . V V W ' 5 I , ' p F e l i i ii l I i l I 1 i i ' l I l . , . I l D seems to V' to he a personifi- E cation of good humor. He has D an infectious smile and a manner i i that draws one to him. Whether he is called upon for recitation in class or he is in the company of friends, Ed maintains a composure and assurance that is the delight of all. A perfect gentleman at all times, he is imhued with the true Ford- ham spirit. With the loyalty and courage that is his, there is no doubt, that, when we look for those successful in life, Ed will he among the foremost. 1 3 F. ILL has a natur lly retiring dis- position, but ven his shyness did not dim the s eady brillianey of his scholastic: achievements. Avoiding notoriety and shunning all self-aggrandizement, he has at- tracted a circle of friends by those sterling qualities which he has so quietly manifested. Bill is a worshiper at the shrine of science, and is numbered among those who spend their lives track- ing down elusive theories. Ever a loyal rooter for his Alma Mater, he will manifest equal loyalty as an alumnus. We don't have to wish you suc- cess, Bill, for we know your abil- ity to forge to the front. FORD!-IAM .lf WILLIAM W. ACAMPORA, B.S. Evander Childs High School Italian Club, 3, 4,' Sodality, 1, 2, 3, 4: Mendel Club, 2,3 36 Il ANDREW A. ADINOLFI, A.B, Xavier High School i Yodulity, I, 2, 3, 4: Italian C lub, 3, 4,' Library Committee, 4: .l'pu11i.rb Club, 2,' Clacmirtrjf Club, 4 F O ll D H A M if ,W ifg 7 Illl r al 1 l y l lil if 37 Illlliii ll .r Slit ,Q " ' s 5 i 4 fi t 1 i a , Xl imma are thlnse wlmo are with- Tcmut enemiesi and who are rich in friends. Such a one was Andy, and for our part, we are grateful for the four years association that has given us such a classmate. To know him was a pleasure, nay more, it was an honor. The members of the Mendel Club alwayslookcd forward to the time when Andy was to read his paper, hecause of the choice hits of re- search he would impart. Andy will study medicine, and is certain to be a worth-while addition to the profess i on. gli i I ill l x I l i I N Louis ii exemplified the an- I cient maxim that silence is gold- en. Not that we mean to suggest that he is dull or disinteresting. Far from it! Louis realized that there is a time for work and a time for play. He is never so completely immersed in his studies that his friendly nature suffers seriously. Louis' warm-hearted Latin tern- perament makes him 21 welcome addition to any group and 'has founded for him friendships which will last for a lifetime. Louis intends to grace the medi- cal profession wherein we are cer- tain that he will be more than a credit to his Alma Mater. p N llima fill: Fila Louis AIILLLQ, B.S. New Haven High School Frencb Club: I tulifm Club, 3 4: Cbemimg' Club, 4,' indul- ity, I ,' Interclu.r.r Bmketball, I 2, 3: Me11llelCl1zb, 3 38 FORDHAM 3 tw? X fi i ii' ""'-.. FORDHAM ,X rl OSIIH W Annum A B Regus High School 4 :ty I 2 3 4 Reprereututzvc 2 3 fr lv- l l -rr" l Nlij r , ' Ill ml if f Q 1: il , et J gf hill' i WI r H t 3 . 1 l l T .N .I ual . L", . . l A K i Sad Zh , , , , ,' Clair . ', , ,' far. l A mm:l"or1m1,'MARooN .Ytajf 4 i J l l g . ' 39 3 s V 1 I ! i s i 1 I ' 5 l f ou has a keen analytic mind J which is never satistied until it has discovered the exact truth. This faculty has enabled him to amass at store of knowledge which is at once profound and varied. It is with pleasure that one meets joe, for his comments and opinions are as edifying as they are inter- esting. Furthermore, .Ioe's personality is engaging and pleasant, and his calm manner hespeaks his self assurance. With these estimable characteristics, we know that he will travel far in his chosen pro- fession. 1 I I 5 . I 1 I I flax I F silence is gol en, John is the I richest man in 'he world, never have we heard lrim speak more than ten words in the ordinary course of a day. But, when it comes to exam time, John becomes voluble, and how volublel He glances at the questions and liter- ally pours out a fund of informa- tion into that innocent blue-book while the rest of us sit in awed amazement, wondering how any- one can know so much. Needless to say he invariably lands a mark in the 90's. His persevering diligence au- gurs well for the future. FCJRDHAM I oHN D ALLEGRO A B Brooklyn Prep Immaculate Conception Soda!- ify, 1, 2, 3, 4,.' Frmcln Club, I 2, 3, 4 40 N FORDHAM I .ll ANTHONY F. ALOIA, A.B. Fordham Prep. Immaculate Conception Sodal- izy, 1, 2, 3, 4,' French Club, 1, 2: Freshman Forum: Mendel Club, 3: Glee Club, 1, 2, 3,' Intercollegiate Context, 1, 2, 3: Manager I nterclarf Baseball, 2,' Chemistry Club, 4: Rifle Team, I 41 H. CLOTHED in the slacred white garments I f the Chemistry Department, Andy roamed majes- tically about initiating the Sophs into the unholy mysteries of that black art. It was only a short time ago that he too was breaking in- numerable test tubes in his zeal to concoct hideous smells and breath- taking explosions. Now that Andy has that elusive bit of parchment, he will shortly hie himself to "Med" School where he will have full occasion to call upon his scientific knowledge. We hope that he doesn't insist on us calling him Dr. Aloia. 4 i l nl l l 1 I l 1 ,ill llli I v l ms sterii loo ing gentleman T with the we mustache is perhaps one of thelquictest men on the campus. Cool, reserved and self-sufhcient he finds, as most wise men do, that his own company is the hest. As for extra-curricula activities, the heavy schedule of the B. S. course prevents him from taking an active part, but in Freshman he showed his talent as a playwright hy having one of his brain chil- dren produced in the One-Act Play Contest. F 1""'i'fz EW Vi 'vii .4 a..J' r ?', l -1 fl lt flplili jimomnll. AMANTI5, B.S. DeWitt Clinton High School l"rc.rhmun One-Act Play C011- tart, Bert. P1101 42 lm N. M " s lit, Q it j 3... 'fill ' ,v,-ln. d I ll l l.. . fem 133' i 4. lull V. lll lg ' V 'WN "?'i'. 'l x gillllll ' is i w il W li 'Q Ip 2 l i ' s g . J ix K ' 5 , lx 'X i W Q l l V . 1 l Nlcl1.soN D. Alvnltlaws, l3.S. . Kingston l-ligh School I limrcbalf, I, 2, 3, 4.' P61111- Cfllb, I, 2, 3, 4: Via'-Prc.ri- dent, 4 l 4 l l i I . 1 li ' . A . 43 li, Q N o stflfll l J' L lf""'xR ...ill y. X : e F if AILING fron th Keystone State, Neil has for four years heen one of the outstanding and hest liked men in the school. Possessed ofa wonderful pitching arm, a strong solid character, and a liking for his native state that is at times alarming, you couldn't help heing attracted to him. He has a cheery smile for every- one. We have often wondered whether this was due to the look of amazement on the faces of hat- tcrs as they tried to see the hall go hy them. gm fi it l'ia'.'. v l ,ii ,ii s . 1 , 1 onns flan ha dly paint a true picture of nge. To a scho- lastic record that is most credit- able, he has mahaged, between hurried trips to his home in West- chester, to impart his aid to in- numerable activities of worth on the campus. The Harvester Club felt his guiding influence as Presi- dent, and numerous were his con- trbutions to our weeky paper as a member ofthe Ram Staff. But it was the Glee Club that claimed the major share of his construc- tive efforts. In short we need not predict success for him in the world at .largeg it is written in his works. FORD!-IAM l ANGELO C. BADOLATO, A.B Mamaroneck High School Immaculate Conception Soda!- ity, J, 2, 31 Harvester Club, 1 2, 3,4, .S'ecretary,1, Vice-Pre.ri- dent, 2, President, 4,' "R4m' stays 23 39 41' Glee 2,3 4, Board of Directors, 3, 4 Chairman of Concert Commit- tee, 4 44 FORDHAM I Josnpn -I. BAKEWELL, A.B. Xavier High School Sodality, l, 2, 3, 4: Fferlamafl Forum: Haroerter Club, 1, Zi Propagation of the Faith, 1. 2, 3, 4: Glee Club, 2, 3, 4: Vigi- lance Committee, 2,' Brooklyn- Long Island Club, 3, 45 Dante Committee, 4 45 ' . I l U A LITTLE tr e oflOld Erin, a large port on of genuine Irish personality, arid an immeasurable quantity of the friendship of his classmates are the things that have endeared Joe to us. He needs noth- ing more. Native intelligence and intellectual honesty render Joe a man who has received, and who has earned the respect of all who come in contact with him. No matter what may be his lot in the future, no matter where he finds himself, there is one thing we all know, joe will land on his feet and like it. l. llama "To keep' you head when all about you ar losing theirs." These immortal vlords of Kipling seem to be particdlarly applicable to this Son of Hartford. Ed's calm, confident air of supreme indiffer- ence in the face of impending ob- stacles, obstacles which creased the brows of his classmates, has always been a source of envy. - He has shown us that a playful manner may disguise a spirit of firmest purpose, that fun and conviviality can be the handmaids of true depth and sincerity, that character and worth are best found in the company of laughter. FORDHAM l EDWARD BALF, B.S. Hartford High School Mendel Club, 1,' Freshman Beueballj Conn. Club, 1, 2, 3, 4,' Partbeniezn Sadality, 1, 2, 3, 4 46 FORDHAM I I III nu WILLIAM A. BARRY, ALB. Regis High School .S'odalit,y,1, 2, 3, 4 47' ,N mu Q a If HERE we hav the Tell-rounded man, tr y a gentleman, scholar and d' penser of mirth. Big of stature, ight of heart, Bill would challengl: a world of pessi- mists and conquer them with the logic of laughter. Possessed with grace beyond measure, coupled with an imper- turbable calmness, he is excep- tionally endowed with the ability to take things in his stride and succeed in all with an enviable nonchalance. We admired his abil- ity, marvelled at his disposition, but mostly cherished his compan- ionship. Au rcvoir, Bill, for in a short time, we shall be rejoicing in the joy of your assured success. iQ UIET add u ssu h never sough the applause of the multitude, o the contrary, he possesses a certai modesty which greatly enhances is jovial spirit. A Fordham affair has always been John's affair, for his ever faithful presence was unfailing. He is a charter member of the College Warblers, and his rich, distinctive voice will be sorely missed. e With an extraordinary amount of common sense and deep regard for loyalty, we know that, when Fordham days are over and life's journey has begun, John will -map out a plausible schedule to com- plete success. FORDI-IAM In ul llll JOHNJ. BERGER, A.B. New Rochelle High School Orcbextra, 1 , 2, 3, 4 4 Librarian, 41 Band, 1, 2, 3, 42 Glee Club, 1, 2, 3, 4: Intercollegiate Con- test, 1,2,3,41 Mendel Club, 3 48 FDRDHAM EDMUND G. BILL, A.B. St. .Iohn's High School Glee Club, 2, 3, 4,' Board af Directors, 4: Vice-Prerident of A. A., 4: St. Vincent DePaul Soriety, 1, 2, 3, 4: Mime.: and Mummers, 2, Prerident, 4i Frerhman One - Act Plays: Brooklyn-Long Irlami Club, 3, 4,' Varrity Play, L' -Yfdgv Crew, 2,' Partbenian Sodality, 1, 2, 3, 4, Secretary, 33 Prvffff, 4,' Vigilance Committeef Con- cert Cammittee, 3, 4 49 ' ju lllll f I g Wu must a sociaie Ed with the gall t knights of old, a handsome, spirited, energetic lad from the confines of Long Island. ' Throughout his four years on the Campus, Ed has played the dual role of honor scholar and congenial pal. Earnestness and thoroughness graced his every move. Space forbids a eulogy, but his portrayal demands glaring colors. A leader in extra-curricula affairs, foremost in ability and Hrst in the hearts of his classmates. With a fond farewell and a sin- cere wish for a bountiful harvest of future happiness, we sorrow- fully contemplate his departure. ililillll 'Hi ll Plllfi lp. I mm we frnect ne of the most H popular, one fthe most lik- able members o I the Class. A happy, carefree smile ever on his features, john makes patent to all who know him a genuine spirit of friendliness that pervades his na- ture. But what is more, jack manages to balance this pleasant trait with a deeper sense of responsibility which gained for him an enviable position among his classmates as a student. Staunch in his friendship and ever ready to help a friend, Jack's character is sure to prove 'the "Open Sesame" to success in his future endeavors. FORDHAM l JOHN T. BouAN, B.S. Regis High School MAnooN Stag, 4 50 FORDHAM l ' P VINCLNT BORCISI BS Ev mdei Childs High School A un I n 5 , i 7 Frerbman Football: Iuterrlau it Barkezball, 1, 2, 3: Frwvlf P Club, 1, 2,' Italian Club, 3, 4,' - i A.r.ri.rtaz1t Manager Barker- ' ball, I , 2: I nterclarr Barelfall, H I, 2: Sodality, I, 2, 3 51 wig E xx V , l r L I L 'i l l onoiu often have us moments B of wonder when we tried to figure out how one man could know so much about the "Sport of Kings" and still be the hard- working and earliest student he was. He would wager with you at any time, on anything, or at any place and there are many of us who have reason to regret. For in this, as in everything else he entered, he persevered, and the only stopping place for him was mastery. He has won a deep place in our hearts and we're sorry to give him up. ,li lily ff 3 l 'I v lull D BoYL wo ld have been E satisfied to h ve remained as one of the obscuremembers of the Class and have finilshed his college career without attaining the pop- ularity which is now his. But his classmates gradually discovered the splendid personality that was in our midst. Slowly at first, but then like an avalanche Ed saw his friends increase in number so that in his Senior year he has in his quiet way achieved a popularity among his friends that is second to none. FORDHAM l D ,lf All 'll EDWARD F. BOYLE, B.S. Regis High School Sodalily, 1, 2, 31 Freshman Forum . '52 FORD!-IAM Ili EDWARD P. BoYLu, A.B. Regis High School Sodulizjy, I, 2, 3, 4,' C111-I-F Bfmkethrlll, I. 2, 3 A sz il ' qw lllll ' for fail lil i OMETIMES me, , eveli after they S have been fexposed to four years of college life, carry the same narrow views as' they had as ado- lescents. But not so with Ed. His broadness of viewpoint and intel- lectual scope are refreshing. Here there is no pretense, no false pride, but a calm and genuine outlook on life. In Ed there are the qualities upon which are based our concep- tion of what a man should really possess on leaving college. We know also that Ed will go forth and face life and its problems with the same equanimity of spirit that has endeared him to us. l rf, 'l pn X I 1 I I I I ! i Ill ill ll N Hughielwe h d our model of I the cultured ge tleman and the staunch friend. Utter lack of pose and intense sincerity has made for him a host of friends. His fore- most interest was Fordham. His smiling face was always in the vanguard, whether it was to urge on a Fordham team or lend sup- port to a hit of fun. A Always cheerful, both in word and smile, always ready for any sport, and always helpful when aid was required, Hugh has reared for himself a monument "more lasting than bronze" in the hearts of those who have known him. HUGH M. Boyus, B.S. Regis High School sdddlifj, 1, 2, 3, 4,' 0-Uiggyiy CW5, 3, 4: Sophomore Vigi- lance Committee 54 FORDHAM Il 3-5. FORD!-IAM III nu T ll l l l l ss uqg I I 1 3 Ill ' Ronum' BoYLu, A.l3. ll. Xavier High School Senior Clam Pre.rielent,' .Yenior Week Committee: junior Ring I l 'I 1l'l 1111 .JU- Committee: Sophomore Vigi- lance: Sodality, 3,4i 5f'1f0" l Bmzquet Committee 5 5 tretentiou :ind suave man- ner, remained o con uer. Surely it was an hor rabl victory to capture at lztrg majority of the class votes for President of Senior. His weapons were sincere scholar- ship and quiet good fellowship. Bob was ll gracious and stimulat- ing lender and was at all times cordial and gentlemanly. The members of the faculty and the students are all immensely proud of Bob. This is at tribute to his chztracter. His activities are 11 tribute to his talents. There is little more to be said. We regret that we must lose the company of so line at gentleman, yet we are proud to send him forth into the world. C' FCDRDHAM III un All RT has ltll tn qualities that A should be fo nd in a gentle- man-intelligenceg wit and deho- naire manner. As a proof of his intelligence we offer his scholastic record for the four years he has been at Fordham. It is irreproach- able. As regards his wit-Mkindly ask any member of the Class, they will all he more than delighted to give you full particulars and will amply confirm our statement. Attend a Connecticut Club Dance and you will see that we have not exaggerated when we called him debonaire. ARTHUR BRADLEY, l3.S. Weaver High School Connecticut Club, J, 2, 3, 41 Harilexter Club, '2, 3, 4,' Senior .Ybelalityi Vigilance Commit- tee, 2: Track, 2,' Varsity Golf, 2, 31 Freshman One-Act Plays: Clan Baxketball, 2, 3 H 4 56 l FORDHAM THOMAS P. BRENNAN, A.B. Larksville High School Frubman Footballj Interclius Baseball, 2, 3, 4: Intcrflfw Baiketball, 2, 3, 41' PHW Club, 1, 2, 3, 4,' Baara'er.r Initiation Committee, 4 57 :fell li l I I I ' I SILENT, Pennsyl- A. vanian, his profoimd wisdom runs a happy ra e with his ready wit. There is an air of perfect sincerity aboutihim, and what- ever he does is certain to be done well. This cheery and happy dis- position has won the admiration of his colleagues. Tom is one of the most popular men in the Class and has found it impossible to mask his likeable personality be- neath an unassuming and easy- going attitude. Now the poignant happiness of commencement bids us part. As the years slip by, Tom, may you win the success yourhigh character deserves. 5' li FORDI-IAM I I l l U 1 HE porrlp an heraldry of Tnotoriety find no lure for Bill. He not only believes in the motto "what is worth ldoing is worth doing wel1," but he practices it. For he is more in the habit of get- ting nineties in his exams than telling others how he gets them. He is thoughtful and studious, but not pedantic. He is as willing to inconvenience himself for others as he is eager to throw himself heart and soul into the work marked out for his attention. In all, he is admired for his talents, but coveted for his friendship, WILLIAMJ. BRENNAN, A.B. Mineville High School Purtbeninn Sodulity, 1, 4,' Quill Club, 2,' Day Stuilentr Soilulity, 2,' Frencb Club, L' Upxtute Club, 41 Initiation Committee, 4,' I ntrumurul Bur- ketbull, 1 58 EDWARD P. BROSNAN, AB. Regis High School .f0zl'1lffUf, 1, 2, 3, 4 59 u will always rememher Ed in the center of an enthusi- astic group of listeners. He is a "Happy Warrior," a master of repartee whose hrilliant thrusts have charmed and delighted his audience. In Ed, moreover, the joyous and the serious are hlended. He is a line student, whose work often reaches the heights of hrilliance. As a supporter of Fordham activi- ties he has few equals. We feel that Ed has every right to face the future with the same boundless optimism with which he has always met the prohlems of his college days. FORDHAM I l l I ll ul V I 'llll I . ll Jonsm S. BROWN, A.B. Xavier High School Sodolity, 1, 2, 3, 4: .Yecretmy of Sophomore Clan NDEED, he iis a ra e person, who I is at once the YARD-ZbOUf-EOWU and a scholar of no mean ability. His finely chiselell features and debonair attitude plus his delicate sense of humor mark Joe a true friend. It was his penetrating smile, and that mischievous twin- kle in his eye that won over his horde of friends. These external graces merely betrayed the traits that nature had implanted within. As genuine as his gentility is his lightness of heart and depth of thought. We do not hesitate in predicting that J0e's future will be brilliant. 60 FORDHAM J osapn G. BUGNIAZET, A.B. Fordham Prep. I Nil :rail W all .l i 1 4, 61 on greets us ev ry morning fresh J from the chilly woods of West- chester. To many he seems to be a high pressure salesman for the realty dealers in that section-so boastfullydoes he praise its merits. We cannot, however, blame him for that, since it only attests the enthusiasm which is his. He is not only a man of high scholastic standing, but his intellectual sta- tus renders obvious the reason for it. With these and other character- istics, Joe may face the world with all the confidence that he will easily overcome any and all ob- stacles that may confront him. nl it I . I l., lil HEN 1 okin for a worthy successor t the genius of Cicero and a tr e exponent of Demosthenic art, ne only has to see the figure of tl'lis sturdy son of Brooklyn Prep. Oratory is his forte and it is in this that he is pre-eminent. Again, he is at home on the dance floor as he is on the rostrum. A leisurely and lackadaisical mien is his, for he never becomes per- turbed or in the least excited. Vin- nie's cogent arguments caused all to direct their attention towards him in psychology groups, and, at the same time, his cynical and laissez-faire manner was the de- light of his companions. FORDHAM I VINCENT A. CARLIN, A.B. Brooklyn Prep. Mimex and Mummerx, 2, 3, 4,' Vigilance Committee, 2,' Coun- cil of Debate, 2,' Freshman Work Shop: Intercollegiate Ora- tor, 2,' Oratorical Contest, 2, 3, 4,' .S'oa'ality, 2, 3, 41 Play -WMP, 3, 4,' Intercollegiate One Act Plays, 31 One Act Plays, 1, 41 Brooklyn-Long Island Club, 3, 4: French Club, 2 62 FORDHAM ill nu Il ll JOHN A. CARMODY, A.B. Xavier High School joddljpy, 1, 2, 3, 4,' .Ypaul.rb Club, 2: Braokbn-Long I.r- luml Club, 3, 4: Demce Com- mittee, 4,' Ifzterelum Basket- ball, 3,' Council of Debate, 4 63 L fllll all l l 1 1 4 l l 1 v uiiufillif I I MBODIED in John lwe find that E balance th t is looked for in the perfect gen leman. Combining the qualities ofla good student and at wholesome "pal," his friend- ship is worthy of esteem. Whether offering an objection in ethics or giving his opinion upon some chosen current event, Jack in his sincerity still maintains that "Devil-May-Care" attitude. Wit and humor blended with depth of character promise him 11 golden future. us has lneen rom Freshman G even to Seniof the same quiet fellow whom all have admired and whose company all have enjoyed. There are none of the common affec- tations of a semi-intellectual soph- ist about Gus. He doesn't aspire to brilliance of mind, but if one is familiar with him, one finds a con- scientious student and a serious- minded young man who has more sound knowledge than a half doz- en "brilliants." We feel sure that without the companionship of men like Gus, college life would lack much of its value and true worth-a fitting tribute to Gus. FCDRDHAM AUGUST A. CASERTA, A.B. Fordham Prep. Vigilance Committee: Clary Burketbull, J, 2, 3, 41 Frexb- man Barketball, 1, 2,' Clan Bareball, 1, 2, 3, 41 Sodaligf, 1, 2, 3, 4,' Frerhman Forum: Quill Club, 2, 3, 4,' Italian Club, 3, 4 64 FCDRDll.fiXM I III u ll JOHN P. CAWLEY, A.B. Morris High School Frexbmenl One-Act Pletyrf Memes and Mummeftr, 1, 2, 3, 4, Vice-Pre.riele11t, 4, Bu.ri11e.r.r Manager, 4,' Ifmmeculate Con- ception Sodality, I, 2, 3, 4,' Seeom! Prefeet, 4,' CUIHICU af Debate, 4,' junior Ring Cem- mittee, 3 1 65 mtg Dunmo the our ylars we have known Jkhn, his quiet yet forceful personality has stamped itself indelibly llpon us. No enter- prise has been a success without him! His clear thinking and execu- tive ability have rendered him in- dispensable to every form of col- lege activity. jack has never shirked this responsibility. Rather, he has taken it up willingly and under his capable direction, suc- cess has always followed. Such success at college augurs well for the future and we are con- fident, that on the broader fields of life, the same success will be his portion. ifhgll Ill? fiiiil l EIN fl I I I i v l orm is che pervect example of J the real student. l-le is quiet and unassuming, but his eyes shine with the clear fight that goes hand in hand with a Fine character and genuine intelligence. John is not one who talks idly to conceal an abiding ignorance or shallow- ness, but who speaks only when he has something to say. We sincerely regret that we must part at a time when our real friendship is beginning to crystal- lize, but since it must be, we can only wish john the success he de- serves. lim la FORDHAM I OHN . CHESKY, A.B. Regis High School Sodality, 1, 2, 3, 4: lnterclnmr Basketball, 1, 2: Frerlaman Forum 66 FORD!-IAM Ill- BENJAMIN CILIDERTI, B.S. Yonkers High School 67 w III li ' i i o U 0 all l N overwh ming desire to A. make the ,most of his four years at Fordham, kept Ben in the background as ifar as extra-curri- cula activities were concerned. This did not characterize him as a "grind" On the contrary, by dint of patient application and keen- ness of intellect, Ben has an en- viable scholastic record to show. But such evidence would be en- tirely unnecessary, for one look at those clear-cut, intelligent eyes would convince the most inastute that here is a man of genuine in- tclligencc. , l X. ,l -3 I 1 i ! Q a INCE this gent eman seems to S have the faculty of bringing to a successful and inspiring conclu- sion whatever he sets out to ac- complish, we may safely predict for him, so long as he continues in the possession of this aptitude, a most exemplary and inspiring ca- reer. Bill is ambitious and opti- mistic-ambitious enough toeffect whatever to him seems good, and optimistic enough to think it can he effected because it is good, He is a gladiator at heart, full of hghting idealism. Who conquers him must have a hetter and strong- er spirit. WILLIAM CIOLKO, A.B. Poughkeepsie High School U prtate Club, 4, Prerielent, 4,' Council of Debate, 2, 3, ' 4, Vice-Preriilent, 4,' Frei-lymqn Forum: Varsity Debater, 3, 4,' Lecture Committee, 3, 4, Lec- ture Debater, 3, 41 Glee Club, 2, 3, 4: Mimet and Nfuinmerr 41 Varrity Play, 3, 4,' Freeb- man Ruler Committee, 2,' Par- tbenian Sodality, 1, 2, 3, 4,' Vartity Play, 3, 41 Boarilerr Initiation Conirnittee, 4,' Inter- collegiate Glee Club Context, 2, 3, 4 a F RDHAM i I l Ill im I 'ui In 68 3 fi FGRDHAM Ill Illl x y ,- l GEORGE T. CLARKE, A.B. Brooklyn Preparatory School A.r.rociz1te Editor-in-Chief of MAROON, 4 69 u 0 3 X I M'N of umor, A. and C an unshakable failing for a p rticularly odious brand of small i igarj good taste. In the four Qyears of our ac- quaintance witl'l George, we have yet to see the frown of anger be- cloud the decidedly masculine handsomeness of those features. The slight evidences of a good- natured cynicism which crop out in his conversation now and then, only add spice to a personality that is so enjoyahle and surpris- ingly mature. Certainly the pleasure attendant upon association with such a re- freshing, clear-cut character, has been among the most sincerely ap- preciated of our college days. l lr, I lx, can b s and after the long attentive ii journey he lnakes daily from the well-known "N State." However, he does- and still man- ages to keep the felar of conditions from his mind. Tom's forte, it seems, is golf, and since he has been a member of our Varsity Team from his Sophomore year, we must place some credence in his ability! We admire him moreover for the genuine air of good fellowship that emanates from him, for his faculty of cheerfulness that has gained him countless admirers. In fine, if character delineates the man, Tom is sure to enjoy future success . FORD!-IAM THOMAS F. CLEAR, B.S. Stamford High School Mendel Club, 2,' Frencb Club 9 Zi Connecticut Club, 2, 3, 4, Band, 3, 4,' Freybman Golf, VWJUJ' Golf, 2, 3, 41 .Yoelality 3, 4: Harvester Club, 4 70 FORDHAM vi will ' 1 nl Ill ll' JOHN M. Conv, B.S. St. Peter's Preparatory School New fenrey Club, I, 2, 3, 4 71 wig , 3 I I Ii 5 li I l y i s l i icruiuz, if you vifill, a lierce Pyoui1g man Svho will light to the finish in defense of his beloved State of Jersey and you have John Cody. He is a unique combination of scholar and practical joker. John is never perturbed by the un- expected quiz or exam, for he is an ardent believer in the adage, "The wise are always prepared." Practical jokes are -Iohn's spe- cialty. His cheerful features fore- stall any retaliation. A man with a perfect sense of humor and the ability and the will to put his shoulder to the wheel needs no further Commendation. We are glad to call him friend. S Geor e is I 1 I I I I l l I -- or-H , nanje cause of hi auburn a banker, we he has been locks, is goi g feel sure. At training for that for the past four years-he is hardly ever seen on the campus before ten o'clock. Despite this propensity, George makes up for lost time by valiantly defending the honors of the Ma- roon cross-country team. In proving his versatility, he has shown marked ability as an actor, and has taken part in several Varsity productions. To cap it all, "Hot-hair" has a great sense of humor. Without a doubt, George will succeed in whatever profes- sion hc elects to purSuC- FORD!-IAM I GEORGE E. CoLL1Ns, B.S. St. Ann's Academy Frerhman One-Act Playrj French Club, 1, 2,' Mimex and Mummerr, 2, 3, 4, Director, 4,' Playrhop, 2, 3,' Mendel Club, 2, 3, 4, President, 2, 3,' Var- .rity Playf, 2, 3,' Varsity Cron Country, 2, 3: Frerhman Cram Countrjfj Brookbln-Long Lr- land Club, 3, 4,' Vanity Track, 2, 3,' Glee Club, 21 Immaculate Conception Sodalizjf, 3, 4,- Auociated Biology Clubr of Catholic Collegex, 2, 3, 4, Vice-President, 2, 3, 4 72 FORDHAM I I WILLIAM P CONLIN AB Regis High School I I l i III V IIII! "'X ' II ll. Sodalzig' 1 2 3 4 Clan Bax kctball 1 2 MAROON Sm IL - , W 0 chuckles from deep own n his chest, while small w inklcs of internal laughter sscr ss about his eyes, 73 is one who has ever won the es- teem and sincere liking of his fel- lows. Solid character, a sense of hu- mor,and understanding-this is our summation of Bill after four years of undergraduate association. We like Bill too well to throw any more roses at his feet, for fear that we may give the impression that this, our opinion, is not sincere. One of the most pleasant of our college memories will be that of our association with this thor- oughly congenial, masculine per- sonality. g fl l 1 f ' in i 'llll 1 l ATT is dine of the strong si- M lent men o Fordham. We just know that he ill become one of Brooklyn's foremost doctors, because he goes at all his studies with that grim determination that is his, and his alone. Even his handball game shows this marvel- ous trait that he possesses. He is unbeatable on the court, we know. When Matt greets anyone it is always with a big I-lello and an even bigger smile, without which we have never seen him. Indeed he is one of the most likeable chaps at Fordham and all our best wishes for success are his. FURDI-IAM I MATTIIEW H. CoNLoN, A.B Brooklyn Preparatory School Brookbn-Long Irland Cluf, 3, 4,' Sodality, 1, 2, 3, 4,' Mendel Club, 31 French Club, 1,' Inter- claxr Bareball, 4,' A.f.ri.rtant Manager of Track, I 74 FORDHAM III im l l .l St, Peter's Preparatory School New AIBf'.l'Q' Club, I, 2, 3, 41 Sadaliry, 1, 2, 3, 41 A-1'-ft MHIINKQGV T6Il7If.f, 2, 3 - 75 AMES E. CoRcoRAN, A.B. :Jill l Lisssim with an ineradicable B sense of humor, Jim strode through his four years at Fordham gathering to himself a host of friends. They were men who looked beneath his smiling eyes and found the real man. They respected his intelligence, they appreciated his unsellishness, his ever present dc- sire to help. They found him a solid bulwark in times of stress. And he was equally popular off the Campus. His poise, his brilli- ant conversation, his line dancing, made him a desired ligure at any social gathering. We have been honored by his friendship. 1 2 ' ' Ill v 'llll in RANKhallsfro FordhamPrep, F50 matriculati n at the College just meant a c ange of class- rooms-no trunk 'to pack, no fond parents to bid farewell, and no par- ental admonitions to bear. As a B. S. student, Frank quietly imbibed the laws of gravitation and the conservation of energy without in the least being perturbed by the immense formulae and equations involved. He studied and hence saw no reason to worry. His is the attitude of the philosopher. In all his undertakings, social or aca- demic this same spirit of savoir faire is evidenced. We wish him well! 1 ll FORDHAM I FRANK J. COROYANA, B.S. Fordham Preparatory School Mendel Club, 4: Frencb Club, 1, 2: Cbemirtry Club, 4,' I,-41- ian Club, 41 Brooklyn-Long Irluml Club, 4 76 FORD!-IAM MATHIAS F. CORREA, A.B. Brooklyn Preparatory School Q AmimwtManagerofFaotLaZl, 1, 2,' Mimer and Mummerr, 1, 2, 3, 4,' Immaculate Concep- tion Sodality, 3, 4 77 I mel hi! lfear Nlattg ha beeh a figure in the class. of a keen intellect and good nature, he the friendship of all. No was satisfac- torily until Matt's clear-cut analytical opinion had been heard. Always the gentleman, always willing to do more than his part, he is a friend one never banishes from one's list. While he was pre- eminent in class, his ability as a playwright was also noteworthy. Many a One-Act Play Contest proved a success, because of Matt's endeavors. It is our belief that Matt will prove as successful after college as during his too-short stay with us. I 1 IT was notl until our junior year that John came into our midst. However, with is gentlemanly bearing and ready' wit he did not for long remain a stranger. John has proved a good student during his two years here. When he leaves us to enter his chosen profession, he will bring to it an abundance of learning and wisdom that he has made part of himself. We shall miss John's cheery "hello," and sincerely hope it will be our pleasure to hear it again even after we take the roads that shall lead us apart. llama l la FORDHAM I JOHN F CORRIDON A B Seton Hall College New fmrqy Club, 3, 4,' Sqdal- iv, 3, 4 V 78 FORDHAM I :::.,'ll CHARLEs CRAIG, B.S. Evander Childs High School Sodaliqy, 1,' Boxing, l,' Golf, L' Mendel Club, 2,' Twfli-V, 1 79 l HARLIE is v brant, full of life C and activi . He has in him the qualities t at are the essen- tials of a good salesman or a high- salaried executive. All his actions are done with a speed and preci- sion which impress thc onlookers by their surety of purpose. His is a happy outlook on life. Possessing a self-confidence that is not offensive and a hearty sense of humor, nothing phases him or takes him off his guard. With these qualities as his recommendation, Charlie will undoubtedly over- come with ease whatever obstacles may rear themselves in the path of his success. CIQRTAIN impex turhahle c1lm ness and urbanity of manner seems to surround Charlie and around him, an atmosphere of quietude prevails. It is his infec tioussmile thatimmediatelydraws one to him. To disregard that dis- arming smile is as impossible for one as it is for a nail to resist the pull of a magnet. His urbanity hides a keen intel- lect that with disconcerting inten- sity of purpose disregards the un- important and fastens relentlessly upon the heart ofthe matter. It is this tenacity of purpose which assures for him success. 4 gym E l 4 ! , 3 'Ill 4 . I i 1 li : 1 'I I A 5 - CIIARLIQS CRAWLIQY, A.l3. Brooklyn Preparatory School Soeleeliry, I, 2, 3, 4,' Bragklw- Long lfleeml Club, 3, 4,' Dance Committee, 4,' .Senior Week Committee, 4 80 FORD!-IAM ll FORDHAM nil llll ii THOMAS R. CREIGHTON, A.B. New Haven High School Vigilance Committee: MA- ROON Staff, 4,' Track, 2, 3,' Connecticut Club, 3, 41 FN-fb' man Forum: Clan Basketball, 2,' Sodality, 3 l l 81 HAKESPEARE us that ap- S pearances a e deceiving, and this may be tru y said of Tom. He possesses the physique of a sea captain, and the features of a man of the outdoors. But his voice is quiet, his carriage modest. He combines a generous disposi- tion with a delightful sense of hu- mor. A keen student of all the sciences, his most ardent study is Ancient History. Tom's ability to size up those he meets should prove invaluable in his work as a law- yer, but it is his spiritual wealth which will make him a man. I Y I 'r was a shdrt fo years ago that ITom first grac d our horizon with his pleasant' self. With the passage of time, through the exer- cise of his kindness and thought- fulness, he has everlbroadened the number of his friends. Whether it be but a word of good cheer or the solving of a scholastic difhculty, Tom was ever at hand to sweep away doubt and indecision. If a 'natural gift of keen intel- ligence and a profound considera- tion of others be any criterion, Tom is sure to find success in the unmapped byways ofhisfuturelife. FORDHAM I THOMAS P. CULLINAN, A.B. Regis High School Freshman Farumj Freshman One-Act Playrj Council of De- bate, 2, 4: .S'oa'aliU, 1, 2, 3, 4 82 FORDHAM GEORGE F. CUNNINGIIAM, B.S. St. Augustine's Academy Bufeball, I, 2,' Nlemlel Club, 2, 31 Clan Secretary, 4,' Cbair- man .Yeninr Football Banquet, 4,' Brookbfrl-Long I .rlaml Club, 3, 4,' Cbairmml .Yenior Week Committee 83 I uqg I uoncu is licient, and His pleasant, never-fading is ample testi- mony of his .ity. For four years he has one of the most popular and best liked in the class. Because of this, he was first cho- scn by the class as "The Best Mixer" and, then, was elected to the enviable position of Chairman of Senior Week. He is so unassuming that, un- less one knew him intimately, one would never know of the scholas- tic rccord he has made for him- self. It is superfluous to wish him, "Good luck," for he cannot fail to succeed. ilinlilli wil l l ' OMBININL the of the with a friendly di po and a keen sense of humor, we evolve the whole-hearted, sincere Jim. If character makes the man, Jim was a man in his boyhood. To know him as a classmate is a pleasure, to know him as a close associate is indeed a real privilege. A born experimenter, with a deep love of the sciences, Jim is bound to go a long way up the ladder in the field of research work. C gentleman a d the scholar, FCDRDI-IAM AMES CUNNINGHAM AB Fordham Preparatory School Immaculate Conception Sadal- ity, 1, 2, 3, 41 Rifle Team, 2,' Freshman Forum: Harueyrer Club, 3,' Spanirls Club, 2 84 FORD!-lAMp llll l F JOHN A. CURLEY, A.B. Regis High School Freshman Forum: Fmhman Ba.rketball,' Vigilance Commit- IM, 2,' tsbddlilty, 11 2a 3a 41' Interclan Baxketball, 4 85 ll l l v X F there is on thinlg in John's I personality lipon which we can place a Hnger, it is his happy and cheerful way of looking at things. It is a sure indication of his char- acter that we can sincerely say that John has never in all his associa- tion with us even approached making an enemy. John has the happy faculty of making friends, and more to the point, he has the ability to hold them. His sincerity and depth of character have a. mysterious at- traction which is one of the many points that go to make john the kind of a man he is. R i l l v lu THOUGH rone o remain in the background,j e has made his presence felt by t e quiet exhibi- tion of those qualities that mark a true gentleman, genuine affabil- ity and a deep consideration for his fellows. Most of the fellows in the class claim as the forte among studies the subjects of Psychology and Ethics, but Joe is of the opinion chat Economics is the most prac- tical. We can still picture him offering the professor the solution of a difhcult labor problem. This ability to analyze an argument and offer a fitting solution will prove of inestimable value to him. all JOSEPH E. CURLEY, A.B. Salesian I-ligh School Sodality, 1, 2, 4: Clam Ba.:- ketball, 3 86 P RD HAM ' in mil 5 l FORD!-QM n ml llll PETER CUSACK, A.B. St. Charles' College, Md. Fordham"NIontl:U" Staff, 3, 4,' Varfig' Cram-Comztfjf Team, 3, 4,' Varsity Tratk, 3, 41 Im- maculate Conception Sodality, 3, 4: Glu Club, 3: MAROON, 4 l 87 I . c I it an my? ,ll Ili l B was pec liar in his loyal- H tics, in a everence for real things-and a few books, in an appreciative heartincss in living, in a rough affection for a regiment of friends. Although he spent only the last two years of his college career at Fordham, he was selected in Senior year toeditthe poetry and dramatic sections of the Monthly. He offered to its genial society all the flamboyant genius of his com- panyg his laugh, his rich theatre talk, the poetic brushes and thistles of his argument, the vigor and brilliance of his gayety. And he leaves Fordham with another per- sonality in its tradition. lllllf :lil gm lllw. MANY pedple t ink they have the gift ol writing-Bill actually has. His entertaining essays and pointed comments in the Monthb' render this obvi- ous. A shrewd insight into the foibles of his fellow humans, coupled with a delicate sense of humor are traits of Bi1l's writing. Of his personality we can say even more. Unobtrusive self-conii- dence, plus the ability to make friends stamps Bill as one who will unquestionably overcome any ob- stacle which may rear itself in his path. As for the future, we know that under the aegis of this same personality Bill will travel far. FORDHAM I WILLIAM C. CUSACK, A.B. Regis High School Monthbf' Staff, 3, 41 Mknoow Staff, 4 88 FQRDI-IAM li, .ii ll JOHN E. D'ALEssANDno, B.S. Flushing High School Immaculate Conception Xodal- itjf, 3,' Baud, 2, 3, 41 Ofvlfw- tra, 2, 3, 4,' Glee Club, 1, 3, 4,' Intercollegiate Context, 3, 41 French Club, 1,' .Ytagc Crew, 3, Brooklyn-Long Ixlanel Club, 4 89 I 1 I I I HEN we rst met John we bl were impressed by his affa- bility. His pleasant features and his air of goodfellowship made him our friend. Whether singing with the Glee Club or playing in the Band, he manifested a sincer- ity and naturalness that was the envy of all. Coupling to this a fine sense of humor and wit that is as keen as it is subtle, John portrayed for us the spirit of a true son of Fordham. With the same geniality he embraced the "Ratio Studio- rum" and swept through the four years in triumph. 4 fl llfl l 0 ll l. , THIS gent emanifrom Regis and the wilcls of Connecticut spent a great deal of his time rid- ing the "6:15" lfrom Stamford. Early rising and the discomfitures to which a commuter is daily sub- jected did not destroy his good na- ture nor make of him the creature humorists hold up as the average commuter. Always wide awake, always with a smile, and a busy pen taking down "Psych" notes, Gene was an example to us to pull up the tent pegs and move to the land he calls home. FORDHAM I y EUGENE L. DALY, A.B. Regis High School Sadaligf, 1, 2, 3, 41 Connecti- wr Club, 1, 2, 3, 41 MAROON Stajf, 4 90 N N M4 ix, .- 1 .yi cg, ltalii , ' hh : ii KENNIBTII DALY, A.B. Xavier High School Chemistry Club, 4 91 FO R D l-fl ,ix M nu li n ll 5 l i i l Baud, I, 2, 31 S0d0liU, 31' fam NIE fx I I I iiililll W lil? Tl" 5 Q EN'S carefree nature is perfect- K ly balanceli by the studious side of his nature. For four years he has ranked, high ih all his classes, but in the latter two he has been especially brilliant as a philosophy student. Many a puz- zling difficulty has been readily solved byhis keen, analytical mind. If he doesn't make a good medi- co we shall be greatly surprisedg that one could fail of attaining the heights with such talents as are his is most unlikely. Physicians may well be congratulated on re- ceiving into their ranks so genial and capable a gentleman as our Ken. I i 1 Q I I l l I 3 i I I l li RT has lompiled a record at might ad- A. college that vantageously emulate. I-le has bal- anced a truly meritorious scholas- tic record by participating in many of the activities on the campus. The Council of Debate knew him as one of its foremost advocates and the Quill Club found in him a staunch supporter. Above all we admire Art for his true, genial na- ture and his ready wit, qualities which make his companionship sought after and much desired. In short, we feel certain that his in- dustry and native ability will earn for him an enviable niche in the outside world. ARTHUR DELANY, A.B. Regis High School Frexlaman Forum: Council of Debate, 3, 4,' Quill Club, 2, 3,' Sadality, I, 2, 3, 4 92 it I, 1 i F RDHAM in i i llll I in FORDHAM Il WILLIAM F. DEMME, A.B. Far Rockaway High School Sodalm, 1, 3, 4: Bfvvkbn- Long bland Club, 3, 4,' Iflfef' clan' Baseball, 2 93 liiufm :ll . wig ' : : l MONG the ny fine points in A Bill's iar cter, his power of concentration is outstanding. He can return to school after having spent his summer as the handsome life guard at Far Rockaway Beach and plunge into his work with that zeal that has made him the fine scholar he is. Quiet, unassuming, yet deter- mined and earnest, he has become a friend to us. Blessed with a fine sense of values and a keen busi- ness acumen, we bid Bill good-bye certain that wc will some day sec his name among the leaders in the world of finance. S ge U l 1 1 N Fred bo h sid s of college life, I the intellectua and the social, and fused are admirably co ,bin into a harmonious whole. As a student he has few equals, for the vision of a useful and successful medical career has spurred him to greater efforts in the field of science. No dance or social gathering is complete without him and his pleasing disposition and goodfel- I lowship always makes him wel- come. Good luck, Fred, and may those qualities which have distinguished you here at Fordham, win you the respect and admiration of your companions in the future. FORD!-IAM I Faunnxucrc C DETROIA B S Barringer High School Mendel Club, 1, 2, 3,' jersey Club, 1, '2, 3, 41 Cbemirtry Club, 4,' Tennir Team, 1,' Swimming Team, l,' Italian Club, 3, 4: Sodaligf, 1, 4,' Ffencb Club, 1, 2,' Freshman Forum 94 ' RAYMOND DIEHL, A.B. St. .Iohn's Preparatory i Sch ool Partlrcnian Sodality, 1, 4.' French Club, If lflfftlfllflfdl l Barkerball, If Upstate Club, ' 7 4, Vice-Prcxident, 4,' .Quill V . Club, 2,' St. john Bcrchmanu l Anodality, 1, 2, 3. 4,' Council of l ' " Debate, 4: Initiation Commit- ' Q W tee, 4: U p.rtatc Dance Commit- ! tu, 4 EE., C11 EW ii vf, ll 'W ill 1 95 A 5 lt 'l'll un 't'l o f l l l ' v-.A 3' 1 al v i ,Wi 4 funn ' : U z "' lo I. LWAYS to be ound in the centre Aof a laugh: ng group, Ray is the possessor ofa quick wit and a gift of pantomimicry that at times has his audience on the verge of hysteria. Here is an antidote for gloom if there ever was one. And now that we have reached the turning of our ways, when dis- solution is about to interrupt our four years of learning, it is with a feeling of profound regret that we bid "adios" to Ray. Yet, we rejoice in the fact that before him lies the inevitable reward for work well done. it i IV I WE suspect t at the spirit of the age i which "Di" lives is so uncongfnial to his free, independent nature that his silent masque is but the expression of his whole-hearted contempt for it and all the blatancy for which it stands. "Di" is a lover of the classics and has acquired a vast fund of knowledge from his extensive classical readings. Therein he secs the most satisfactory expression of man's spiritual yearning and feels that a return to its simplicity is sorely needed in this Twentieth Century, work-a-day-world. FGRDHAM I FERDINANDJ. D1G1UL1o, A.B. Evander Childs High School Spanish Club, 21 Immaculate Conception Sadaligy, 3, 4 916 FORDHAM RAYMOND-I. D1s1c1N, A.B. Regis High School 97 ! sulg Ilml Riffs most tabld character- istics are t e brilliancy of his mind and the k enness of his wit. With these gi ts he has carved himself a niche in our memories, which no mere passing of time can erase. His flashing thrusts of hu- mor have never failed to delight his audience and he is a welcome addition to any social gathering. But it is in the field of scholarship that Ray is best known. His fault- less reasoning has made even the most difficult problems appear ridiculously easy. We part, Ray,yet,knowing how splendidly you are equipped for life, we are confident of your suc- CCSS. l gm ll. l We have in! our midst a gentleman who answers to the somewhat expressive appella- tion of Dulce. Duke is the kind of a fellow whom everyone respects and uses as a personal conficlante. Such qualities as he possesses as- sure him of success in the future, but success can never be half so bright or half so great as his old friends and comrades would wish for him. As we turn the leaves of mem- ory and "sec the smiling faces of friends that we have known" a score of pleasant memories will recall Duke. FORD!-IAM l WILLIAM P. DIVINEY, A.B. Regis High School sodaliiyi 1, 2, 3, 4,' Vigilahcc Committee, 2 98 FORD!-IAM 'nu' ll XVALTER G. DONNELLY, A.B. Brooklyn Preparatory School Amirtant Manager of Foot- ball, lj Spanirb Club, 1, 21 Mendel Club, 32 Bf00l2lJ"l' Long Island Club, 3, 41 5'0- daligf, 1, 2, 3, 4: Rifle Team, Z,' Iuterclau Barebull, 4 l 99 iilfu ull , f fmlg I 5 I . ALTER'S osen profession is mediciir and it is with a singular correctness that his aspir- ations bend thait way. A gentle- man of the Newman type, kind- ness and humility are among his assets, and never has he been heard to utter a harsh word against anyone. What a heritage to leave behind! To know that he bears with him the esteem and goodwill of the class, to realize that we are all "rooting" for him, who so loyally and unstintingly rooted for us, is all that we ask him to remember. v im X l i I i I f I i ii lllleiii Iii l i A li , i , t i T is a sad fact that some men we I meet will soon lleforgotten. But our memories of Ed will always remain. For it was his healthy exuberance which entertained us, his strength of character on which we depended, his sage advice to which we turned. For Ed possessed these gifts, and unselhshly placed them at the dis- posal of others. So we take this opportunity to pay tribute to this sterling character who would rather have had the story of his good work kept in the shadow of his modesty. il EDWARDII. DOYLE, A.B. Xavier High School Interclfzu Basketball, 1, '21 sazazm, 1, 2, 3, 4 100 F RDHAM i . nf i lllln I it M,.n-warp FORDHAM W1 l JAMESJ. DOYLE, A.B. Regis High School Sedalizy, 1, 2, 3, 4: Fmbmfw Forum, Trea.rurer,' Freshman Ba.rebezll,' Vigilance Commit- tee, 2,' Interclmrx Basketball, L' Interclau Baseball, 2 101 .'::.,'ll l ERRY has eve surrounded him- J self with a r serve that almost defies penetration. But beneath this placid exterior he hides a truly affable and likable nature. To this his countless friends will all testify. Even in his studies this trait has been exhibited. Never in any sense ofthe word a ' 'gtind," he has mas- tered without undue exertion the most difficult problems that phi- losophy could present. is il ILL has lzhat i tar some- B thing, which for want of a better word, we ill call charac- ter. It is this trlait which has earned for him the respect and ad- miration of his friends. Individuality of thought and independence of action mark him as one far above the average. Whatever Bill attempts, his per- sonality stamps as his own. The delightful combination of humor and sincerity are so blended in him that he is genuinely likeable and a real friend. L FORDHAM I WILLIAM S. DRESCHER, A.B. Fordham Preparatory School Editor-in-Chief of MAROON, 41 Secretary Freshman Short Story Guild 102 FOPXDHAM I ig .ll l JOHN C. DUFFY, A.B. Brooklyn Prep. solidify, 1, 2, 3, 4: Brooklyn- Long Irlanrl Club, 3, 4,' MA 1zooN Stajjt, 4 103 I l Y 0 EEN-MINDE and lregular, are K the word which best de- scribe John. Being the honor man in his class in Junior merely made his smile the brighter and his "hello" the friendlier. There has always -been about him a boyish eagerness to accomplish some- thing. This, perhaps, explains his four years of academic triumphs. The teaching profession is call- ing John. All it need ask to be benefited by his entrance into its ranks, is that he apply his bounti- ful talents in the same generous Way he did at Fordham. l I I I l l 1 1 Trecognize in him a rare char- acteristic. It is a certain broadness of mind by which he finds, not pleasure alone, but also intrinsic value in all the phases ofa young man's life. He studies energeti- cally, he plays with enthusiasm, and his conversation abounds with sound opinions that lack any taint of prejudice often found in youthful minds. One such as Lou who can appre- ciate all the advantages of our age is indeed unique, and wemay add, fortunate. It is certain that he will derive the utmost benefits from life. 5 D ' ' Hose wl'lo kn w Lou, easily Louis M. DURSI, A.B. Fordham Preparatory School Sophomore Smoker Committee: Harvester Club, 3, 4,' Council of Debate, 4,' Glue Club, 4,' Intercollegiate Contest, 4,' So- dulity, I, 2, 3, 4,' MAROON Stujf, 4 104 FOR D H A M u ,III llll l A Fonou m ' 2 an llll l It ll' THOMASJ. EARLY, A.B. Dickson High School Sadaligf, 1, 2, 3: French Club, 31 Penmylvania Club, 1, 2, 3, 4, Trearurer, 2, 41 MAROON Staff, Advertising Manager, 4 105 1 Full H fill 1l"il ARDINAL NE MANQS definition C of a gentle an is rarely per- sonified in ever detail, but that definition alone, adequately ,por- trays Tom-always agreeable, ever considerate and kind. His quiet- ness is the result of cultured asso- ciations, his humor is born of pro- priety. Because he allowed few to pene- trate his silent, gentlemanly cloak, few really knew him, but those that did met the perfectness of true gentility in every respect, under all circumstances. Sincerity, founding his intimate friendships, welded the links in his chain of friends so strongly that it will al- ways endure. la' F DHAM I 'V Ill nm ANY tire t e friends, and M many are e happy asso- ciations which N ls leaves behind him at Fordham. lflow could he do otherwise with such a genial dis- position and such aspirations to urge him from one success to an- other? The merest glance at his activi- ties show how all-inclusive is his genius, but the thing we remem- ber is, that always, be it in the role of the scholar, dashing com- mander of the R. O. T. C, battal- ion, or suave and fluent master of ceremonies at a French Club func- tion, he was the same steadfast friend and classmate. So here's to you, Nels, as we say "Farewell!" NELSONJ. EDGE, A.B. St. Peter's Preparatory School Frencb Club, 1, 2, 3, 4, Vice- Prexulent, 3, Preirident, 4, Frencb Club Year Book, 3, 4, Editor, 4,' Rifle Team, 1, 2, 3 4, Captain, 3, Manager, 4: Ojfcer: Club, 3, 4, Secretary, 4, Quill Club, 1, 2,3,4,' "Montb- bf"5'tajj',4,' Councilof Debate 1,2, 3, 4,'NewferseyClub,1,2 3, 4,' Dance Committee, 3, Secretary, 4,' Playrbop, 1, Z, 3 4,' Partbenian Sodality, 1, 2, 3, 4,' St. fobn Bercbmanlf Soalality, 1, Z, 3, 4 106 FORDHAM ADAM F. ELCEWICZ, B.S. Rindge Tech Ff'6'.l'l7772d7l Football: Fresbfmzn Ba.reboll,' Vormy Football, 2, 3, 4,' Vmtrity Bareboll, 2, 3, 4,' Mo.r.rocla1z.rett.r Club, 2, 3, 4,' Captain Boxeball, 4 107 W all my: , I 9 . suAL1.Y the ost huiet person U on the ca pus, with just a little coaching Adam could be turned into a cqmedian and enter- tainer of rate talent. His wonderful record as an ath- lete is well known to everyone. On the diamond and on the grid- iron his work was superlative, and this same spirit of excellence pervaded everything he did. For all of his unobtrusiveness, his class record as a student easily matches his athletic achievements. His mature judgment on all things eminently qualified him for the position of adviser extraordinary to all or any of us who were in trouble. QM I l Y I 'V 'IIII 'll HE terrri, "fo r-square" man, Tcan be aptly applied to jim. He has always m naged to strike such an even balarice in his actions that he has made a friend of all whom he has met, and 'it can be his worthy boast that this friend- ship has never faded. He is indeed a friend of the type that Shakes- peare put in the mouth of Laertes, "Those friends thou hast and their adoption tried, grapple them to thy heart with hoops of steel." Keep this penchant for winning friends, Jim, and you are sure to remain the object of admiration and respect in coming years. FORDHAM I JAMES FAGAN, A.B. Brooklyn Preparatory School Manager of Golf, 41 Sodality, 1, 2, 3, 41 Brookbn-Long IJ- land Club, 2, 3, 4 108 FOPNDHAM Illl I I N WILLIAM H. FARRELL, B.S. Aquinas Institute St. john Berclamanhf .S'0daliU, 2, 3, 4,' Amimmt Baseball Manager, l,'2,' Ojiwff Club, 3, 4,' U prtatc Club, 4: Mendel Club, 2 109 ml! f I F the colle c mail it can sel- G dom be sai that his chiefest sin is that of over-generosity. Yet of gnomic Billl such a "sin" is aptly predicable. Even when dis- gruntled be the "arrows of out- rageous fortune," his thoughts are tendered to others, and his "pangs" seem to be soothed by rendering service to his fellows. It is for us who had the pleasure of close association with him to try to express in a few futile words some notion of the gratitude we experience for his generous fellow- ship, some admiration we feel for the entire man. l i'fllll rl: :fill l V n 5 s l 5 I l l ITERATEUR a d man about L town, Frank an be likened to a polished diamo d. He was bril- liant, gleaming with wit, and his presence was always a stimulating tonic. A debonair dilettante, he dab- blcd in the arts. Music, poetry, thc classics-all these captured his in- terest. His critiques of modern poetry are among the finer mem- ories of our days at Fordham. Few men are found with so ap- preciative a knowledge of the arts, with so fine a view oflife. We who appreciated these qualities, will always remember Frank as the impeccable, cultured gentleman. FOPXDHAM I l l FRANCIS FAVORINI Xavier High School Italian Club, 3, 4 110 FORDHAM III um VINCENTJ. FAZIO, A.B. St. Mary's High School St. Charles' College Xt. fobn Bercbmank Sodality, 3,' Partbmian Sodality, 3,' Mendel Club, 31 New f"'J'0' Club, 3, 4,' Chemistry Club, 4: Italian Club, 3, 4 111 wig iiiliml ll l E is a sL+'iny-disposi- I-I tioned tell w. Coming to us in Junior year, he has in a rela- tively short ti e won the friend- ship of many. glibc Maryland sun- shine has left its print upon him. V i n c e n t , however, is serious- mincled when the time for jocular- ity is passed. He studies-andwell. From him have come no excep- tionally coruscating flashes of in- tellectual brilliancy, but rather an evenness which is more to be desired. I In two years he has attuned him- self to the true spirit of Fordham. Such adaptability will be an in- valuable asset in his chosen pro- fession of medicine. I , l l i I PTIMISM first ip itself 0 to us as a concrete qualifica- tion and truly adequate personifi- cation, when foui' years ago Joe carelessly swaggered along the "elm lined path" of Fordham. His attitude was most gratify- ing and soothing to his Freshman classmates and they observed in Joe a veritable gold-mine of knowl- edge-whose ingenuity perceived fallacies, profound or otherwise, in all problems. A difiiculty? Well, delay no longer, if it is your earn- est desire to arrive at the proper solution, call out, "joe, G Joe, come here a moment." He comes and the difficulty is solved. FORDHAM I JOSEPH FENNELLY, JR., A.B. Brooklyn Preparatory School ' Freshman Swimming Team: Vanity Swimming, 2,' Cgun- ci! of Debate, 2,' St. Vincent dePaui Society, 3, 4,' Parthe- nian Sodality, 2, 3, 41 Brook- lyn-Long Ifiand Club, 3, 4 112 FORD!-IAM IH nu EDWARDJ. FENTON, A.B. Evander Childs High School Immaculate Conception Jada!- l ity, 3, 4,' French Club, 2 113 .ll and last seem- ingly shun limelight in the calm of their studies. Although this group somewhat evade the of their fellow students, we often find among them extremely interesting per- sonalities. Edward comes under this category. Of an unassuming personality, he exemplified a con- scientious learncdness which im- pelled a deep respect, and yet his wit added an informal touch, a mellowness to his sincerity which was admired by his friends. With such ability to concen- trate as his, Edward will without doubt be able to face the future with no uncertain degree of suc- cess. gym ' V I is we are up our impres I sion of Ji, we wc immedi- ately select the or.. congenial. We do not kno whether he affects environmdnt or environ- ment affects him, but we do know that he always seems satisfied, and that everyone near him appears the same. Not only can Joe say: "I have no enemies," but he can even go further and say very positively, "I have friends in the academic world, in the athletic world, and in the social world." We predict for himva most suc- cessful career in law, his avowed profession, and we congratulate him upon it, for we have ample evidence of his fitness and ability. FORD!-IAM I Josapn M. Flcco, B.S. DeWitt Clinton High School Italian Club, 3, 4 114 3 W x FORDHAM I y III 1 ml l ll- ll' JOHN S. FIELD, A.B. Regis High School "Ram" .S'mjff,1,2,3,4,5'p0ffI Editor, 4: Sodality, I, 2, 3, 4 I 115 i wig llHill" Luthlzr "-either coops" or S will do-is! probably best known to most of us for his superb handling of theisport department of the Ram, and for the ever inter- esting comments and anecdotes in his weekly column, both of which indicated talents that are usually found in a man of more advanced age and wider experience. Perhaps we shouldn't say "wider exper- ience" at that, for there is hardly an athletic contest that doesn't number "Luther" as one of the spectators. The newspaper pro- fession will surely profit if he elects to enter it. u v v I E l HEN, balk a d . forth we meet "Flash," W? are of the poem that ends, "--and be a friend to man," "Flash' ' good-natured 1 . really exudes friendliness ever ned in story and song. While not attracting 'headline attention, Frank possesses those qualities which add to the integ- rityand steadfastness of character, qualities which strengthen and build those affairs which he under- takes. To wish him good luck would be to become redundant, we can hope that the passing years will serve to brighten his life in all re- spects and continue his amiable existence. FRANCIS J. FLAHERTY, A.B. Clinton High School Freshman Foothallj Chairman Sophomore Vigilance Commit- tee! Massachusetts Clnh, 1, 2, 3, 4, Treasurer, 2 116 FORDHAM ian! FORDHAM I Louis A. FLECK, A.B. Richmond Hill High School txbddlibty, 19 29 3: 41- Mendel Club, 3,' Council of Debate, 4: Harvester Club, 3i Bf00kUW' Long Island Club, 3, 4 117 I U Y 0 T is said that ne miist live with I a person befo e one really knows him, but once' you have heard "Louie" talk, and have associ- ated with him a while, a feeling of utmost friendship and securitywill surround you. Tall and handsome, "Louie" combines a sympathetic and an understanding nature, which probes beneath the veneer of superficiality, with a depth of personality. The medical world will profit greatly by his advent into it, since his determination, ability, and goodwill must spell success for him. Ill! ip I ma old Cice on problem Tconfronts us gain, not where to begin but howl best to find an ending within the space allotted. The maxim, "Quod facis, bene fac," seems to permeate Artie's whole being. A friend to the maxi- mum degree, he has concentrated in him all the sterling qualities that go to make up a real man. Whether on the basketball court or in the classroom, he pursued his objective with a grim determina- tion that is worthy of praise. Combine these qualities with a genial irresistible grin and you have a true picture of Artie. l WI FORDHAM I ARTHUR E. FLOOD, A.B. Xavier High School Sodality, 1, 2, 3, 4: Frerloman Forum: Broolzbn-Long Island Club, 3, 4,' Dance Committee, 4,' Haroeftcr Club, 1,' Propa- gation of the Faith, 1, 2, 3, 4,- Vi gilance Committee, 2,' Mimey ' and Mummers, 1, 2 118 Fonnnw vi I ml l l ELM1211 1. FOLEY, B.S. ll Swlalzfy, 1, 2, 3, 41' Bfvvkbfl- Long Island Club, 3, 4 Erasmus Hall High School ,Q ,2- l ,rm is i, 2 if Ill ,ll img fa l ' l ' ,ll FLASHING s ilc which Cliffuses A itself, is oAly one of Elmer's many qualities Bavhich have made him popular here at Fordham. He is one who took Fordham's motto "Sapientia et Doctrina," and made it his own. Elmer, we have been told, has chosen for his field, teaching. We arc sure that he will, in days to come, with his keen Irish wit, brilliant smile, and level-headed reasoning, come into his own. We know that success will attend him, and at parting, we shall hold the memories of our days together at Fordham amongourmostplcasant. L,-so ll' i .111 I ony tput, trai - ing the snap- back of the Pat has made his tackle. We've seen him it for three years of Varsity and seen himrevvatded 'with the laurels of "All-American" in his Senior year. 4 On the pitcher's mound, pos- sessed as he is of an unrufflcd calm in a tight spot, he has struck out his opposing batter with regular- ity. ' Pat is the man, the athlete, the student, the perfect combination -the Hsummum desideratumf' If after graduation, his good fortune is in any way commensurate with his demonstrated ability, he will be a very successful man. FORD!-IAM i FRANCIS P. FOLEY, A.B. Hebron Academy Freshman Foatballj Varxizjy Football, 2, 3, 4,' Freshman Barelallj Varying' Bmeball, 2, 3, 41 Interclam Ba.rketball,4,' Maxmclouyetts Club, 1, 2, 3, 4 120 FCRDHAM I in I JAMES T. FOLEY, A.B. Troy Catholic High School Upstate Club, 41 Pdffbmifm Sodaliny, -ly 23 31 4 l 121 EXPRESSIONS subt e humor, an unruffled aiu un isturbed na- ture are a ble parts of Jim's P . personality. He is ever satisfied with his particular fate-what- ever it may be. It is because of this thatjim has never experienced any difficulties as a student and has never been wanting in friends. His unassuming attitude only conceals his possibilities as a cap- able and eflicient leader. The facil- ity he shows in analyzing scholas- tic problems is certainly a worthy characteristic, typical of the clear thinker. This fortune We wish him-that he be as successful as a professional man as he was as a student. il il' i ET a ne boo be published and you can rest assured John will be the proudlpossessor of it. We know not of al greater lover of biography than John. V But we like him most of all be- cause of his pleasant nature, con- versation with him is the best cure for the "blues," so infectious is his chuckle. He has made the somewhat 'long and dreary class day merry for many, and because of this, Fortune will smile also upon him and fill John's cup of success to overflowing. FOR D H A M u ,III llll n Il JOHN D. FOUNTAIN, A.B. Xavier High School Spanirh Club, 2, 3, 4,' Braak- lyn-Long Ixland Club, 3, 4,' Promoter of League of Sacred Heart, 4 122 FOPXDHAM -N l ' 'IOHN FULLAM, B.S. Brooklyn Preparatory School . Sodality, I , 2, 3,' Boxing Twin, 2,' Gln Club, I, 21 Brookbn Long Islam! Club, 2, 3, 4 123 u 0 I ui iNG'his c 1lbge,course,.Iack D has been h ld in igh esteem and regard by h s clas mates, who soon came to re ognize in his radi- ant smile and su ny disposition an indication of the genial warmth of his personality. Never have we known Jack to wear a frown. He was always the same, cheerful, easy-going and good-natured. Yet, this gentleness could be quickly turned to clear-headed aggressive- ness, asjack so often manifested as a member of the boxing team. His is the resilient nature that can stand the hardest blows and can rise again, smiling and eager for a new contest. Battle life as you fought here, Jack, and you are bound to win. .Il. lite il l I 1 I 1 FORDI-IAM l THOMAS P. GAINES, A.B. Tappan Zee High School Immaculate Conception Soda!- iU', 1, 2, 3. 4 Us'r as inl an my there is a J Joffre or a Turr ne who has the trust and esteem offhis men, so also there is in a class a Yellow like Tom Gaines. By his friendliness, Tom has Won the love of his classmates and by his intellectual keenness of thought the admiration of his as- sociates. Each moment spent with Tom has made our memories richer in true worth. Thus it is with a real pang of sorrow that we real- ize that after Commencement we shall be deprived of his daily com- panionship. 124 FORDHAM FRANCIS L. GALLAGI-mn, A.B. Cathedral College Immaculate Conception Saddl- jty,1, 2, 3, 4: Baxelmll, 1, 2. 3,' Muimming, Zi Tfmli-fi 47 Brookbfn-Long Ixluml Club, 3, 4, Cblli7'7I2d7l Bl"00kb'7l-Lmlg Iklmm' Dance, 3 125 Ill l i :sell yr X oun years at A ordhitm have won Ffor "Babe" la host of friends. We need not Search very far in order to discover the reason-his congenial personality plus an hon- est and sincere interest in his friends' welfare4is the cause. Commencement will disband the Class, but not our friendship for him. The thought that we may meet others of his ability and genial nature somewhat tempers our sorrow. Here's to "Babe" and his golden smile. l t 9 sw! l I H l I , l I ll l I 1 . 4 l Hnouon UT hi four years here Tat school, Bill i as always been connected in somefway with some school activity. He is not the type that broadcasts his accomplish- ments but who nevertheless makes his quiet presence felt by his actions. In Freshman it was baseball and after that it was tennis and the stage crew that drew his atten- tion. Under Bill's capable manage- ment the tennis team was emi- nently successful. Knowing Bill as we do, we feel confident that he will as readily cope with the difficulties and ob- stacles that are bound to confront any ambitious young man. FORDHAM T lil., if WILLIAM A. GANEY, A.B. Brooklyn Preparatory School - Tezmif, I, 2, 3: Nlemezger, 41 Vijilmzce Committee, 2,' Heer- 1'e.fter Club, 1,' Sedeelizfy, 1, 2 3. 4,' .Yteege Crew, L' l7re.rbmem 1 l?r1.rel1eell,' I17tercla.r.r Barker- lmll, l 126 I , , ll l A 1 'F pl, FORDH M 1 y us llll josism-1 D. GATT1, A.B. Hackensack High School Band, 1, 2, 3, 4, LCWIW, 3, 4? Orclaeetra, 1, 2, 3, 4, Prefi- dem, 3, 4,' Menelel Club, 3, 4: St. john Bercbmanlr Soelal- jey, 2,' Partlaenian Soelality, 1, 2, 3, 4,' Italian Club, 4, Vice-President, 3, Pfwidffff, 4,' Manager of Intramural Sports, 4,' New fvfffiy Clubw It 2, 3, 4, Dance Committee, 4,' Chairman of Boarder.: Initia- tion Committee, 4, Pretidwf of Boarderx, 4,' MAROON1 41' Senior Week Committee, 4 127 HU' l I l u I I I I nm: we ha c a mln that has a H true feeli g for the higher things of life. 'oe's aesthetic ap- preciation of the line arts, especi- ally music, is of the highest order. Withjoe as the student leader, the distinguished Fordham band rose to its greatest heights. He is full of life and vigor and his ability to lead men is readily recognized. Medicine is his chosen profes- sion and it is with singular preci- sion that he has made this his choice. Undoubtedly when the hosts of the successfulcome march- ing forth joe will again be among the leaders. gym I z ' ' Ill 1 . 'llll N every clliss th re are a certain I few whose ac ievements are masked by a mantll of dignity and reserve. But always they have the admirable quality of being better liked as they become better known. Such a man is John. A scholar of more than passing ability, he has taken an interest in his own quiet way in all the activities that Ford- ham calls its own. As a friend and a fellow classmate he has won our hearts and his departure leaves a space that time will End very hard to fill. FGRDHAM I JOHN P. GAVAN, A.B. Regis High School Sadaliy, 2, 3, 4,' Freshman Forum: Council of Debate, 2, 3: Interclau Beuketball, 1, 2 128 ORD!-I l' i L l Glcoizou P. Gmzvals, A.B. Lowell High School I 129 1 I U Z Ill 1 f nl' I l ' I I ESERVEDNESS and relineinent are adequa cly e einplihed in "Chic." His ta iturn and irenical propensities haife unquestionably characterized him as a gentleman of unusual potentialities. His na- ture, pre-eminently suave, mani- fests a person of moderate savoir faire. He is superior to, and mas- terful of diflicult situations. Com- bining a debonaire disposition with an orthodox insight "Chic" commands the admiration of all his acquaintances. The journalistic world relent- lessly stretches forth her hand to consume "Chic," for his is a pro- lific pen. He will he an honor to the profession. ,ll lil gm ill. I 'r seems that the pass of time I never weighs upon those who can enjoy so many and different pursuits. And surely this clebo- naire and urban gentleman known to us as Dan can do just that. We've never met a man who can enjoy Tennyson and almost in the next breath discourse upon the merits of the best show in town or popular orchestras as Dan can. His intelligent and wide outlook on life promises a pleasant future. FORDHAM I DANIEL M. GILMAR1'lN, A.l3. Brooklyn Preparatory School Partbenian Soelality, 1, 2, 3, 4,' Freebman Baseball: Band, 21 Frerbman Workrbopj Brook- lyn-Long Island Club, 3, 4: Senior Week Committeej Inter- clarr Baseball, 2, 3,' Interclam' Football, 2,' Interball Barker- ball, 2, 3 130 FORDHAM llll I ll I ll I DANIEL A. GILROY, A.B. l wig ,ill Illlf "' N an 5 " Xavier High School Sodalizy, 1, 2, 3, 4X B"00kb"1' Long Island Club, 3, 4, Ddflvv Committee, 4 131 HE most o standing charac- T tcristic in D n is his loyalty- loyalty to his friends, classmates and to his college. When anyone wanted to know anything about the college in general it was to "Big Dan" and his inexhaustible fund of information that they went. His happy smile surely does not belie his inward self. We were all aware of his cheerfulness and many a conversation was drab until Dan came along. His willing- ness to help others certainly will bear fruit and without doubt he will forge to the top in his chosen endeavor. fl I ' Ill ms excecuingi handsome man Thas the quiet nassuming per- sonality that sta ps him as a true gentleman. His qllietness does not mean that he has no intellectual keenness. On the contrary his si- lence is a golden silenceghespeaks only when he has something wor- thy to impart to others. This trait should prove of inestimable value to him in the profession he may choose to make his own. The class reluctantly bids farewell to the man who has been one of our inti- mates for four years. FORDHAM I G1No L GIORGINI B S Amityville High School Italian Club, 3, 4, Secretaqy, 4: Mendel Club, 2,' Broakbfn- Long Island Club, 3, 4,' Cbem- imgf Club, 4,' Interclass Bax- kfffbflll, 1, 2, 31 Freshman Baseball 132 FORDHAM I EDWARD GIORGIO, A.B. Xavier High School Sodallty, 1, 2, 3, 4,' Band, 2, 3, 41 Orebestra, 2, 3, 41 Frmd? Club, 3,' Italian Club, 31 Coun- cil of Debate, 4,' Brooklyn- Long Lrlanel Club, 3, 4, Dance Committee, 4: MAROON Staff, 4,' Frefbuzau Forum! Harvest- er Club, 2 133 II I I D has man attrilnutes which E are worth of mention. Not the least of the e is his cver-cheer- ful clispositionl It can be truth- fully said that Ed has never uttered an unpleasant or harsh word while he has been among us. Besides having more than the usual share of good looks, Ed has a depth of intelligence and a personal charm that is really refreshing. Now, when we come to the parting of the ways, we realize, with a sincere regret, that we are losing a real friend, and we can only smile sadly as he departs. IMAGINE a arga tua laugh, a heart in propo tion and you L have a composite pict' of Mar- ty. But this picture is incomplete. It makes no mention of his de- lightful sense of humor, of his diverse talents. For Marty possesses that culture peculiar to the well-read, widely- traveled man. A brilliant conver- sationalist, a perfect man about town, he was welcome every- where. This is the Marty Whom We have come to know, the gentle- man, the perfect companion. The judgment of students is ever a criticalone, and Marty was ac- cepted as one of the best of us. MARTIN GLATZMAYER All Hallows Institute Golf Team. 3 1.34 I FORD!-IAM III l un ll FORDHAM ll .sl u ll Ill MARTIN GLYNN, JR., A.l3. ' Brooklyn Preparatory - I School I Frerhmun Forum: Council of ' Debuts, 2,' Mendel Club, 3: Brookbn-Long Irlund Club, 4,' "Monthb1" Stuff, 2 135 :::.g'l ,ii elf fl" I ARTIN is t a llifficult man M to clescri e. He is at once charmingly open and a man of genuine intellectual ability. In him there is none of the snobbish- ness so prevalent among young college men. Simplicity and gen- uineness are the keynotes of his character. Martin will be a physician and we can unqualiliedly state that he will be a good one. He has the calmness of nerve and the proper self-confidence which are the prime requisitcs of any good doctor. With this in mind some day we will be able to say, "I knew Dr. Glynn when . . ." 5, Prequisites of a yone in search of a perfect gentl man and a true friend. He, whose hrmour is plated with Fortune's choicest gifts, whose friends are many and true, need never fear the years ahead, for no ill can, befall him. Secure indeed is Peter Goetz. From what we have seen of Pete, we can predict for him a life of conquest-of conquest over whatever obstacles befront him, and the reward of conquest, a triumph-a triumph made glori- ous by the many he has enchained in the bonds of endearing friend- ship. A K , l ETE, we lcnow will satisfy the FORDHAM In Ill Illl PETERJ. GoETz, JR., A.B. Brooklyn Preparatory School Sorlality, 1, 2, 3, 4,' Brooklyn- Lonlg Iflond Club, 3, 4,' Brook- Ufl-Long Irland Club Dance Committee, 3 136 FO ll D H A M I ul llll ll VINCENTJ. GORMAN, A.B. Brooklyn Preparatory School 137 I GENIAL s le, a wonderful A nature, an excellent student, an all around 'good fellow, we could go on forever singing Vin's praises-but there is not enough room. Hereisamanwho,we know, will honor Fordham's name as long as he lives. Rather proficient at history, he expects to carve his name in the Hall of Fame as a pre- ceptor of this subject. But his geniality and his studies are not his only attributes. Vin is an ar- dent tennis player and quite a swimmer. When Vin goes forth to teach history, we know he will carry Fordham's respect with him. I I I u I I 1 I Um' was! rese ed and quiet, B but when t occasion de- manded, could speak intelligently and clearly. Beneath his mask of silence there lay the traitsiof sin- cerity and understanding. In Freshman, Burt was a mem- ber of the track team, but was un- able to continue this activity throughout the four years. His efforts on the debating team were well attested to by the success of that institution in its various con- tests. We who have been intimately associated with him, regret part- ing-yet we are glad to send him on the assured path to success. FORDHAM I HUBERTJ. GREEHEY, A.B. Brooklyn Preparatory School Brooklyn-Long Island Clab, 3 41 Frerbman Track: Sodallzjy, 1, 2, 3, 41 Council of Debate, 3 Mendel Club, 3 138 I 3 I 2 ua V I llll' I DAN11.L M GRI LN A B All I-ltllows Institute Frarlmmn Plqy.rbop,' R. 0. T- C. Qmcenr Club, 3, 4 nu Ill I FOR D H M an i nu I 139 D NAMIC p rsbn. ity with a A keen app eciat' n of the really line thi gs i lifeg these words best ext ess the character of Dan. To those few who really understood hini, Dan was a IUOSI agreeable and sincere friend in all that the term implies, and a schol- ar of unlimited ability. His mental prowess was finely balanced by a keen sense of humor which dimin- ished formality but did not de- scend to mere convention. To con- verse with Dan was to learn some new aspect of an ancient problem or a subject of contemporary inter- est. Engineering seems to be Dan's life work, a profession well suited to our able friend. al slum WHEN 'one hinks of the scholastic cadets in the class, Jerry is alwa s given a prom- inent place among them, and not without reason. For from,Fresh- man to Senior he has been emi- nently successful along scholastic lines and although that field is of the greatest importance, he has not confined himself to it. Jerry's pop- ularity ancl appealing personality was amply verified when he was chosen to fill the office of Chair- man of the Brooklyn-Long Island Club's Dance. The medical profession is Jerry's choice and we all feel . . . Well, read the above again. FGRDI-IAM n GERARDJ. GRIFFIN, A.B. Brooklyn Preparatory School Clam Basketball, 4,' Mefzdgl Club, 3, 4,' Council of Debate, 3: Sodulity, 1, 2, 3, 4,' Bmgk- lyu-Loug Iylund Club, 3, 4, Dance Chairman, 4,' MAnooN Stuff, 4 140 FORDHAM JOHN B. GRIFFIN, B.S. Regis High School Frerlammz Forzzmj Sadality, 1 2, 3, 4,' Freshman Workshop: Vigilance Cammittes 1 41 JOHN has. fo himself the reputation f be ng one of Fordham's m t loyal rooters. No matter how far the team might journey away from home, John was sure to be present at game time. He was a familiar sight about Worcester and Boston cele- brating Fordham victories in bc- fitting fashion. These long and tiring journeys did not prevent John from being an earnest student. In fact, an examination of his record will show that he stood well up in the Class. His enthusiasm and capabil- ities will make him an alumnus of whom Fordham may well be proud. sl FOPXDHAM I H lllllalil WERNER B. GUTENBERG, B.S. Collegiate Preparatory - School Connecticut Club, 1, 2, 3, 4,' of'tha type, ' ERNE is whicl1r contacts, woes, once alleviate ou submitted to his they sink to the rank the trivial. His fine personality :ind friendliness have been live factors during our college days and will be remem- bered always. Within this classmate, lies the student, calm, judicious and thoughtful, with a record of con- sistent good scholarship. Be the occasion academic or social, he was willing to lend whatever aid he was capable of. i This friendship is one to be valued, let us hope that it be one that years will not fade nor glory dim. I Pezrtleniem Sodezlity, 1, 2, 3, Prefect, 4,' MAROON Staff, 4,' St. felon Berelomanlr Sodezlity, 1, 2, Master of Ceremonies, 3, 4: Vigilance Committee, 2,' Freshman Forum 142 FORDHAM lx lll llll RUDOLPH L. HANISH, A.B. Xavier High School Blessed Virgin Sodnlity, 1, 2, 3, 4,' Freshman Forum! Fresh- man Short Story Guild: Fresh- man Bn.reball,' Braokbn-Lang Island Club, 3, 4 143 :Rl I wig llll UDY is the pe ol fellow who takes all sks, hard though they be, cheerf lly. He is a worker who mu findsl time to play. His good nature and easy going dis- position have won for him the af- fection and the esteem not only of his classmates but of his instruc- tors as well. We feel that we can, 'with all surety, predict for him a future brightened and gladdened by a host of warm, sincere, and worthy friends. The best of luck to you, Rudy. X I I 2 ul 'llll JOHN is the, type inf man who has obtained the ulm1 from his years at Fordham! He possesses a happy knack of assiaying things at their face value, and his attention is never centered on the trivial or the unimportant. His pithy com- ment on every-day life and his large store of knowledge make him a brilliant conversationalist- a man at case in any company and therefore the ideal college man. It would be superfluous to wish him well. l FORDHAM I JOHN A. HARRINGTON, A.B. Regis High School Immaculate Conception Soda!- iiy, 1, 2, 3, 4, Aosixtant Sec- refau, 1, 2, 3, Conralror, 41 Freshman Forumj Clam Bar- ketball, 1, 2,' Council of De- bare. 2, 3: Vigilance Commit- tee, 2 144 FORDHAM I JAMES A. HARVEY, A.B. Meriden High School Cram Country, L' 57- f0l9'1 Berclamuuk Saduliziy, L' C011- uecticut Club, 1 , 2, 3, 41 Mendel Club, 2, 31 Soduliqv, 2, 4 145 my l l v ch p, unassum- JIM is a in ard an innate that rare talent -the ability ask and follow up an intelligent clluestion. Time and again, he has broken up the mo- notony of classes with a searching question from which a lively de- bate has arisen. He is essentially a seeker after truth. Jim is equally interested in sports and has ever been a loyal follower of the various Fordham teams. He is a chap whose friendship everyone is proud to claim. Jim should go far in the world and he goes forth with our 'unqualified endorsement. gentleman. gm f, 1 1 ' I Ill 'llll JOHN is a nlan of ariea interests, which fact is attested to by glancing at the li t above. He is at once a shrewd llebater, a liter- ateur, a scientist, and an amateur playwright. The strange part of it is, that John manages to do all these things well. His keen sense of humor blends very well with the rest of his per- sonality. His clatity of mind and thought have always enabled him to pick out the ludicrous or hu- morous point in any situation. With these attributes to carry him through, John will make his mark in the world. FORDI-IAM I JOHNJ. HAYES, Jn., A.B. Regis High School ' Debating Saciezyf, 1, 3, 4,' Treasurer of Debating Saciezjf, 4,' Harvester Club, 1, 2, 3, 4: Spanish Club, 2, 3,' Track Team, 1, 2, 3: Mendel Club, 2, 31 Sodality, 1, 2, 3,41 "Rain," L' Playsbop, l, 2 146 FORDHAM JOHN T. HEALEY, B.S. South High School Football, 1, 2, 3X NIIIJJWFIW' Jem' Club, 2, 3, 4 147 1 0 Z l A-CONGENIAL ncl elucrgetic stu- dent and thlete-from this alonewe could I cognize"Moco," but we want tolsay more. Four of our happiest years have been col- oredwith the good-natured, quiet, unassuming disposition that was characteristic of him. Always eager to lend a helping hand to a fellow-classmate, his kindness and thoughtfulness won for him a host of friends. We may forget philosophy and other things, but as long as our mind and memory can conjure memories of friends like f'Moco," a charm and a smile not to be du- plicated, college years will not have been ill-spent. fl s. l. Qllll X HEN I ack 6 from Hol, Cross, after having spent his first two years there, we were ihclined to con- gratulate him merely upon his commendable change of mind. But very soon we were to learn that we were the ones to be con- gratulated for having received so line a fellow as jack in our midst. With a seriousness of purpose, Jack has a charming manner that has won him innumerable friends. -Medicine seems to have called him, and if sincerity and ability are to be given their due, success is assured him. I ' I C2l.I'HC EO L15 FORDHAM I JOHN A. HEINLEIN, A.B. Brooklyn Preparatory School Brookbn-Long Island Club, 3, 4,' Sodality, 3, 4,' Mimef and Mammary, 3, 4 148 FORDHAM I . ul llll FREDERICKJ. HELBIG, A.B Xavier High School New ferrey Club, 1, 2, 3, 41 l Glee Club, 3, 4, Concert Corn- mittee, 4,' Intercollegiate Con 16.023, 41' -Slodaliiya 11 21-3a 42 Freneb Club, 1 149 I mlg llil OUR serio -milded friend might hav app ated to the casual observer perhaps a bit too stern for a yout but to those who knew Fred, hel was a gem of a friend. His genuineness and schol- arship heightened one's respect for his sincerity of purpose. All in all Fred was a perfect gentleman under all conditions. Admiration and respect are man's highest hon- ors toward his fellow man's char- acter. Fred was certainly admired as well as respected. Endowed with such gifts as these, Fred will not face the world alone-for sincerity begets sin- cerity in the form of lasting friend- ship-the essence of success. EW V, 'IIII 1 I . Jfsr as a warms of ev ryone, so has the of Bernie into our midst .. .... e--- , the departure of Old Man Gloo , and prepared us for the sunnine s and amicabil- ity of which onlylhe was capable. Throughout his four years, he has held an even keel in all his activi- ties, whether he was cheering the team on to greater heights or whether he was gliding over pol- ished floorsfthe cynosure of other men. With ability to practice the golden mean on all occasions, this A-staid, likable chap has 'come to be recognized as the model of every- thing characteristic of Fordham, a perfect gentleman, a man of char- acter, al fine student, a true friend. ray pf sxlxshi cl FORDHAM I BERNARD HERBERICH, A.B. Marlboro High School MAROON Staff 150 FORDHAM u' ll ANDREW A. HEUGEL, JR., A.B. Regis High School Sodality, 1, 25 3, 41 Freshman Forum: Harvester Club, 2, 3 w 151 l Q rw-wfllllg I l l c A 1 llilzflll W fl Ir we were cla sifyinlg our fellow- students un r types such as in- tellectual an emotional, we would, without doubt, place Andy among the intellectuals. By intel- lectual we mean one of unusual mental capacity not for facts alone but for drawing conclusions from facts. Most of us are inclined to study indifferently. Andy, how- ever, through sincere effort, has overcome this defect and has developed amen tal alertness which at once distinguishes him. Many say that accuracy is the soul of scholarship. If we interpret it thus, then in Andy we have the true scholar. Tis his ,- fl. HE most test of a person uesirani ity as a dinner companion, and i such a test as this Bill rides thr ugh in rare tri- umph. His are the' gifts of aware- ness-awareness of every slight nuance, emotion, and ephemeral feeling, radicatecl in an extraor- dinary sensitivity and giving rise to a most brilliant causerie. We shall picture Bill as the inno- cent sophisticate C slightly Byron- esquej for whom all things exist to be felt and remembered, for whom 'everything is as infinitely alive as Bill himself, the whole world overwhelmingly rich and Bill in- cffably eager-trembling on the edge of every unanswered question. FORDHAM V Ill nu WILLIAM H. HINES, A.B. Brooklyn Preparatory - School Glee Club, 1, 2, 3, 4,' Tennis 1, 2, 3, 41 Sodfzlizy, 1, 2, 3, 41 Mime: and Mammary, 1, "M0ntbly," 3, 4,' Braokbn Long Island Club, 3, 41 Track, 11 MAROON Staff, 4 152 FORDHAM gi, ie. WILLIAMJ. HOGAN, B.S. St. Francis Academy Frerbmfm Track: 'Immaculate Conception Sodality, 2, 3, 41 Brookbfn-Lang Island Club, 4 r 153 I HO GH'blCS dlby ature with I ,wfunlg I I 0 a quiet, un rtur ble charac- ter, Bill has c t a ide path in popularity amo g his fellows. A serious spirit o earnest endeavor characterizes alll he attempts. A true student, his industry in class has enabled him to extract the utmost from his course. A deep student of the game of bridge, one could usually find Bill between classes indulging in this worthy pastime. Many claim that he is even now preparing a book on the more devious ways of playing this widely famed game. However, we do not tie his future success to such a rumor. We feel thapthe future will reward his industry. I Ill l x I I IF the on its most con- tented lookin ' member, Oscar would easily calc the honors. We cannot conceive of him working in an office, for hc ii the personifica- tion of the ourdoor man, especi- ally when he is calmly scrolling about :he campus smoking his aged, blackened briar. We best remember Oscar as the football player. The lmclc who managed to gain through guard, with Oscar in the way. was All- Amcrican nmzcfial. We are sure that Oscar will ac- complish much in his chosen pro- fession of reaching and even more Certain that he will be a source oi' pride to the Class of '31. "ina 'la Oscmz T. I-IOLMBERG, B.S. Brockton High School - Prcrbman Footballj Varxiqy Football, 2, 3, 4,' Boxing, 1,' Marfacbfzrettr Club, 2, 3, 4 154 FORD!-IAM III un l .l. mug Elly... SYDNEY Silarrn nc: remarked that a certain ers was the vanilla of society. .If we may take the liberty, we should like to call Ed the sauce of our potpourri of students. He is that added touch, that extra ingredient which is so essential to flavor of the mass. He is vigorous and active, and the term "vanilla" falls far short in its application to him. There are none of your gently insinuating qualities about him, but there is rather an obvious robustness of spirit and genuineness of worth. FORDHAM In ul llll EDWARD HUNTER A B Cathedral Preparatory School 156 V FORDHAM RAYMOND T. HURLEY, A.B. Fordham Preparatory School saaazw, 1, 2, 3, 4, Fmt Pa- fect, 4,' Frefbman Football, Varrigf Football, 2, 3: Track, 1, 2, 3, 4, Captain, 4, Frefb man Forum: Debating Society 2, 3, 4 157 fitsl the three of a truly edu- cated man than anyone else in the class. ally built, he is one of the best football and track men Fordham has known in recent years. As a scholar, his high rating for four years testifies to the strength of his intellectual capa- bilities. Modest and unassuming through all his success, he pre- sents a figure of what the ideal Fordham man ought to be. Besides this he commands the respect and admiration of the entire class as is shown by his genuine popularity. F: l l u I I I I I Y versally reco ni as pana- ceas for mental de res Tom is an acknowledged dvr A of that philosophy captioned as the ' 'Anti- Mental Depressionists." There- fore it is Tom's unquestionable prerogative to manifest these com- bined qualities in an abounding degree. Theintermittent ludicrous expressions that cmanate from the soul of the altruistic Tom, have enlivened and brightened many a conversation. A May we thank you, Tom, for many joyous moments and may your life be ever pleasant. CHEERFULLESS a d mirth are uni- 'z FORDHAM I THOMAS M. HURLEY, A.B. St. Peter's Preparatory . School New jersey Club, 1, 2, 3, 4, Treasurer, 3, President, 4: Council of Debate, 2, 3, 4 , Secre- tary, 4,' Secretary Atlaleticflsse- eration, 4,' Freshman Forum: Freshman One-Act Plays: St. Vincent'DePanl Society, 3, 4 158 FORDHAM l VICTOR C. HURLEY, B. S. Newtown High School Cbeerleaeler, 1, 2, 3, 4, -fwivf Cheerleader, 4,' Freebfnan One- Act Play.r,' Brooklyn-Long IJ- land Club, 3, 4,'5'wlf1lifJ', 1, 29 Mendel Club, 2,' Senior Foot- ball Banquet Committee, 4, Haroeeter Club, 4 159 I I I I I l l o II ' I I I SMALL of st ture laut large of heart, that s the indelible im- pression we al have of "Vic" after four yeari of happy activity in our midst. The liveliest man in his class, Vic has been the proto- type of perpetual virility and stamina to all who have but watched this big little man. He has played no small part in Ford- ham's triumphs in all fields of sport. His one sterling asset has been his unceasing and successful efforts to keep up the morale of Fordham's countless sport follow- ers. His enthusiasm will ensure him a successful future. alll ff ills IT takes bnlt a f w moments of conversation w th Nels to dis- cover howimanly a cl sincere he is. Quiet and unnotliced, he goes about his daily tasks in a way which has commanded the respect of all his classmates. Nels is the type of man we will want to know in later years. A man of his calibre is bound to 'scale the heights, no matter in what field of endeavor he may find himself. So we bid Nels a fond farewell, only hoping that it may be our pleasure to meet him often as the years roll by. FCDRDHAM I NELs J. JOHNSON, A.B. Evander Childs High School Orchestra, 1, 2, 3, 41 Track, 1,' Cross Cauntfjy Team, 1,' Soda!- ity, 3, 4 160 FORDHAM JOHN W. KEHOE, A.B. St. Peter's Preparatory School Baseball, 1,' Interclau Basket- ball, 1, 2, 3,'.S'0dz1lity, 1, 2, 3, 4 161 Ill 2 i:::.,'ll osssssno of n engLging frank- Pness,Johnni smiled his way to popularity. No one who has come into contact lvith this blond- haired youth has failed to become affected by his contagious smile. But there is more to him than this. Quick of thought, he has the competitive spirit of a natural athlete. With his coolness and self confidence, he has every qualifica- tion for a leader of men. But the note he strikes is his mziuete. With this refreshing char- acteristic, his infectious smile and ready Wit make him a choice companion. i Qllll p N f lill 1' BOWN thi swill current of the years, the name Kelly has al- ways stood for something noble and grand-as it has been graced by men who fought valiantly for their principles either as leaders of a cause or as faithful retiring fol- lowers of a standard. jim Kelly has steadfastly lived up to the highest ideals that his name im- plies and it has been our pleasure and privilege to have been his companions during our course at Fordham. May he always follow the noble and exalted ideals of his forebears. y M JAMES KELLY, A.B. Brooklyn Preparatory School Brooklyn-Long Irlzznd Club, 3, 4,' Sodnlity, 1, 2, 3, 4 -162 FORDHAM I FORDHAM v I y llll vu ll' ll JOHN E. KELLY, A.B. De LaSalle Institute Glee Club, 1, 2, 3, 4. Board of Directors, 2, 3, 4 , Seffefafy, 2, 3, Chairman, 4,' I ntereollegiate Context Group, 1, 2, 3, 4 163 Nw llll l e oHN is best now among his J friends as a si, ger. He is blessed with a most pleasing voice which has been developed to the utmost under the tutelage of Director Joselyn of the Glee Club. It was with the Glee Club that John won many triumphs as solo- ist. Appearing at the various Met- ropolitan Colleges, John was al- ways well received, and his rendi- tions will long be remembered as those of a really fine tenor. Such ballads as "Angels Guard Thee," "Collette," and "MotherofMine" have charmed many an audience and established john as a singer of true merit. fi FCRDHAM I I I l the time-worn things come in small packages," nd even though the analogy limps a bit, we cannot but apply it to Will, whose small stature was more than compensat- ed by an unselfish loyalty to his friends. There could not have been a more equally balanced character. A cheerful disposition marked his genial personality. Besides these charming traits, he possessed an enviable scholastic record which was the product of conscientious studiousness. ' We cannot but predict a success- ful future for our friend, for suc- cess reflects effort, and effort will not be Wanting in Will. A. adage, WILLIAM A. KELLY, A.B. Kingston High School . Bdfld, 1, 2, 3: Orclaertm, 1, 2, 3 164 FORDHAM ROYJ. KENEL, A.B. De LaSalle Institute 165 i alll, . f my? U I U I Ill ' V I I ' I READING o Wa along the road of li , we will meet many people oi diversified types, but few will mean so much to us as Roy Kenel has. Roy's love of privacy and quiet has held him from the limelight of leadership in class activities in spite of his ability. However, his character can bear the full glare of critical inspection without being found wanting. His courtesy has won for him a place in our hearts and we accord him the respect due to one of such a gentlemanly character. F.. ll I HERE was al ay' a kindly Tsmile of welc me from "Reg- gie." He won the friendship and admiration of his classmates be- cause of his manly character. In reconition, he was nominated as one of the candidates for junior and Senior office, for Editorship of the 1931 MAROON, as well as for Chairman of the Senior week com- mittee. Delicate health barred him from many extra-curricular activ- ities. He was a good student with a natural bent for literature and literary things-and an apprecia- tion of the other arts-the sign of the dilclttante. Mr. Kennedy is both a gentleman and a scholar. FORDHAM REGINALD T. KENNEDY, A.B. De LaSalle Institute Council of Debate, 31 MAROON SMH, 4,' Cbemirtfjy Club, 4,' Senior Week Committee, 4: So- dality, 3, 4: Councillor, 4, Secretary, 4 166 FORD HAM ,I 2, ul lx nu WILLIAMJ. KEOGH, A.B. Clason Point Military Academy Orchestra, 1, 2,' Frcrlaman Fo- rum: Parthmigm Xodalizy, 1, 2, 3, 41 Pennxylvania Club, 1, 2, 3, 4, Pruident, 4,' Council of Debate, 4: MAROON Staff, 4,' St. fabn Berclamanlr, 2, 3 167 lf COMING from the iiiiountainous regions of ennsylvania to a large city, Bill iquickly made his worth felt at Fdrdhami. He was a leader in his State Club, serving as its President in his Senior year. Activities outside the regular curriculum were his forte, Bill participated in the Council of De- bate and gave his most particular attention to the devotions of the Sodality. Whether he seeks his fortune in the Big City or in Shenandoah, we know that his activities will be as successful as they have been at Fordham. I I l I l I I ' 1 IM joine odr lass in unior, J coming 41-om eton Hall Col- lege. We are prou to say that this change of school was of great advantage to the c ass. Industrious and serious as regards duty, Jim has gained the admiration of all who truly know him. Though studies occupied most of his atten- tion, he still found time to engage in many of our campus activities. Rumor has it that Jim cuts a wide path socially over in the unknown territory of New Jersey. However, we maintain that this is but an idle tale. Jim, it seems, intends to study law after graduation and we know he will win success at this dis- tinguished calling. l . FORDHAM l JAMES F. KERVICK, A.B. Seton Hall College Sodaliqy, 3, 4: New jersey Club, 3, 4 168 FORDHAM 8 'Di n- lla JOHN W. KERWIN, A.B. Xavier High School Immaculate Conception Sodal- izy, 1, 2, 3, 4,' Clan Baseball l,' .Yopbamore Vigilance Com mittee, 2,' Prem Club, 2, 3, Brooklyn-Long Ixlaml Club, 3 4, Dance Committee, 4 N g 169 I News wig ' o 5 , c ! s Don Juan of Allstria went A marching to wat and came back victoriousQ so did john Ker- win go marching off to college and return a conqueror. He ttooped in- to Fordham with a set, intelligent face illuminated now and then with a brilliant smile which bc- spokc the highest form of good- fellowship. Now he leaves us car- rying in his hands the utmost re- spect of all his college chums. Some days were dark and dismal, but we always found John ready to dispel the gloom. ,gi I I I I I I l I I l l ' l I - I n l I Q l ARRY'S was t the voice you H could hear bove all others in one of our "deep" discussions. His was rather the part of the listener who learned by the mis- takes of others, and who had the happy faculty of convincing an opponent with a few well-chosen and well-timed words. Fun-loving by nature, Harry was ever ready to swap stories with a humorous twist. He has often set his listeners to wondering if it were possible for one so young to have gotten around so much. But he'll swear they are true. FORDHAM I HENRYJ. KIERNAN, A.B. Xavier High School Swimming, 1, 3: Tennir, 1,' Brooklyn-Long Island Club, 3, 4, Dance Committee, 4,' Clan Bareball, 1,' Xodality, 1, 2, 3, 41 Vigilance Committee 2 170 FORDHAM I RICHARD G. KUERZI, A.B. All Hallows Institute MAnooN Staff, 4 171 .'.':.,'l 12 we were r strictl:d to giving I Dick but on characteristic, we would unhesit tingly use the word " gentleman." 'And a gentleman he is, quiet, cultured and well- mannered. He is altogether a de- lightful character. Dick was content to confine his activities to the classroom. Extra- curricular activities had no appeal to him. I-Iis one love, the study of ornithology, took all his time. His sincerity of purpose and tenacious adherence to the ideals of Ford- ham cannot but promise a bright future, full of the peace and quie- tude his personality will give it. l .nl l l 1 M4N vxlith s ch a delightful A complex per i nality produces so many impressions, that it is difficult to decide the most vivid and most interesting to write about. Jud is generously endowed with talent and ability to excel in different fields of effort, but chiefly in that of music. Since he came to Fordham the name "La- Haye" has been synonymous with rhythmic, syncopated piano rip- plings that never failed to soothe the harassed student's soul. Predictions we have noneg we only say that Jud will be the brightest star in any firmament. FQRDI-IAM I UDSON A. LAHAYE, Jn., A.B. Central High School Offlffffm, 14 2, 3, 4, Director, 2,' Glee Club, 2, 3: Partbenian Sodality, 3,' Organift, 41 Con- necticut Clab, J, 2, 3, 4, Presi- clent, 4: Frerlmzan One-Act Playff Sophomore Vigilance Committee: NIAROON Stag, 4 172 FORDHAM JOHN LANE, A.B. Fordham Preparatory School Tbe "Ram", 2, 3, 4, Editorial Board, 3, Editor-in-Cbief, 44 5'oa'aliU, 1, 2, 3, 4, Axxiftant Prefeet, I, Trearurer, 2, Cbair- man Union Committee, 2, 4,' National Convention Repre- Jentatioe, 2, 3, 41 Council of Debate, 2, 3, 4, Prefident, 4: Frorb Forumj Froib Debating Team: junior Vanity Debat- ing Team, 2,' Vanity Debat- ing Team, 3, 4,' Prefielent Atla- letie Auoeiation, 41 Frofb Tennix Tearnj Auiftant Man- ager of Barketball, 1, 2,' Glee Club, 2, 3,' Senior Week Com- mittee, 4: Froib One-Act Play Context: Cbairman Frerbman Oratorieal Context, 4 173 ml? i l I Z x JOHN is one of thosciterribly elli- cient people vvho manage todo a thousand things and to do them all well. As president of the A. A., Editor of the Rani, President of the Council of Debate, and an In- tercollegiate Debater, he docsn't have much time for sleep. It is a marvel to all of us how he can cram a day of normal activity into a single hour. Besides doing all these things, John manages to keep Well up in class. A man with such ambition cannot be kept down, so good wishes for the future would be superfluous. l Ill: sill FORDHAM In m llll I I I 1 s u won the students. "Lani" was a fine companion and a great friend. There was no stilt- edness or artificiality in his char- acter. Sincerity was its prime con- stituent. It found expression in his spirit and loyalty not only to his friends but to his Alma Mater. A man of such honesty could choose no finer profession than law, which "Lani" proposes to follow. There is nothing more sorely needed among jurists today than straightforward integrity and self-respect--both of which are conspicuous qualities of "Lani's" nature. ' dent, whose or respect of his ell MATTHEW J. LANIGAN, A.B. Bushwick High School ' Freshman Sodality, 1, 2,' Brookbn-Long Island Club, 3,4 174 FORDHAM I Faux E. LARKIN, A.B. Xavier High School Track, 1, 2, 3, 4: Bafkerball, 1,' Clan Barketball, 4, Man agar, 4,' Clam Baseball, 1 175 I I :::.,'II Enix excels san thlete and as a student. An assiduous and ' ac man, he could be energetic found every afternoon running lap after lap in the Gym. Spring found him practicing the javelin throw, at which he particularly excels. Felix was not only a star track- man but was also a good student. His constant and energetic appli- cation easily overcame the diffi- cult problems of Psychology and Ethics, the bugbears of Senior year. Pursuing his way serenely and calmly Felix obtained the prized degree of A.B. gym f, E I I I , I. . since ity Inihough nd 1 the a coll gestu- dent, these modern times of 1 education. Gardner's personality radiates these qualities-which find elo- quent expression not only in his conversation but in his dealings with his fellow students. A cul- tured gentleman, well versed in the happenings of the day, he is also an enthusiastic follower of sports. Uncertain of his future work, Gardner will undoubtedly choose something which is really worth- while-something that will bene- fit his fellow men. Surely theworld could not demand a more balanced personality from which to form a leader. ' FORDHAM I J. GARDNER LAWLOR, A.B. All Hallows Academy Frefhmmz Ba.rkctbull,' Frerb- man Baseball: Vmnrigf Base- ball, 2 ,3 ,4,' I nterclan' Burket- ball, 2, 31 Immaculate Con- ception Sodality, 1, 2, 3, 4 176 FORDH M l M IH nu JAMES T. L1LL1s, A.B. Seton Hall Preparatory School Freshman Baseball! Vanity Baxeball, 3, 41 Twnif, 21 Golf 2,' Glu Club, 2,' New jerxqv Club, 1, 2, 3, 4, Secretary, 4 177 , IQ l I I VERY dog as his day-and E every class fts Beau Brummcl. Jim is the lucky possessor of a rakish and debonair air, "savoir faire," is not only just another word tojim. This cloak of worldliness does not completely hide the sincere and trusting friend, it serves to enhance its value-a balance of charm and wisdom equally dis- played. Nor is he at all times seri- ous, but this is one of his most en- gaging facets. He presents to us a multisided personality. It is to both Jim the man, and Jim the friend, that we offer every possible best wish for the future. I U 1 1 . a e believe Florida to e the "land o sunshine." But after being in Joe's company for four years, we think it is New Jersey which deserves this appellation. The long trek from Jersey to Fordham every day has certainly not dampened his ready smile and cheery greetings. Joe will embark on a law career, and we certainly wish him every success. ' Joe has but to apply himself in the same diligent manner to law as he did to his work at Fordham, and the same marked success will be his then, as it is now. FORDHAM I JOSEPH D. L1NTo'r'r, A.B. Xavier High School Frerbmim Playrlsopj Vigi- lance Committee, 2: Sodality, 1, 2, 3, 4: French Club, 1, 2 178 FORD!-IAM I .H ' RALPH Low, A.B. Monroe High School Swimming 1: Spanish Club, 1, 2,' Sadalizy, 1, 2, 3, 4: "Ram" Staff, 2, 3, New.r Editor, 4: Editorial Staff MAROON, 4 , 179 L lol HE subject f ou story is a Tslim, calm hap,lwhose easy smile and rac ul presence have been so co me an addition to our college life. But these few ,words must fail to do justice to one of the finest men we know. For he is utterly un- selfish, willing to work unstint- ingly that others might gain by his efforts. As the patient News Editor, as the brilliant columnist of the Ram, Ralph gave some evi- dence of these qualities, as the friend and companion, he gave more. It might be sufficient to say that in the critical judgment of the student body, Ralph has been ac- cepted without reserve. I I : III - I llll' X l ll. X, I I sl' i l l I UR four ifears t Fordham have O been made ore pleasant by our association with Charlie. His pleasant, smilingidisposition has won him the friendship and grat- itude of his fellow students. His popularity and the confidence we have in his ability were clearly manifest when he was elected to the position of Treasurer of the Class of '31, U It is with sorrow and a deep sense of loss that we part with Charlie, for he is a friend not easily replaced. Yet, knowing his ability and determination, we do not hesitate to predict great things for his future. , . FORDHAM I calms A. MCALOON, A.B.A Cathedral College ' Preparatory School Glee Club, 1, 3, 4, Member of Board of Directorr, 4, Trear- urer, 4,' Auirtant Football Manager, 1, 2,' Clan Treas- urer, 4,' Sodalizy, 1, 3,' Har- vester Club, 4,' Intercollegiate Glee Club Context, 1, 4 180 FORDHAM ROBERT D. MCCABE, A.B. l Xavier High School Brookbfn-Long bland Club, 3 4, Dance Committee, 4: Soda!- ZU, 1, 2, 3, 4 I 181 f ml: f 4 uiialiiii I oval' yellrs sho! ing f Fl' tbush ha eho even begun to dim the ar or a l brilliance that is"'Bob's" ow . That ever present smile milght well be termed magnetic, in its capacity for at- tracting others' to its admirable owner. Bob's college record is a well balanced one, athletically, scholastically and socially. He is a past master at the art of estab- lishing himself in the hearts of men and his ready wit and humor have endeared him to all. He has been chosen the luckiest man in his class, but even without Dame Fortune smiling on Bob, his manly characteristics are suflicient to in- sure success in whatever Held of endeavor he may choose to con- quer in the future. lll fl fill CrsAnL1u ls a upon whom we can depe d. What better quality can be pr dicated of any- one? I-le is a loyal friend and a clever, interesting companion. Further, he is always willing and eager to help his friends in time of difficulty. I-le experienced little trouble in his studies, for he is splendidly equipped and applied himself so diligently that even the most dimcult assignments were easy for him. These hne qual- ities have been widely recognized and have won for him a host of friends. We part, Charlie, but you will live in our memories of a happy college life. Clmnnus MCCARTHY, A.B. Regis High School Swfdlify, 1, 2, 3, 4: Frerlamqn Forum: Freolammz Short Story 182 FGPXDHAM FGRDHAM I tm llll l l u IAMLS M NCCARTIIY A B Peter s Piepu ttorv School errey Club I 2 3 4 fbdlf ml: lu! "I man o Dance 4 Secretary 3 .S'pfu1i.fb Club 1 l l l 183 nu Jersey lub ances have been a feat re o our college social affairs b ause of the kind- ness and the soliicitude shown the guests by the sponsors of the dances. Among those who capti- vated us by their generous hos- pitality wasjim, a genialfriendly, courtly personality and a gracious host. His gentlemanly conduct, accompanied by his intellectual search for truth has definitely placed him among those "most- likely-to-succeedf' In-Iim's robust cheerfulness we have found a deep well of human understanding from which we have drawn many pleas- ant moments-moments which time cannot hope to dim. FORDHAM I Ronmvr J. MCCARTHY, A.B. Mt. Vernon High School ., . l "BOB is t uly man, cllever conversation, brilliant in studi s, able in ath- letics. He holds a hc place in our memories. , He was ever the true friend and loyal companion, whose bound- less optimism and depths of sincer- ity and understanding won him the respect and admiration of his fellows. Quiet determination al- ways characterized his work in the classroom and there were none more ardent in their support of Fordham activities. Such an auspicious beginning can scarcely fail to have a happy end, Good-bye, "Bob", we know that Fordham will be justly proud of your professional career. wdll-rciundcd 184 All Hallows Institute FORDI-IAM I s k III lu ml ll' 185 EDWARD B. MCCONNELL, A.B. ms two I ' ' qualities in Tthe ch aract r of olar friend are Cheerfulness a d charitableness towards his fellowstudcnts.Thcsc, blended with la keen sense of humor, are "Mac's" contribution toward good-fellowship. This rare combination made him a very agreeable companion both in the classroom and on the campus. His unfailing good humor brightened many an otherwise dull class or gloomy "lab" period. What "Mac" intends to do after graduation is yet indehnite but we may predict with certainty that a man of his calibre cannot fail to succeed. Good-bye and good luck, old pal! nil CZIHC I0 US ms son f n Tfour ye rs a from a quiet hamlet on the ba ks of the Hud- son. Since then e have come to know and appreqiate "Mac" for his varied characteristics and ac- complishments. His opinions are always well-grounded by a wide and diversified reading, and by an ever hungry intellect which, to be trite, takes things apart to see what makes them tick. Coupled with these admirable qualities- others go hand in hand, a love for music, poetry, and all that is worthwhile in life. We know that "Mac's" good nature and broad knowledge will bear him lightly along to success in his chosen Held. FORDHAM I HAROLD C. MCCOURT, A.B. Marlboro High School Frerlammz Ont-Act Plqyrl Short Story Club, 1, 2, 31 Up- xtate Club 186 FORDHAM WILLIAM O. MCCUE New York Military Academy Sodoliu, 1, 2, 3, 4: Vmiv Burketboll, 2,' Brookbn-Long Island Club, 3, 4,' "Ram," 1, 2, 3, 4, Humor Editor, 3, 4,' Forzllaam "Monthly, ' ' 4: MA- ROON Stuff, 41 Vigilfmff Committee, 21 R. 0. T- C- Cjicem' Club, 3, 4, Secrctdfy, 3, 4 187 Tllceen wit .if unster, the is approach to any gatheri g, wi h his famil- iar, "Hi Keed! ' No one is known to have walke away, for Bill is Cheerfulness itself. But, beneath this charming ex- terior, there lies a sincerity and depth of purpose balancing the scales of Bil1's character. We, the recipients of his wisdom, are im- measurably benefited by associa- tion with him. It is not hard to predict Bi1l's future, for the genial editor of the Humor Column of the Rom, and the generalissimo of the forces of logic, cannot help but be success- ful, and what is more important, contented. 4 fill H UGHIE 211 S alll ey th well- knowrl ' rr.. of the world, greater Boston. T ough rather un- assuming, he can claim a host of friends among his classmates. Hugh's forte, outside of class, was football. His ability as a player is attested to by the fact that he was a member of our great team since his Freshman year. As a member of the Massachusetts Club, the success it gained wasa result, in no small way of the in- terest he showed in the Club, since its inception. t Hugh disclosed the fact that his ultimate goal is Law, and the fu- ture will surely grant success to his forensic ability if his present attainments be any criterion. FORDHAM HUGH F. MCCUSKER, B.S. St. Anse1m's Preparatory School sodaliux 1, 2: 3, 41' M4114 cburctts Club, 3, 4,' Football, 1, 2, 3, 41 Bareball, 1, 2, Track, 1, 2 188 FORDHAM WALTER P. MACDWYER, B.S. Holy Trinity High School Freebman Stage Crew: Freeb- man Track Team: Auixtant Manager Football, 1, 2, Var- .ritjy Manager, 41 Bf00lGl9'f2- Long Island Club, 3, 4f 5'1- folan BerclJman'.fSoa'ality, 2, 3, 4,' Boarders Initiation Com- mittee, 2,' Spaniels Club, 2: Football Banquet Committee, 4,' Senior Week Committee 189 S III l 1 I l . I l l o S busy man Indeed. The duties of the classroom and the activi- ties of a football manager are no light burdens, but Wally in his own quiet, efficient way, acquitted himself well in both, his marks were high and the trying situa- tions that are the daily bane of a manager's existence, were solved without any fuss. Quiet, unassuming, and efficient, he should have no trouble in per- fecting himself in whatever pro- fession he may choose to embrace. lil l l 1 3 ENIOR year und ally a very l l Q 1 K HERE ls an. effect t at deep, and adage o t izvat runs best to in- terpret the charac er of Edward, a quiet-even silen ilad, who seems to find solace in the calm pursu- ance of his studies. Edward is a conscientious student who takes his education seriously. Quiet per- sons, when they do speak, invari- ably have something enlightening to say. Perhaps he is a bit shy?- this may merely be a manifesta- tion of our friend's deep se1f-re- spect-a superb qualification of youth. , The mental power of concentra- tion is probably one of the greatest assets governing success today, and so we are most optimistic about Edward's future. FQRDHAM I EDWARD J. MCGLYNN, A.B. Xavier High School Sodalizy, 3, 4 190 FORD!-IAM u ll JAMES F. M'cGoVE1uf, A.B. St. Peter's Preparatory School Sadality, 1, 2, 3, 4: New jersey Club, 1, 2, 3, 41 Ddfiff Committee, 2, 3, 4: Ffeslvmffl Forum 191 I wig I I z III I llll' I p I I I ' I I I EEN, analyt cal relasoning has characteriz djim's classwork from his early eshman days. No problem, however Gargantuan, everfazed this intellectual giant. In a cool, modest manner, Jim would train the weapons of his intellect on the difficulty, and proceed to rake it with a gunfire of logic that soon forced it to surrender to the cohorts of certitude. Jim carried this ability into other fields, and it is our belief that some day he will astound the men of lawpwith his splendid reasoning. Good luck, Jim, and may you work out life's problems in the same determined manner as you have here at Ford- ham. llllll N the four ears e have been at I Fordham, neve have we heard it said thatTom co ld not"crash" a dance. In a haulghty voice he could assure the most skeptical door committee that he had paid for his bid-but had unfortunately left it at home. If that plan failed, there was always the fire door. In class Tom changed, he was quiet and attentive as he took page after page of notes and readi- ly assimilated the complex prob- lems of Psychology and Ethics. FORDHAM 1 lu Illl THOMAS B. MCGOWAN, Jn. A.B. Brooklyn Preparatory School Sodalizjy, 3, 4, Secretary, 4, Interclass Basketball, 4,' In- terclass Baseball, 2,' Fresh man One-Act Plays 192 FOR D H AM n ml llll l EDWARDJ. MCGRATH, A.B. Regis High School "Ram,"1, 2, 3, 4: MAROON 4,' Swimming Team, 1, 2,' De- bating .Yociegg 1, 2,' One-Act PIKUL' Sodaligf, 1, 2, 3 193 E a d to-the-point articles in am concern- ing the of our baseball team are examples of his personal The bright sharp comments with gen- tle satire, always received an ap- preciative understanding from the readers of Ed's articles. This same cleverness and ability has stood Ed in good stead throughout his four years here at school. He has endeared himself to all his associates, through this same personality. We know that Ed, in no matter what company he finds himself, will experience no difficulty in maintaining his customary cheer- ful poise. iilllilwl l il" ill who p sses es l I I I I l l 1 'Toi as all the chadactlr tics hf a incere and earnest stu nt. He was a steady and consrvative fellow, whose opinions falways carried weight when argurments flew thick and fast. Always smartly dressed and always in a cheerful mood, Tom was an innate gentleman. In many a "quiz" class, to our delight, Tom would advance an objection that would cause a wary instructor to proceed with extreme care in answering it correctly. For one whose life is so well ordered, and whose judgment is so mature, the future can hold no terrors. Tom will pursue the course he has set for himself, and with little difhculty attain his goal. FCDRDHAM Ma lm llll ii THOMASJ. MCGRAW, A.l3. Fordham Preparatory School St. Vincent cle Paul Society, 2, 3,' Council of Debate, 3, 4,' .fpnnirla Club, 3, 4,' Glgg Club, 3, 4: Brooklyn-Long I.r- lnncl Club, 3, 4: .Yadnligf I, 2, 3, 4 194 FORDHAM Ill , lg FRANCIS H. MCGUINESS, A.B. Regis High School Sodality, 1, 2, 3, 4,' Manager of Swimming, 4: Auiffdflf Manager of Bareball, 1, 2,' Orolaertra, 1, 2: Interclarr Baseball, 2,' Interclarr Basket- ball, 3: A. A. Council, 3, 4,' Brooklyn-Long Irland Club, 3, 4: Senior Dance Committee 195 mvll I III' ' II Il' u 1 I null is boundle s oplimism and H good-fe lowship make "Frank" one o L the most popular and likable men in the Class. As a supporter of Fordham activities, moreover, he has few equals. He has unsellishly given much of his time in shaping the destinies of the Swimming Team. These qualities have won him the friendship and respect of his fellows, and it is with a feeling of loss that we regretfully part.How- ever, we are confident that the problems and difiiculties of his fu- ture life, like those of his college days, will fade before his cheery smile. - U I A U l l l l 1 1 , l E seizd this y of bi formally intlodn a man who is abounding ln likable char- acteristics-a manwho is forever loosing the flood gates of good cheer and sympathyupon his class- mates. Aside from his charming personality and his ability to dis- perse gloom, he possesses a quality of leadership, the prototype of which can only be seen in the makeup of an Alexander or a Washington. As an actor, there were few in the school that could vie with him, to this fact many a one-act play owes its success. Endowed as he is, Bernie will find life a pleas- urable adventure. FORDHAM I BERNARD F McK1:RNAN A B Regis High School Sadezlity, 1, 2, 3: Mime: and ' Mummerr, 1, 2, 3, 41 Freela- man Plezyelaopf Varrigy One- Act Plezyr, 2, 3, 4,' Glee Club, 2,' Swimming Team, I, 2, 3, 4, Manager, 31 Mendel Club, 3, 4: Harvester Club, 3 196 FOPXDHAM GERALD B. MACKINNEY, A.B. Brooklyn Preparatory School "Ram," 1, 2, 3, 4, Circula- tion Manager, 41 Arsirtant Burinerr Manager, MAROON, 4: Partbenian Sodality, 1, 2, 3, 4, Auirtant Prefett, 4,' Frencb Club, 1, 2, 3, 43' CWM- cil of Debate, 3, 4,' Haruexter Club, 4,'.S't. fobn Bercbmanlr Socieu, 3, 4: Interclam Base- ball, 2, 4,' Interclan Barker- ball, 3,' Intramural Sports, 3, 4,' Baseball, Frosb, 2, 3, 4J Braokbn-Long Irland Club, 3, 4 197 my ' I I I , l I I I I s Ilvll THOUGH sma of slature, Jerry has stood t in every phase of college life. A fine scholar and an excellent atlxlete, he has put into practice that very splendid saying "I must be up and doing." With a sunniness of nature that enabled him to win the friendship of all, this little bundle o' dyna- mite from the City of Churches has actuated all the qualities that mark out the Fordham man. The Ram never had the same appeal unless delivered by its resourceful circulation manager. We are never for a moment doubtful but that jerry will prove a success in his chosen field of Teaching. fl. DURING llis c lege days, Ed was an activ amember of the Debating Societyf His forensic ability is well known to all who have heard him, and his clear, cogent arguments have always been a source of trouble to his opponents. Ed was also a faithful member of the student's Sodality and an outstanding member of the class basketball team. I-lc is of the quiet type, and is appreciated by all who are his intimates. His pleasant disposi- tion and disarming smile will long be remembered when Ed has left our midst. III X EDWARD F. MCLAUGIKLIN, A.B. Fordham Preparatory School Sodaljty, I, 2, 3, 4,' ffztertlarr 13a.rketl'ull, l,' Debating .Yo- tiety, I 198 l l F ti FORDHAM 1 y un i I -ll In FORDHAM iw' Iosnpn W MCLOUGH1 IN A B Xavier High School Sadaligy, 1, 2, 3, 4: Inrefflfm Bfuknball, 1, 2: Vigilante Committee, 2 199 'E on is one cha acter ifvhom it will J be impossibwe to forget. His is a personality fprever possessed of a smile, whose language is ever expressive. He kept alive what- ever group he happened to be in. His adroit wit and hisability to receive flippantly the humor- ous attacks of others, won for him many friends. Such a quality as this, is sure to fit him admirably for vvhatever line of endeavor he may choose to undertake. It. is with the real regret of loss of gen- uine friendship that we see him leave our daily association. l Qllll X I V 1 I Houma we carr with us a pic- S ture of Pat a a gcnial com- panion, a steady fr,1end,or an inter- esting convetsationalist,we would still scarcely be doing justice to him, whose good qualities surpass even these. For in Pat we find a delightful combination of wit and intelli- gence, a rare combination which serves to make his presence doubly valuable. A man with the will to accom- plish whatever he attempts, who is naturally a pleasant compan- ion, is a valuable adjunct to any class. We are proud of Pat. ll FORD!-IAM I PATRICK W. MCMAHON, A.B. Manhattan Preparatory School Frulsman Debating Sodaliqy, 1, 2, 3, 4,' Ojfcerf Club, 3, 4 200 FORD!-IAM WILLIAMJ. MCMAHON, A.B. Clinton High School Football, 1, 2, 3, 41 Clary Presiilint, 1, 2, 31 Massachu- .rettf Club, 2, 3, 4, Vice-PreJi- dent, 3, President, 4,' Sopho- more Smoker Committee: Freib- man Track Team! Student Council, 3: Baseball, .Z,'.S'opbo- more Vigilance Committee 201 I I I I l I 1 I :aol New came this Fmodern to lay the Op- posing Goliath . A s holarly ath- lete, he was th idol of the grand- stand and a avorite with the faculty. l In Junior year occupied the coveted position of Class President. During lectures, "Mac" was in- tellectually keen, soft spoken, re- served, and almost timid. In the years to come, we shall turn back the pages and delight in the memo- ries of this little iron man of the Grid who made small of the giants. As he passes each white line on the held, we'll be shouting from the bottom of our hearts- "C'mon Mac." I .li is I I ll I UIET Jbhn IS good nature Qpossessed of that has the pow of drawing to him many friends He stands out especially for his maraderie and gentlemanliness, rind as a conse- quence is liked equally well by the faculty and the student-body. He is an indcfatigable worker, as is testified to by the fact that he is the head of the Publicity Com- mittee of the Council of Debate, for which organization he has done wonders in drawing large audiences to all of the public de- bates. To those who know him personally it is obvious that such extraordinary executive ability will surely spell success for him in the business world. FORD!-IAM I JOHN P. MCMANMON, A.B. Regis High School Baseball, 1,' Freibman Foramj 50d4lifJ', 1, 2, 3, 4,' Council of Debate, 3, 4, Publicity Committee, 4,' "Ram" Stajff, 3, 4 202 FORDHAM I III EDMUND J. MCNAMARA, A.B. Brooklyn Preparatory School Sadalizy, 1, 2, 3, 4: Brookbw- Long I.r1andClub, 3, 4 203 i v I D came to u fro Brooklyn E Prep. Ther was no fanfare or blare of trum ets, but none was needed. He devo ed himself to the ardent pursuit of his studies, and though he was a man slightly younger than the rest of us, his keenness of mind and clarity of thought stood out. As for his personal characteris- tics, Ed's disposition is mild. It can be truly said that never has there been an occasion on which we did not welcome Ed as a pleas- ant addition to our company. We know that in parting with him we lose a true friend. - il' staturegavehi ac U mien which caus d him to stand out among his fellows. His sincerity and trustworthi- ness compelled respect. Loyalty was another of his outstanding characteristics and we present in evidence his many extra-curricular activities. His clarity of thought and speech made him an interest- ing addition to any debate. No matter what profession he JOHN'S ale t cou ten and tall may choose to enter, that profes- sion will be enhanced by his presence. FORD!-IAM I JOHN T. MADIGAN, A.B. Regis High School Sadalig, 1, 2, 3, 4: Glu Club, 3, 41 Freshman Forumj Coun- cil of Debate, 3,' Freshman Baseballf Interclan Barker- ball, 3, 41 Spanish Club, 1 204 FORDHAM JAMESJ. MAHON, A.B. Regis High School Freflamiin Forumj Vigilance Committee, 2: Boxing, 1, 2,' Sodality, 1, 2, 3, 41 Brooklyn- Long Irlonil Club, 3: Mime: and Mummers, 1, 2: "Ram" Staff, 1, 21 Interclam Barker- ball, 1, 2 205 THOUGH a m n of slnall stature, Jim looms arge in class, for his probing mind is ever ready with questions pertinent to the discussion at hand. Ever good humored and ever cheerful, he has countless friends among his fel- lows. Off Campus,Jim is prone to give evidence of his ability to emulate the "gate-crashing" propensities of the far-famed "One-Eye" Con- nelly. In this, however, he would not be unwelcome, for jim is a pleasant addition to any gather- ing, because of qualities that make him ever his cheerful self. 1 l 5 a 1 l I l I u N Tom, an 'ad irable 7 of zealousscholar and a true g ntle an, augmented by a spontaneous ens of humor and an air of goo -fel everything he dods, he reveals a whole-hearted enthusiasm and a boundless energy-which literally crushes all opposition. Beit study, sport or debate, the same persever- ance and proficiency are clearly manifestf Tom is not only a light-hearted comrade but he is possessed of an unsellish disposition, which has merited him a host of friends. And' now, as out in life he 'vvends his way, he will oft be remembered by his fellows for his disarming smile and happy disposition. 1 ' x THOMAS . MANAHAN, A.B Fordham Preparatory School Soda ity, 1, 2, 3, 4,' Stag Crew, 2,' Interclass Baseball 2,' Harvester Club, 4,' MA- RooN Sta , 4: Assistant Man- ager Basketball, 1, 2, 3, Man- a gee Basketball , 4 206 FORD!-SAM I ml llll ll JOHN-I. MA1uNo, A.B. Brooklyn Preparatory School Purtlaeniun Sodulity, 3, 4 Mendel Club, 3: Brooklyn Lang Island Club, 3, 4: Ital- iun Club, 3, 4 207 v Z JOHN is the pe sonifi ation ofthe old adage t at "good things come in small, packages." Four years of observlation make us be- lieve in the saying, despite John- ny's protestations to the con- trary. The good things in this package are the qualities of the true friend-quiet sincerity, deep understanding, and helpfulness. These endearing qualities, cou- pled with the saving grace of laughter, make a man to be re- spected and admired. We can prophesy nothing but success for John in the future-we wish him nothing less. i l III x 3 I I l I l ,ll I l . . I . -r is impossiblelfor anyone, no Imattcr how skilled in the art of writing, to add a single item to the brilliant recoild which "Vin" has built up in his four years among us. His position as the "most brilliant" is unchallenged, and even his nearest rival cannot but admire the comparative ease with which he masters the most complex psychological problem. It would be far from the truth, however, to assume that "Vin,' because of his scholastic record, is not a regular fellow. Amulti- tude of friends and a host of ac- quaintances attest to Vin's popu- larity and magnetic personality. FORD!-IAM l VINCENT E. MARONEY, A.B Xavier High School Soelulity, 1, 2, 3, 4,' Brooklyn- Long Island Club, 3, 4,' Dance Committee, 4,' Spuuieb Club, 2,' Council of Debute, 2,' Clue: Atbleticf, 1, 2, 3, 4 208 FO ll D H A M 1 ul llll WILFRED E. MARRIN, A.B. Evander Childs High School Sodaliljy, 1, 2, 3, 4,' Inter- cl:z.r.r Baxketball, 1, 2, 3 209 I I I I I l l IN these par doxicial days of sloth and ina tivity, Bill swings down the midd e path, calm, un- ruflled, and with a fine disregard for the rushing tide of life. There are few more steadfast Fordham rooters than this inter- esting character, who loyally fol- lowed the Maroon banners-no matter to what parts they led. We, his friends, pay tribute to his frankness, his honesty. It will be difficult to forget his easy wit, his warm friendliness, his ready smile. If only for these qualities, we value his friendship. EIU' fl I I ! l ll V m I 'IIII Asmlmss and blustering are qualiti s wh h can never be applied to Mi . He always worked at any di culty in a calm, collected manner. Hidden beneath the quiet, staid 'demeanor was a heart,which those who have probed deeply have indeed discovered to be gold. Mike carried on his class work and other activities with that equa- nimity which won him the rc- spect of all. No plan was ever adopted until Mike's weighty opinion had been heard. It is his cool, deliberate mode of action that has fitted Mike to carry on after june brings the parting of the ways. gl FQRDHAM MAURICE L MASON A B Goshen High School Uprtate Club 4 210 FORDHAM THOMAS H. MI.SSEY, Jn., B.S. Manual Training High School Brookbfn-Lang Ixlemel Club, 3, 4,' Mendel Club, 2: French Club, 2,' Sodality, 1, 2, 3,'4 211 .ll r J4'Sl'1a lal .yb be remembered for his ap ity tp make and hold new d . Quiet of manner, democratic, res urceful, and with a reputation foe good-fellowship, we are tful' at the thought of Tom passing from our daily com- panionship. We can be certain that he will make just as many new contacts and friendships at "Med" school as he has here at Fordham. Success is an essential part of his personality and we entertain no fear for his ability to establish himself prosperously in his chosen life's work. We may forget phil- osophy and other things, but as long as we can conjure up mem- ories of friends like him-it shall serve us well. .l sql... l THOUGH in the past four years Del has bee interested in many activities, it can never be said that anything claimed more of his attention than his beloved sport, baseball. Let not De1's intense loyalty to this diversion, however, over- shadow his other interests-for he is a scholar and a gentleman as well. Whenwe have scaled the heights to success, there, no doubt, we shall find Del, and as we see him smile, we will inevitably recall a true friend. FOPXDHAM I Danos MAYNARD, B.S. Evander Childs High School Baeeball, 1, 2, 3, 4,' Vigi- lance Committee, 21 Inter- cla.r.r Basketball, 1, 2,' Sodal- iEy7 1, 273 212 FORDHAM AMLS E MAZZACANL B S New H tx en High Sehool Italian Club 3 4 Soalalzty I Cbemzftfy Club 4 Inter cla.rrB:1rketbbll 1 2 Meri del Club 2 lfeucb Club 1 2 I , 'ul N I 2' r I . , . . 1' i ' l . ' . ' , f , ., 1 , 1 1 ' ,- . - ' 1 V - 5 J ' 1 'n 5 1 I, - . ff i V , 1 ' 5 1 li I I 213 .'.'a.ll ,rl l Run genius is best expressed Timor in con fnuing to do what others have dope before you, but in initiating ahd in constructing things that will be of benciit to those who come after you. It is in this type of work that Jim has shown his ability. The present success and good standing of the Italian, Chemistry, and junior Clubs, is a result in some manner, of the whole-hearted co- operation that james Mazzacane Contributed when these organiza- tions were in an embryonic state. These institutions will ever be in- debted to Jim for his earnest work. ll! ,U E I jaw, l I-Iuoo is well l known to the B.S. student as a quiet, slim lad who possessels an ever ready smile, that by itsfriendliness, ex- presses his complete personality. He has not taken part actively in the student organizations, so that he could devote his time to his favorite study-the sciences. That he has succeeded in this endeavor is evidenced by the high scholastic standing he has maintained for the past four years. Such diligence and constant application to duty are sure to ensure Hugo a' pleasant future. l l X N o FORD!-IAM Huoo L. MAZZAIII, B.S. Stuyvesant High School i Chemistry Club, 4: Mendel. Club, 3, 4 214 1 ,III llll ii V 4 -i FORDH M a l an r l llll l THOMAS MEMOLI, A.B. Stuyvesant High School Mendel Club, 2, 3, 41 Ifdlifw Club, 3, 4,'.S'odaliU,1, 2, 3, 4 215 Ill 'v . D mp l l 2 mv I Ill' I un friend is among that group 0 of 'ent who do not adopt a conventional yiewpoint towards study as a necessary evil. Of a somewhat studious nature, Tom took a more than common interest in his courses at college. With his interest in biological subjects, it was natural that he should become a member of the Mendel Club, an organization for the furtherance of biological research. In his future work, he may well be assured of success in the world. all 5 lllll X I u ERE is lno n rdeneu, cynical H Senior, but one who has luckily retained his youthful out- look on life-and its vagaries. When we couple this with a pleas- ant seriousness, there can be no doubt as to its merits as a winning combination--which is success- fully exemplihed byjim. Comrade of our fortunes and misfortunes for four years, his buoyant and re- freshing friendliness has been em- inently appreciated by us and has made him a favorite with con- temporaries at sister colleges as well as with us. For this, we are thankful-to have found one to rejoice with us in joy or cheer us in trouble. JAMES S. M1LI,EA, A.B. C. B. A. High School Parthenian Sodality, 1, 2, 3, 41 Baseball, 1, 2: Freshman Stage Crew! Interclass Base- hall, 31 Vigilance Committee, 2,' Founder of the Upstate Club, 4,' Chairman of Christ- mas Danee, 41 Initiation Com- mittee, 4,' Boxing Team, 1,' Spanish Clnh, 1,' Football, I 216 FORDHAM FORDHAM MICIIAEL P M1sK1N1s, B.S. Brockton High School frerhmmz 1' aatballg l7dI'J'fUl football 2 3 4 BoxingTMw, 2 4' -4 , 9 1 9 I i if Q 1 i 1, 2 217 l i f l Q 'X l tx l 5 l 3 MIKE has s jccessfully demon- strated for the past four years that the lessons of the foot- ball field may be successfully ap- plied to advantage in the class- room. A certain pugnacity of spir- it,along with his strong purpose of action, clear methods and brilliant reasoning, have brought him just rewards in both placesf We feel sure that these qualities will bring him prizes in the game of life, es- pecially when underneath his seri- ous mien, lies what has often been called a "saving grace"-a sense of humor. Good luck, "Mike"- we'll back you to win. i A llli 5 :lg i : BEAMIN co te. seems A best to expla n I-Ioward's un- dying optimism hic is a splen- did charactcristid of youth-for optimism never admits of failure. A devoted follower of the teams, Howard possessed that spirit which is essential to the proper function ofcollege life. This loyal- ty to one's Alma Mater is a superb quality in one's character, for it is composed of the same material of which devotion to any cause is formed. i Markedly gifted with loyalty and optimism, Howard's advance- ment in the future is assured. FGRDHAM I HOWARD MITTEN, A.B. St. Peter's Preparatory School Sodality, 1, 2, 3, 4,' New fy- .ray Club, 1, 2, 3 218 FQRDHAM ii M FRANCIS C. Moonn, B.S. St. .Iohn's College High School Sadalilgf, 1, 2, 3, 41 Mwdfl Club, 2, 3, 4,' Brookbn-Long Island Club, 3. 4 l 219 v Ulm' and d gnifiell, with an occasional flair for wit and good humor, rank represents a man of intelldctual attainment who finds time to do many things -all of them well. The pursuit of knowledge came first with Frank, but there were other things which held his inter- est. His love for science was only paralleled by his ardent interest in his religion, which is well attested to by his faithful attendance at sodality. With such a stable, well rounded character and personality, we feel sure he is destined for great things. in Q b at p 3 ' 1 ff! ' f I l l . 4 , , IMMY, thi: bright young man J with surgical aspirations, came from the city of New London to matriculate here at Fordham. He is a gentleman of unusual reserve, quiet-spoken and he represents in his make-up a personification of the four cardinal virtues. He has been appropriately c h r i s tc n ed "Happy" by his classmates, for even in periods of unbearable weather or unusually dillicult exams, Jim always has a cheery word of greeting for everyone. In these days of shallowness and de- ception, it is an honor to know a youth of Happy's type---an hon- est, upright, four-square man. JAMES P. MORAN, A.B. Bulkeley School Temzir Team, lj Mefzdel Club, 2, 31 Sodaliry, 3, 4 V J , 220 ' i FO R D H A M V in Up, ' llll fi, y l A Ii' L Q A,-Q FORDI-IAM hllil l' TIMOTHY MoYNmAN,A.B. Regis High School Clara Burketball J, 2: Saddl- lry I 2 3 4 Frerlmzafz Fo- rum VlZl!d71C6 Committee, 2 4 I 221 k I s l l l li NR .Wg Ss B p li s I l imu we hav one og FOI'dl12ll'll'S H most talented and popular entertainers. Tim is a trap drum- mer and tap dancer of no mean ability. He can hold his own in any circle of wit and pleasantry. He came to Rose Hill right after a year's tour with Ziegfeld's "Rosa- lie," which featured Marilyn Mil- ler, that greatest of present day Commediennes, Here is where Tim probably picked up his amusing anecdotes and scintillating songs. Wherever this gay young man goes, there is bound to be a happy circle of merriment and laughter, against which gloom and sorrow are unable to compete. zi gm' , IT is needlbss to 'ntroduce Jerry. His smiling fa e and laughing words are known lto all his class- mates. His poptilarity has not been caused by any forced ,meas- ures on his part, but merely be- cause his seemingly care-free air and unruflled countenance has stood out in bold relief against the cares and worries of school time. But there is beneath his smiling exterior a Jerry that is fully able to cope with the cares and prob- lems of the world, the person who wc know will make his mark in the world and bring glory to him- self and Fordham. 5 il GERARD MUCCIGROSSO, A.B. Fordham Preparatory School Glee Club, 1, 2, 3, 41 Band, 2, 3, 4,' Orcbestra, 2: Assistant Manager af Basketball, 1, 2,' Italian Club, 3, 4 222 FORD!-IAM u ll , U ANDREWJ. MULCARE, Jn., A.B. M 1 3 Brooklyn Preparatory . School - Sodaligf, 1, 2, 3, 4: Brwklyfl- p Long Island Club, 3, 41 Har- vester Club, 3 FORDH M I 3 , In lm 223 are rflfi .'.':.,'ll l a I I I T would be ea y, yet no less true, Ito say that,Bud is a perfect gentleman. However, we fear that some may fail ito catch the full signification of that phrase. Sar- torial correctness and suave man- ners are important assets of a gentleman-but there are others more necessary. With true concepts of, and strict adherence to the ideals of conduct, Bud's character embodies every virtue of manhood. Scrious-mind- ed in academic pursuits, he is an energetic student. But above all is that stream of geniality which diffuses itself whenever he joins a group of friends. I I 1 ! ll, Ill I IT is the fridndshi of fellows like Phil that mak s onc's college associations the mqmo things that novelists would have them be. Phil has in him, we know,'those characteristics that mark men as beings worthy of respect in the world. He is the type of fellow that-without knowing why, one seeks out when- the grey clouds of trouble begin to gather. His ready sympathy and advice soon dispels the gloom. The class as a whole feels sure that Phil will grace any profession that he decides to adopt. FORDHAM lm llll DANIEL P MURPHY A B Calais Academy 224 FCJRDHAM I Fiufrvcis L. MURPHY, Jn., B.S. i Harrison High School Golf Team, 1, 2, 3, 42 HWW-f' tcr Club, 4 225 U . Ill l f IIII' I II. I We their effects. it is spirit of friendliness so widely, that is the of his popularity. His keen wit easy manner have engendered secret admiration of all of us. Frank was also an enthusiastic member of Fordham's Golf Team. One must associate with him to really appreciate his cheerful dis- position. A smile for all and a cheery "Hello" will make Frank well remembered by his class- mates. He takes with him college days well lived. A His chosen profession is law, and one so equipped with such qualities as are his will be happily carried along the path of success. J x mann is' onlyl one expression that can adequately portray Bob-he is a true gentleman. In- nate gentility and good breeding are as characteristic of Bob as his pleasant countenance. Artificiality or pretence are not part of his make-up. His real, heart-warming sincerity has en- deared him to his friends. He has a keen, well-developed intellect and a quiet sense of humor that is invariably well applied. These traits, in common with his splendid bearing, are surety that Bob will travel serenely through life in happiness and honor. V l sw i : X W, iff 'lv Ill fm p p N I Fl Qi' , 5 . I i I i 5 i f H I-I1 1 I r 4 1 ROBERT A. MURPHY, A.B. Brooklyn Preparatory School 226 l . F RDHAM n p III IIII H FORDHAM EDWARDJ. MURRMAN, A.B Clinton High School Masmcbuxetty Club, 2, 3, 4: Partlamian Sadaligy, 1, 2, 3, 4,' Frcxbman Ba.reball,' Vigi- lance Committee, 2,' Interclam Bmeball, 31 Interclars Bm- ketball, 3, 4: Frcrlaman Forum 227 I I I U l l U U rrruouon min from the A small tow of Clinton, Mas- sachusetts,thcre is nothingusmall- town" about Ned. What is most noticeable about him are his su- perior qualities. In Ned we see the go-getter, full of determination and grit, who is at the same time a pleasant com- panion. Ned really came in to his own on the basketball court or the diamond, where his stellar ability was an important factor in the victories of his team. Ned leaves Fordham truly a cul- tured gentleman, a credit to Ford- ham and to himself. i-3 gym i l ' lll I, 9 ' l 0 one can deny that silence N under somelciri is at valueless virtue. Neither is n boisterous tongue a prized posses- sion. Butjoe, with his even tem- perament, was guilty of neither of these extremes. A Quiet, but never it recluse, and gifted with at goodly share of wits, his advice was sought by his class- mates. His friendship was it thing of value. What the future holds forlloe we may not know, but of this we are certz1in,that he will never lack the friendship of his fellows. FORD!-IAM Josmrri F. Mums St. ,Iohn's Preparatory School Soddiigya fi 27 39 41' Mendel Club, 2 228 , Q, li l '15 , iii ' i ' .4 FOP. D s-u M I, ti I ff IN t.., , f l' GUIDO NAPoL1'rANo, B.S. DeWitt Clinton I-ligh School A.rJi.rtm1t Manager Baseball, 1, 2,' Italian Club, 3, 4 229 I I i 1 6 .'.:.,'l li ll N such a large athering of I youths, a rather silent and un- assuming personality can readily escape notice. Nevertheless, Gui- do, to those who had the pleasure ofhis acquaintance, was a likable companion and a pleasant chum. As a member of the Italian Club, and thejunior ' 'E' ' Club he showed his devotion to the things that are Fordham's. Medicine, no douht, will claim the attention of our friend in the future. A man of his ideals cannot avoid success. M. sw fl fl, , ! ERE is life- ith its sudden H joyousness a d clear skies- with all its quic 'little rills and changes that so dndear it to us. Not like the dying autumn, but as the strengthening mid-summer with its promises and rewards, do we regardjcrry, friend and brother. Naive humor and simple sincerity further characterize him, and we know, will aid him materially on the road to success. We may for- get his interestin studies and other activities, but we shall remember that herewasafriend, who by rea- son of his sincerity and helpful- ness made it a joy for all who knew him. GERALD F. NEARING, B.S. Callicoon High School Partlnenian Sodalizy, 1, 2, 3, Serretafy, 4: Upstate Club, 4 230 3 . 'n , ' M 2 l, F RDHAM I III f un 'u 'u FORDB-IAM t a bw su i llll I ll. ll i WILLIAM A. NEEDHAM, A.B. a V Brooklyn Preparatory W i School i 1 Sodalizy, 2, 3, 4: Soplwwvrf , f Vigilance Committecf Brook- . Q Un-Long bland Club, 2, 3, 4, I Vice-Prerident, 4,' Dance Carn- l mittee, 3: Chairman Senior Dance i f - v ' 1 1 i l ' 5 l l ' l L 231 I mfg l f . ' X . i i l lu 3 wg? nn 3 I 1 ll UR friend lom ong Island O possessed deep respect for his Alma Mater-a superb quality in any undergrziduate. This spirit of loyalty found its highest ex- pression, not only in his conversa- tion with his fellow students but to an even greater extent, in his affiliation with the various college clubs and their activities. He was a prominent member of the Brook- lyn-Long Island Club and of sev- eral dance committees. He was also appointed to the staff of the Senior Week Committee. With such organizing ability, our friend cannot fail to make his mark in future life. gym X aoizou osse es many admir- able dualiti s which have won him the res ect and admira- tion of his felloxy classmen. His brilliant humor and whole-souled good-will make him a welcome addition to any gathering., The many activities in which he par- ticipated testify to his ability in almost every form of undergradu- ate endeavor. George, moreover, is a loyal supporter of Fordham ac- tivities and he has given much of his time to assure their success. We are confident that a charac- ter, manly and wholesome, cannot but reflect glory upon Fordham, splendidly equipped as he is to meet all of life's problems success- fully. ip FORD!-IAM 'il GEORGEJ. NICOLAUS, A.B. St. John's High School Mendel Club, 3,' Partbenian Sodality, 1, 2, 3: St. Vincent a'ePaul Society, 3,' Varsity One-Act Playa, 31 Varfity Play, 3,' Miniex ana' Murn- nier.r, 3, 4,' Glee Club, 2, 3, 4, Intercollegiate Context, 3, 41 Aryistant Manager Track, 3,' Manager Crow Country, 4,' Interclau Baxeball, 2,' Inter- clan' Basketball, 1, 2, 4,' Vig- ilance Committee, 2,' MAROON Staff, 42 Athletic Auotiation, 3, 4 232 FORDHAM I THOMAS V. NOLAN, A.B. Regis High School Sodality, 1, 2, 3, 41 Dfbdfing, 1,' MAnooN .Sita y IT 233 wig u I s Ill' I ANY are ndowfed with a M faculty w ich enables them to delight ever one in their com- panyg others inzspite of scholastic brilliance, .completely fail as socia- ble beings. It seems that a well- balanced man should possess, at least moderately, both qualities. Tom, we think, is such a one. Al- ways pleasant and cheerful do we find him, yet the facility with which he gathers friends about him is not lessened even when he immerses himself in his studies. Tom is energetic and enthusi- astic in everything he undertakes, and in view of his determined na- ture no one doubts as to his suc- cess in later life. sl lll 8 n 1 ,B I l u 'll'..11'. Hia iii! ISTINCTION i conferred upon D a man in p oportion to his excellence. Howe er, it seems that certain kinds of eiccellcnce remain unnoticed.Bill is socndowed'.I-Ie is one of those rare individuals who are completely unconcerned with the sometimes beautiful distrac- tions of youthful days and totally untouched by' the petty vices which are often regarded as ac- cepted customs, in manly circles. Although his manner is reserved, he receives a greater respect and a deeper admiration for his sincere study, than those who are con- tinually striving to project them- selves beforethe public eye. I FORD!-IAM In llll WILLIAM V. O'BE111NE, A.B. Regis High School Sodality, 1, 2, 3, 4 234 il X . 1 FORD!-IAM .ill l JAMES C. O'CONNOR, A.B. l St. Francis Preparatory , School Playrhop, 21 OWCCVJ' Club, 3, 4,' Sodality, 3, 4 235 I N myg .'.':.,'ll I l 0 FRIENDLY, and genial with a sense of hu- mor, are terms characterize our companion? Conversation and interest were never lacking when "Red" was among those present. He could always perceive the hum- or of any situation-which to an- other less cheerful student might seem non-existent. To associate with such a one is indeed to men- tally refresh oneself. w If medicine is the field which our friend will enter, Fordham un- doubtedly can be proud to have him among her graduates. l l 1 6. l 4 ED possclses sdmething which makes you think of him as being the "noblest of them all." A pleasing and unpretentious chap, O 'D. has unconsciously caused us to envy his consistency and facil- ity in becoming the master of all difficulties. His loyalty to Ford- ham and her activities has always been evident. Memory will oft re- call his subtlc humor, his conta- gious smile, and his heartychuckle. Let it sufhce to say-he is one stamped with all the finer quali- ties of manhood and one whom we are proud to call friend. And so, Ed, let us say not "good-bye" but "so long" for awhile. FORDHAM I EDWARD F. O'DONNELL, A.B. Regis High School SUJHUUI, 1, 2, 3, 4,' IlIf6'l'C!6l.l'.l' Baxketbull, 1, 2, 3 236 .ul-xx FORDHAM i. X M ,,f I H mx :I Rcgxs High School MAROON Sm 4 Oratorzm! Conten' 2 4 Prerzdent Huglaef Debatzng .Yoczety 2 umor Rzntg Commzttee 3 Prexzdent 1' rexlammz forum Baxketball 1 2 Bareball I 2 MzmeJandM1zm7nerr I 2 3 Glee Club I 2 Vzlgzlfmce Commzttee Varn1tyPlf1y I 3 Ru ll .fm 1 2 -.4 E, 5 mx Mwfh 2 W yull H ,X lg iff' Q , i a. , I--1. 4 -1 ' , M , , Q V V 1: 1 - z., H V , ., 1 '1f?.?:"f',,.. E ' E 1 1 ,f 51 1 1 ' ,. ..,, , ,LN ,five - "5 , 2 ,Ja . . , . A D f ' ' Q-Q Egi 595QZ2gs:ai -'10--M x. 2"-i-vc.'V1f"'Q7F'F'Q-"A"v::- - - . ... Q-fawawa-'5'9,32wr'?":0 f-,EC-:"'E:'.'o' -3-X4OC3':'L5'0,, 7... -"5--'nxt 2.-rriwml-1 fv:5.QQQ,,:g'S?IC,TwE94wQ QLEQQQEZQNQTH rzgglfi "'.Jf"t Iu- "" Doo :-200: 39-5592 3'-5 gm"3.11'.7'O-'T2rb""""'..:'- -a-,Qi Pg .O:"-' AON-,.,,,e-PA :hx-"'.'3"'-1 "' ',:S"' -' 5 5 gain-QSQQ ffamwn - ---,,, c5"FP2' Ei,.'S-mo i?HQ2nH:vz:-nas? O: ':HD":-:5.C:lV1 --gnc: En ff-1--,. 0 :S'gT,,mm-1-"'v,-.-U-N056 -"1 nzwwnhovhn 0 UO '--...V'.'I,J.qCO,.,nOf-up-1'-x0.::: "J::m:f...,7..'5.-.Ecg,- D ww Q ,,,,i0":'..Q. rn.-nQO2 ....2,-,.:'g:. Us 5"-qv-m g....p I-1""'-Signs.-L7-"'E"':""3FUUQHD .-. O,-m.'i'-:..nB..5T'f'D"?-lg, T f F 1 p V, Vi 1 2 W l 1 , y H V I 1 X ' H f an f g i , if 6 1 l 1. I ff XX + 6 K , 'U g 'iff Q H - .A 3 VZ: ,A 5 t 2 V . 1 1 5 5p,'f 1 ' - 4 5 ,izgkif E a Q ? Ps Mwiff fm .F f' 305 ,ji WILLIAM F.O'DONNELL,A.B. ' in 7 5 I .. I L39 ,-iP5' -4" EV i , "i. g il A' 3 V fi , H, f ' f 53 Q E2 ,e E, , ' e L, 3 3 , gik.x4".:- J . ' A I s 'I' 1 55 3 D W' ,'., ' - Q Y 5 ' 1' I . 9 n u C I " 1 1 1' I. t , ar A- , 'f 5 ML 1 vv I in 7 IF, , c 1 'A ' - f I ' Q ' , , 5 ' ,Q zfiwl 1 c x 1 K 7 ' Q' 2 7 3 l gm 1 2 Ill v F anyone houl ask the reason I for the great su ces' of the Irish could be readily and truly give by saying, "It was motivated by men like joe." The wit, the intelligence, the incentive for leadership of Old Ireland have all found a place in Joe and have made him an active, never-tiring student leader of whom Fordham is indeed proud. As Joe graduates, Fordham nods inlgratitude to him for all he has accomplished in her name, and she eagerly awaits the new laurels he will bring her by his unquench- able enthusiasm. Renaissance, the ns' FORDHAM osEpH M. O'DONOI-IUE, A.B. Brooklyn Preparatory School Freshman Forumj Freshman One-Att Plays,'FreslJman Play -WJUIL' Vigilance Committee,' Varsity Play, 1,' Mimes and Mummff-f, 2, 3, 4, Assistant Business Manager, 3, 4,' Mem- ber of Board of Directors, 4,' Holy Rosary Sodalig, 1, 2,' Immaculate Conception Sodal- ify, 3, 4, Assistant Prefeet, 4.' Brookbn-Long Island Club, 3, 4, President, 4, Treasurer, 3 238 ' ! In FGRDHAM TIMOTHY A. O'LEARY, Jn., A.B. Immaculate Conception High Cllevere, Massj Bu.rine.r.r Manager of MA- nooN,' "Monthly".S'ta1f, 2,3, 4, Business Manager, 3, 4, Massachusetts Club, 2, 3, 4, Secretary, 3,' General Chair- man of Easter Dance, 3,' Glee Club, 3, 4,'Interrollegiate Con- test Group, 3, 4: Boarderr' In- itiation Committee Chairman, 4,' Freshman Cro.r.r-Country! Track, 1, 2,' Intramural Bare- bgll, 4,' Partbenian Sodality, 2 239 l I l 'ie I Mm: LED His indomitable will, Tim a driv- ing force in the applying his to concen- trate and to the full force of his mind io any particular point in hand. Fire is the motif of this energetic person. Whether on the cinder path or in the Glee Club, whether in his business transactions or among his fellow students, this same spirit brought him to the fore. With his incomparable verve, unbounded optimism, and hearty good fellowship, this quiet, effi- cient "Bay-Stater" has acquired for himself an enviable record and place at Fordham. 5 llll ff flllfllll .sc t Q , 4 l i in Qumr as gained J'of all his classmates. was not the do-nothing rushing, type. Ih a somewhat reticent but earnest and skillful manner, he has successfully completed his four years at Old Rose Hill. It was truly characteristic of Bob never to begin anything unless he could bring it to a successful conclusion. In every held of endeavor he put this excellent trait into use, whether he was solving knotty problems in class or undertaking extra-curricular activities. But we admired Bob not only for this remarkable point of character, but above all, for his gentlemanly con- duct that assured us we had gained a true friend. ROBERT O'SULLIVAN, A.B. 5'+li Xavier High School S'odality,1, 2, 3, 4 i 240 F 0 R D H A A Q Ill A llll it it Il l H 4 l l Y l ' 1 .,f""""" FORDHAM SALVATORE PACIA, B.S. DeWitt Clinton High School Sophomore Vigilance Commit- tee: Italian Club, 3, 4: Frexb man Bareball 241 wig : O Y o :il li y AM has neve beenit member of S the Fordha University Or- chestra becausei of outside activi- ties, but it is a well-known fact that he is one of the most accom- plished musicians in the college. When he starts strumming out tunes on his banjo, all eyes and ears are focused on his playing. Besides his ability in music, he is also a fine baseball player, play- ing as he did on the Freshman Nine. Add to these capabilities his successful work in class and you have a man made up of physical and mental facilities which are bound to carry him to the front. FORDHAM In ua TIME and lclista ce often tend to dim the mem y of people we have all known. uch a condition with Tony however, is almost im- possible, for who among us can forget his cheery smile and engag- ing personality? And who can for- get the inimitable experiment with the rheostat? That adventure will long be remembered by those who were fortunate to witness it. He was a hard working, earnest student and his class work never fell below the high level of his character. We feel sure that his life will always be a creditable reflection on the days he spent at Fordham.. ANTHONY M. PALLADINO, A.B. DeWitt Clinton High School Mendel Club, 3 242 FORD!-IAM I RAYMOND T. PALMER, A.B. Fordham Preparatory School 243 liillmi lll'N l AY'S calm d uhruffled dis- R. position h s won for him an enviable positi n among his fel- low classmates' He is so consti- tuted, that if a ciharge of dynamite were to explode directly behind him, he would consult his wrist watch in order to ascertain the exact time of the disaster. It is this lack of excitability which renders Ray so attractive. For calmness of judgment and clarity of thought, Ray cannot be surpassed. All of us know that Ray, in the turbulence and turmoil that is attendant upon the struggle for existence, will stand unperturbed and untouched. 5 in qi E Q I il ., 3 ,-' i 1. V' J ,, l 3 ' ill i 'IIII A sizivsu oi humor is said to give its possessorfa sense of pro- portion. If this isfso, George will go through life with the ability to assign proper values to things, for his humor is of the best. He attains his ends with the minimum of effort. Thus the smoothness with which many campus organi- zations have been run, was the result in no small way of his sup- port.He possesses these and other qualities which the world is sure to recognize and reward. ills: GEORGE L. PARIS, A.13. St. Peter's Preparatory School Sodzrlily, I, 2, 3, 4,' Newjer- JU Club, 2, 3, 4, Dance Cam miftee, 41 .Ypmzirh Club, 2, 3 Debating, 1, 2 1 i l 4' A if F RDHAM p any t i ilp I Ii ll 244 l FORDHAM I CARMELO S. PERCONTI, A.B. Seward Park High School Immaculate Conception Soda!- ity, 1,' Italian Club, 3, 4 245 ye ll. Alfa? FRIEND is ne w o cherishes kind regar for another. This is only a definition, mere words which have no reality unless ex- emplified by an actual personality. "Pic" fulfilled this definition of a friend to those who had the good fortune to know him. Sincerity and trustworthiness were inherent in his character-paramount qual- ities of a genuine friend. "Pic" has chosen law as his life work. Surely a man of his ideals cannot fail to succeed in such an undertaking. If wishes can avail anything, we may close with the words-" good luck and abundant success." t l A BRILLIAILT ha d Working stu- dent, a sterlin athlete, and a gentleman of wh m any school would be proud, is the fit summa- tion of Peck's character. Beloved and admired by his classmates, this big playful youth will leave a memory of achievement behind him that is unique and incompa- rab1e,and onethatwill linger viv- idly when class days and events are but dim distant recollections. For in spite of the reticence behind which he strove to hide, his ge- nial disposition and sparkling wit won a place for him in our hearts, which has no equal, a place which shall be prized above all others. FORD!-IAM l ill CHARLISJ. Pmcuuzwxcz, B.S. South Boston High School Freshman Football: Varsity Football, 2, 3, 41 Track, 1, 2,' Marracbuxetty Club, 2, 3, 4, Easter Dance Committee, 3 246 u II FORDHAM ANTONIOJ. PISANI, JR., B.S. Townsend Harris Hall Immaculate Conception S'oa'al- ity, 1, 21 Arrirtant Manager Baseball, 1 , 2,' Manager Freeb- man Baxeball, 31 Manager Varrity Baceball, 4,' Band, 2, 3, 4, Drum-Major, 3, 41 Clan Secretargf, 2,' Cla.r.r Vice-Pre.ri- dent, 3, 4,' Orcbertra, 2,' Mime: ana' Mummerx, 1, 2,' Interclarr Bafeball, 2,' Interclarf Barket- ball, 21 Atbletic Council, 3, 4,' French Club, 1, 2,' Prem Club, 1,' Brooklyn-Long Irland Club, 3, 4,' Senior Dance Committee, 4,' Swimming, 1 247 L f 'TN fmlg ...illi I HEST out, ead erect, with C whirling ton majestically leading the banil through its ma- noeuvres at the Polo Grounds, Tony was a familiar sight to the entire student body. But his fel- low Seniors knew him as an indi- vidual, not merely as part of a unit-a man whom we were all proud to know. Quiet, self-sufh- cient, and friendly, and with his inexhaustible fund of wit, Tony was a source of admiration and pride to the Class of '3l. He was truly a representative member of it-a member from whom we ex- pect a great future. l., N fmt... a model to uphold s as it has been handed dow from the days when knights ro e together-to with this -AI:ITHONY ha A friend. I He the ideal of 'comr de the death. He combir I faithfulness, other natural gifts- the power of deep thought, and the ability to discern between true and sham manhood. These are the gifts he has brought us, friend- ship, thought, discernment. We part from Anthony, but leave him our gifts in return, those of esteem and loyalty. p We take leave of you, Anthony, confident that the future will hold all the happiness and laughter that you brought to all who knew you at Fordham. FORD!-IAM l ANTHONYJ. PORCELLI, A.B. Frexbman Forum," Freybman One-Act Playcf Rifle Team, 1, 2, 3, 4, Captain, 41 Glee Club, 2, 3, 41 Frencb Club, 2, 3, Trearurer, 31 Mimer and Mum- rners, 2, 31 Harvester Club, 2 3, 41 Council of Debate, 2, 3 4, Cenror, 41 Lecture Group, 2 3, 41 Italian Club, 2, 3, Vin- President, 31 Banol, 3,' Oljigm Club, 41 Immaculate Concep- tion Sodality, 1, 2, 3, 4 I 5 9 248 FORDHAM la' HERBERT W. Puiucx, A.B. Brooklyn Preparatory School Q Rifle Team, 1, 2,' Broaklyn Long Irland Club, 3, 41 Ojfi car.: Club, 41 Sodaliy, 1, 2 249 I " ERB" is o e of those quiet, H unassu ing personalities which constituite an essential an important part of any group in col- lege, or elsewhere. He was a very likable chap and a pleasing friend, indeed, to those who knew him. An enthusiastic follower of sports and an ardent exponent of his Alma Mater, "Herb" was always ready to discuss the "pro"and "con" of any game in which Fordham had been the victor or the van- quished. What "Herb" will choose as his life's work seems yet' indelinite, but we may predict with certitude, abundant success. , he f. lr gym N I 1 " I 'll I 'll OMBININT: Seemingly in- C compat ble qualities of schol- ar and great Fordham rooter, john is well known, and still bet- ter, well liked, arhong us. He was always as enthusiastic infollow- ing the Maroon to victory as he was in following the lines of rea- soning of his professors during the four years he was with us. His activities were always wcll-bal- anced, no Fordham function was complete without him, and in the midst of philosophical contro- versyjohn always came to the fore. John, in the future, we are sure will attain success in his chosen field, and with sincere regret we say, "So Iong,Jack!" FORD!-IAM JOHN PRYOR, A.B. Regis High School n llll IIII Frerlaman Forum: Council of Debate, 2, 3, 4 250 FURDHAM THOMAS P. QUILTY, A.B. Regis High School 1 1 I my :ill lr "P : ll 5 u11s'r thoug he nlnay be, Tom is one of e best liked and Frefhmmz Forum! Sodaligf, 1, 2 3 4 u I I ' I 251 most admired en of the Class. Beneath his unpketentious exterior we have found the sterling quali- ties which are always character- istic of the unassuming. For Tom, nothing was impos- sible. Always a zealous student, we can safely say his high marks justified his efforts. Socially, he could outshine most of his class- mates and also supersede them in the helping of others. We shall always remember Tom as one of Fordham's most likable and representative students. lil X SOLID and taun -Ed has Won a place amon his classmates second to none. His nature was such that he nevier offended an- other-never failed a friend in need. Interwoven with this sun- niness was the ability to adapt himself to any environment. At dances Ed was ever the charming cavalier, and on the campus he displayed a quiet gcntlemanlincss that gained the respect of all. ,When graduation brings to an end our intimate acquaintance- ship, we will feel as though we had lost something that is irre- placeablc. iw' + EDWIN S. QUIN, B.S. St. Benedict's Preparatory School Mendel Club, 2, 3: Parthe- nian Sadaligr, 1 , 41 New jersey Club, 2, 3, 4: Intcrclarx Bau- ball, 1, 2 252 I F RDHAM ' an 4 illl i 1 -ll in FORDHAM i 1 JOSEPH T. QUINNAN, A.B. St. Thomas High School Pennxylvarzia Club, 1, 2. 3: Sodaligf, 1, 2, 3, 4 253 A ,llyl s s ' l I on is not an asy man to write J about, for hatever is said of him must be keeping with the man-unobtrusive, sensible, neat- ly turned. Tasteful decorations fit into the scheme of things without clashing, not because they are hid- den, but because they are the right thing in the right place. His pleasant, quiet manner and enlightening comments have been a source of great pleasure to us. His sincerity and faithfulness ad- ded to these have placed him among our dearest friends. Reluc- tantly, therefore, do we sec the right of enjoying his close com- radeship pass to others. g 311:11 qi 2 A RIQFINED an Q gentle bearing blended with a mind intel- lectually keen, are the qualities which characterize Andy, and stamp his personality as that of a gentleman, When Andy is not devoting his time to his studies, we can he sure to Find him at a local dance where we cannot fail to notice the assur- ance and grace with which he per- forms. .What he has mapped out for the future we do not know, hut we feel sure that whatever Held he contemplates entering will have obtained av valuable acquisition. l J H p limi fill! Slip fi ANDREW RAFFERTY, A.l3. Fordham Preparatory School 5i0le'lllifJ', 1, 2, 3, 41 French Club, 2,' Council of Debate, 2,' Fre.rlmzmz Forum 254 FORDHAM p Ill i l un V i I Ji' l 1 xx-Q " CORNELIUS R. RAFTERY, A.B. Xavier High School A fadaligy, 1, 2, 3, 41 Debate, 2, i 3: Vigilance Committee, 2 FQRDH M f u llll ll it 255 Q yw Ill ,Ill mug W I I ' u I I l n I EVERYBODY nows tall, genial Neil Rafte . If you see a big smile or hearr the latest songs hummed in the most syncopatcd manner and in a pleasing barytone, then you know he is somewhere in the neighborhood. l-lis favorite occupation, other than singing, is disputation. He will uphold any side ofa question just for practice and amusement. May we predict that wherever he goes, he will always be wel- come, and no matter what troubles Neil undergoes, he will never lose that smile. F. QIIII rf : ' X ' III 'IIII in the gate ith the cutout wide open, 'speedys up the path, stops, and speedy Ed Rammel- kamp has arrived. We can't say whether or not he was so confi- dent as a Freshman but Ed is now a Senior, and a gentleman of great poise. Nothing disturbs him or causes him to lessen his smile. We suspect that he will roar through life as he speeds through Fordham -fast but not furious. p i Y i i A Low, b ack oadster swings FOPXDHAM 1 fm llll EDWARD W. RAMMELKAMP Fordham Prep. Sodality, 1, 2, 3, 41 Frcrbman Short S1001 Guild: Freylamfm Forum 256 FORDHAM ly III un i Il, l I' 1 EDWARD D. REARDON Xavier High School Frefloman One-Act Play! Af- .rixtant Manager Football , 1,2,' Harvester Club, 2, 31' Tfdfk Team, 2: "Ram".S'taf, 2: Vigilance Committee, 21 Svddl- izy, 1, 2,' Loyalty Club, 2 l l 257 will I D is a vivac' us st dent whose E cheery dis osition refused to be bound by any stilted formality. It was this frielldly nature which we will remember most, a nature which gave him his inimitable and charming personality. Always a conscientious worker, Ed attacked every task with a determination and will, which augurcd well for the successful completion of his work. With his will to succeed, Ed cannot but succeed in his activi- ties of the future. tl lll HMI ff, fill. 1 l . i N the yellrs t come, happy I memories will be awakened in the minds of many of the sons of Fordham by the,recollection of their acquaintancewith"Wally." His quiet, untumed appearance concealed a sympathetic under- standing and wisdom which can never be forgotten by his class- mates. His was the understanding heart, and he had the "open ses- ame" to the hearts of his friends. A straightforward, honest man- ner, a rapier-like wit and an abil- ity for concentration and applica- tion to vexing problems, made him one of the most outstanding men of his ,class both socially and scholastically. ,ll WAL'YERJ. REILLY, A.B. Naugatuck High School Frerltmem Debtltirzgf Connec- ticut Club, J, 2, 3, 4: Memlel Club, 1, 2, 3, 41 St. Vincent tlePaul Society, 1, 2, 3, 4, Secretary, 3, Vice-Prerielent, 3, 41 Mlme.r and Mzttnmef'.r, 1,' Partlaenltm Sodality, 3, 4: Glee Club, 3, 4,' Concert Com- mittee, 3 258 F RDHAM i I i III l "H, . I u' If Q,-nv., FORDHAM JAMES F. REYNOLDS, A.B. Evander Childs High School Football, Zi Glee Club, 3 259 I wig, l Illll 'H with of hu- mor, enviable and per- sonality plus He is the I , tenor voice that contributed to the success of the Glee Club in Junior. He also has strong points in his favor when it comes to football. If ever there was a "friend in need" he was that to the "nth" degree. He will long be remem- bered for his friendliness and com- radeship. Beneath all this, how- ever, there lurks that factor so necessary to success, namely per- severance. In Septemberjim will have com- menced his second year in law school. In this endeavor he will reach the heights and be acclaimed. or of a golden sl Ill FT 1 r some arrlist w to paint a pic- I ture-of a "Lau hir Cavalier" in modern dress, he could choose no better subject than Eddy Ricca. There is no one in the class who can excel him in the enjoyment of life. A laugh is always lurking behind his lips and it requires little effort to bring ir forth. Eddy has always been admired for his happy laughter and his personal interpretation of Beau Brummel. So, to a "Boulevardier" we say: "Cheerio." FORD!-IAM I EDWARD F. RICCA, A.B. Secretary of Frerlvman Cla.r.r,' Vice-President of Frerlaman Foramj Vigilance Committee: .Siodaligg 1, 2, 3, 41 "Ram" Staff, 2, 3, 4, Managing Edi- tor, 4,' Council of Debate, 3,' Committee Block "F" Dinner, 41 Track, 2 260 P Evander Childs High School Cbemixtrjy Club, 4: Bafebnll, 2,' Mendel Club, 1, 2, 3, 4 FORDHAM 1 QQ Ill llll I . 261 FREDERICK W. RICHTER, B.S. 1:-il iw I If sl"i PERSEVERANCB alone! assists im- measurably i enabling a man to attain the object of his ambi- tion, and Fred possesses this and many other laudable qualities. His prime motive at Fordham has been to rise to great heights in Chemis- try, and now in Senior we find him an instructor of his favored study. Congenial and loyal, Fred makes a true friend. His brilliant capabili- ties and his determination are sure to carry Fred to success in his chosen field. He leaves these hallowed halls with the love and respect of all his classmates. I III 1 I I 1 8 I I II III f- I ! ' ' ' Ill , I I . xx TE are apt t underestimate the chara, ters of those students who are of a quiet, unas- suming nature. John came under this category. However, it is bet- ter to have a few lasting friends than many temporary ones. Those who claimed John as a friend were not disappointed, for his charm- ing disposition and sense of humor made a superb Personality. We cannot but wish him the greatest success in his life's work, whatever it may be. ,Iorm L. RIORDAN, A.B. Brooklyn Preparatory School Brookbfn-Long Ixlemd Club, 3, 4,' Sadallty, 1, Z, 3, 4,' Prem Club, 2, 31 Vigilance Commit- tee, 2 262 I Y , I .I- sl l I F RD H AM I f an un I , I -III In FORDI-IAM in .:u. I I Y 0 WILLIAM I. Roman, B.S Evander Childs High School 263 TO Bill, with his frliendly smile and chcerfu disposition, must go the palm of being one of the most charming' and worthwhile personalities of the class. His ready wit and congenial spirit is a potent panacea in dispelling troubled thoughts. Looking at Bill from another view, we find him ranking high in the scholas- tic standing of the class. As he departs from Fordham,we hope for his success in his future work. Every moment of associa- tion with Bill will linger as a pleasant memory. .ful is iii: 1 4 . l 3 , 3 ' 2 a ll llama i X h . 1 a JIM is a student agnd a gentlemang one energetic his enterprises, shrewd in his judgments, clever in his discourse, andipleasant among his companions. His nature is a combination of fun and serious- ness. Because of this he is every- one's friend and a decided asset to any gathering. The real reason we like Jim is his instinctive consideration for others. That is the mark of a true and trusted friend. Fordham is justly proud of such men for they can bring nothing but credit to their Alma Mater. lfwi f fi IJ ' f' N N X i i I I ' AMES P. ROGERS, B.S. St. Ann's High School Mciizlel Club, 2, 3, 4,' Spdal- iw, 1, 2, 3, 4 , . 1 . if fi f ii , 1 ilisi If My I . 5535 if 1 , ' 1 pu 2. 51 L .,. f . , . 1 . l , ,l l 264 i :Mk FORDl-MM . . E, I .-. A - .---.....-.g...... .,-,,, -l .1 --Q.-gm.-.. -1... - 1- -. 1 vllf A l Q , ZA A A , I A L .AQ .A i, A ,A -A A 58. A H, A :A .A V . J, in x - ,AAA - A A -A A A A Af"fAf f ,A ' ' - A. F A A A- A 1-fAAl-fra? A A A A A A A A A A ,Q r:...AA A- 2 A ,gf 'YJ -,A,4l1f' "-:211-.,- 1--L' ...Am -A -YAA ' if ., ...A.......... .,.-, .,,A4 -..A ,A.,,...,, A' ff, 9-,AA -, " , 4 -,--.137 1, l 1 no . L la l ' 4 5 N' u rv ' ' . .. ., S. 5. . w v. I -. . . . ,A . . . A A 5 A A A V A , .Z..f.sQA4....:.. .QA .. A f A C-: .,fM,f,,Y.. A A A A 1,, -A A Xi ' ' ' "' ... A A A' A ve--AAA1+a1-fmxsamzn-2,.,.,.,mgg,.,.,,A,,., ff X A ' ' 1 - - -.J -TA. . S3 , - .- al-Isl . ' ' -MMA QHWAWNU c : J ' - . A I an an nz: fm, at 4 5' ' G Z l A ' . ' 3" . F A Ax .3 5' QD-v1 'G - ... H ' ...W- ' - f- ,' , - A ---AA , """""3 nn NN. M :N A . - , - .. -.., ..,. ... .... .,- W... ' . K . - 45'-V' '17 FT? ,.. . . A A- . . ' 1 ' ' v-- -AL, AAWMA-. .... --....,.-- as . A ""f"1Y""f"? - ' N ' """ sam:-,ner -1-an ' v-- ' EF!zf3mr ' A A A ..--A A-Y, A 1 , D '-' , i-......-....-.........- ye' f ' "' ' 'H 'mv vnu- an 13, 1" I n I - I u NA.. , --" - rx - ALBERT G ROCLIANO B S Waverly I-hgh School Cbemuny Club 4 .Ymlalzty 1 2 3 4 Mcflllcl Club 2 3 4 Italian Club 3 4 ClurrBa.r kctbull 2 3 Mzmer and Mummcrr J 2 Glee Club 3 Swzmmmg Team I 2 Band 265 xrnp. CURRICULA ICEIVIEICS seemed to have quxre an xp pe 11 to our fr1,end Albert Not m my men could fulhll the oblxga CIOFIS entalled by memhershxp m so many org 111111210115 But Al IS nor .zn ordnn zry man The same c up 1c1tv for work was found 111 hrs mctnvmes IS .1 student I-l1s class record IS hngh we mlght even mdd very hlgh ACIIV IEV ro some nnphcs h xsre but Al went lbout everyrhxng so efhcxent ly that he wls xlwlys cllm md unruflled He 1I1ECl1LlS to enter the medlcal professlon md we c In presage sue cess for hun 111 rhns held F IJ h Frank ll. a qui t, chap at Fordham. during his f ur Possessed o a qu t, warm smile pregnant with go d nature, Frank won the admiration of the mem- bers of the Class of '31 the very first day of Freshman, and as time wore on, the affection of the Class was more and more his. In the Held of athletics, Frank was versatile, excelling in basket- ball. We can never forget the speed with which he dashed about the court, sinking shot after shot. To one whose life is so well ordered, where judgment is so mature, to wish success would be superfluous. Frank will pursue the course he set for himself and will inevitably attain success. FSRRDHAM gif FRANK P. ROHAN, A.B. Fordham Preparatory School Clan Basketball, 1, 2, 3 Clam Bareball, 1, 2,' Fresh- man Workxlaap, L' Sazlality, 1, 2, 3, 4,' Frerhman Forumf .fpanirla Club, 1 ' 266 1 , 1 f FORD!-IAM THOMAS P. RONAN, A.B. Xavier High School Sodttlity, 1, 2, 3, 4,' Slaort Story Guild, 1, President, J,' Qztill Club, 2, 3, 4,' Cemor, 31 Frerlaman Forum: Council of Debate, 2, 3, 4, Viee-Pre.ri- dent, 4, Intercollegiate De- lmter, 4,' MAROON .S'tez.0', 4 267 ll! lf ' l l iiiufllll R I Ill: F you want t sec ali author and I adebater-1 okforTomRonan. Under that quilet exterior there is a wealth of knowledge and wit. If you can get Tom to talk you will have a very enjoyable time. His observations are penetrating and profound and they are so col- ored by his own humor that one is apt to overlook their depth and only admire their surface bril- liancy. To really know and appreciate Tom, you would have to meet him in quiet surroundings. Despite his retiring disposition, his ability has been recognized--so that he has capably Hlled many executive positions on the campus. 5 sl' , X l l u l l 4 . l gg f t l 1 , ly I E L h I , 9 l I . HJ-ACK" relnindsl us of Shakes- peafe's deli htful jester- Touchstone-"a inost noble and worthy'wit."Not'smiling to hide , tears, Pagliacci-like, but laughing and bubbling over with a zealous zest for life. For the sublimity of his wit and pantomimicry, we are duly grateful. Humor,howevcr, is not his only "forte", he wears other mantles well with the sincerity and dignity of a gentleman. They are far too numerous to recall in these few lines, but let us remember chiefly his aptitude for studies and art, they have been notable accom- plishments, 'not lightly forgotten. X N THOMAS D. Rows, A.B. Bridgeport Central High School Art Editor of MARo0N,' Con- necticut Club, 1, 2, 3, 4, Dane, Committee, 1, 2, 3, 4, Vice- Prerident, 4,' St. john Barcla- mnn'J Society, 2: Initiation Committee, 4,' Pnrtlaenian .Yo- dtziity, 1 t 268 5 l , F RDHAM l III i llll ,Ii FORD!-IAM iid JOHNJ. RYAN, B.S. 1 Evander Childs High School Frerlamem Ba.rketball,' Freeb- man Bareballj Varsiqy Bar- ketball, 2, 3, 41 Varxizy Bare ball, 2, 3, 4: Sodalizjy, 1, 2. Vigilance Committee, 2 269 ' 1 I ,NIE ililllii 'H fill fl" I Ai years roll n andlthe remem- brance of t- e old class grows dim, there will remain a memory of certain cherished friends which will never depart from us. Fore- most among the memories lodged in our minds will be one ofjackie Ryan's smiling countenance. The most likable thing about Jack is that a friend may always approach him and be certain that the same old feeling will be there. It is said that Fortune smiles on those that are cheerfulg ifso,Jack's cup of success will always be hlled to overflowing. N these few lines we can hardly do 'justice to the friendliness and sincerity that characterize Neil. He personihes those homely qualities and virtues which are the backbone of life and without which we can never hope to at- tain success. These make the man and the friendg the man to whom we wish the greatest success in the future, and the friend, whom we shall ever remember for the pleas- ure he brought to our student days. Nl5ILJ. RYAN, B.S. Middletown High School .Slmior Week Committeej C011- nectimt Club,l,2, 3,4,'13unJ,l 1,1 1 -f Y 1 I I vs 1 ' l 1 270 ,.f. -:fy l ,ip ' 4 rl ,,,.- -. K'-f 4 3 V nl, ,V i s' I j 1 7 V nil itll FORDHAM I PHILIP E. RYAN, A.B. Fordham Preparatory , School Cbeerhader, 2, 3, 4,' Rifle Team, 1, 2, 3, 4, Manager, 3, 41 Assistant Manager of Track, L' Sodaliry, 1, 2, 3, 4: Frexlw man One-Act Playa' Varrizy One-Act Playr, 2, 4,' Mimv-f and Mummerr, 2, 3, 41' 'Ramu Staff, 3, 4,' Ojicerr Club, 3, 4, P1'c.ria'ent, 4 271 I l I I l l U' I Ill' I l ' I ow we c me to the dcbo- N' naire "Milly" man, who, in his trim uniforin, with stentorian commands, directs his company through all the intricate evolu- tions of the parade ground. Now we see him in the colorful uniform of the cheerleader, urging the team to greater efforts in their titanic struggles at the Polo Grounds, now as the masterful actor, playing his role superbly in the One-Act Plays. Phil truly is an all-around man successful in every- thing he undertakes. We sincerely hope that he will meet with the same success in whatever vocation he may choose. l l 1 I nu s ,Q . IT is a stringe thing how little one -comes to know the people with whom we come into contact. But it is strangerlwhen one con- siders it, that when we come to place Tom Ryan on paper we feel that we are about to do him an injustice. We might talk about his activi- ties in sports and in the classroom, we mighttalk on his Celtic blood, but it would be far better for us to remember him as Tom Ryan- the man. ' FORD!-IAM I THOMAS D. RYAN, A.B. Fordham Preparatory School Freshman Forum: Quill Club, 2, 3, 4,' Freshman Short Story Guild, Seereturjyg Class Bas- kethall, 3, 41 Vigilance Cbm- mittee, 2,' Mendel Cluh, 3: French Cluh, 1,' Soelulity, 1, 2, 3, 4,' Council of Debate, 3, 4: Freshman Busehull 272 FORD!-IAM l I li, ll i LUDWIGJ. SATTLER, A.B. All Hallows Institute Freihrnan Tmckj Immaculate Conception Sadality, 1, 2, 3, 4 273 ' Ill ' : ' ' I y i s i o I V i i Ill ' i 'Y l ' Ill N l . il 1 I 2 I 1 i I 1 ' ' I l ' 1 u I I i ' 7 f . INCERITY and romptitude char- : S acterized dwig, and the ' i former quality as inherent in all 2 i his thoughts arid actions. In dis- l cussions outside of class, Ludwig 2 was always ready with an opinion which invariably resulted from sober deliberation and to which he tenaciously held, irrespective of the barrage of eloquence leveled at his position. All in all, Ludwig was a conscientious student with a nice sense of his duty to his fel- low students and to his Alma Mater. The place our friend will fill in the world is still uncertain, but let us wish him the greatest good which man can offer-success. litg. Af- ll'-.mi i 1 RALPH P. SCHIPA, A.B. Xavier High School Sodulity, 2, 3, 41 .Ypanirh Club, 2: Brookbu-Long Island Club, 3, 4: Frcrhmnn Forum R- eyer professi n he adopts. This observation is not idle praise but is based on foiir years of con- stant and pleasurable companion- ship with him. His cool, blithe, debonaire front encascs within it a heart which has erected for him a magnificent edifice of friendship. Time may put out celestial fires, but it will never dim the pleasant memories of the many happy mo- ments spent with Ralph. ALPH wili be a redit to what- 274 1 I . : 4 .51 .4 If X ' 'S 'f w F RDHAAM y ji I a ' III llll li FOPXDHAM s G1:oRC1: A. SCHOLZE P .B. Regis High School .Yodality 1 2 3 4' Brooklyn- Lonfg I.rlandClnb 3 4' Fre.rh man Tennix Variity 3 4 Amirtant Manager 1 2 3 Manager 4' Vigilance i Com llll I I i I 1 3 3 I ' 1 9 I , 1 1 Q i I 3 1 1 1 3 ' - V, mittee, 2 w l ' 2 1 N 2 275 l e ffm: l...Ispl :lil 1 I l Honor: is o idea of what a G college mln should be. A good mind, a keen sense of humor, and a gracious nersonality are but a few of the attributes of our friend from Flushing. George has never had any scholastic worries and is an ardent sportsman. Since his Freshman year, he has been one of the mainstays of the tennis team and showed his worth as manager of the same. George will go far. We hold it an honor to have associated with him and are proud to number him among our friends. X 5 glllii gym ,1 X 2 I ' Ill 2 'IIII t 1 4 n HERMAN s one of the intellec- tuals o the enior Class. It is to men like him that the world owes its mighty c thc tow- ering business building and lofty State edifices. He is the exemplifi- cation of the maxim "not by words alone, but by deeds, do we attain the top step of the ladder of fame." When a deep psychological question is to be discussed, either in class or in private, the inquir- ingheyes of the group are always turned toward Herman for a solu- tion of the difficulty. His life is bound to be a success for intellec- tual earnestness will never be denied. '. A FORDHAM I HERMAN F. SCHWARZENBACH, B.S. DeWitt Clinton High ' School Sodaligy, 3, 4 276 FORDHAM lx III i Illl Louis F. SCIARRILLO, A.B. Fordham Preparatory School Xodaligy, 3, 4.' Italian Club, 3: Mendel Club, 3 277 l l I l III ' ' Ill IIII. ' l I I I ' ' II ' I l ' I l ' a I F 0 I HEN we peak 'of Lou, we are talki g of an unselfish spirit, encased n the body of a smiling youth. Honest with himself, helpful to others, sincerity is his keynote. His energy appeared boundless. For in his own affairs or in the service of a friend, he would spend patient hours, struggling without bitterness, over some abstruse scientific problem. His determina- tion brought results. Such a nature is to be admired, such a friend should be cherished. l I 0 a l l I brain, splen- Possassanlof an g..- did physique and an incom- parable smile, St n has been high- ly regarded by a,ll. His thrilling end-runs as a member cf' our great football team will never be for- gotten. Few can boast of such ex- cellent characteristics as those attributable to Stan. Even as the wily spider' spins his diaphanous web, so did this likable chap entwine the silken threads of friendship about our hearts. ' We have no lack of confidence in Stan and we know that in the future, he will justify this belief by plunging through the real ob- stacles of life, and emerging vic- torious. FORD!-IAM I STANLEY E. SHABLESKI, B.S. Lincoln High School ' Football, 1, 2. 3, 4,' New jer- -ffjf Club, 2, 3, 41 Interclau Bzzxketball, 3, 4 278 FORDHAM I l l . l l JAMES C. SHEA, Jn., A.B. B. M. C. Durfee High School Glee Club, 2, 3, 41 Marrachu- .rem Club, 2, 3, 4: Frerhmorl Baseball: Interclmr: Baxeballf Bafketbollj Parthenian Soda!- iijy, 1, 2, 3, 4,' Vanity One-Act Playa, 1,' Sophomore Vigi- lance Committee 279 I ...qi ccr: HoMo! his ums up our E conception of Jim. He has endeared himse f to us. His quick wit and brillizint repartee have brightened many a conversation. We know him also as a scholar, second to none, who wields a facile pen, changing drabness to beauty, making dull inanimate things sparkle with life. He possesses an air of perfect "savoir faire" and is equally at home in the class room or draw- ing room. These qualities, coupled with his keen analytic mind should carry him far in his chosen profession, the "fourth estate." lille ! n M5 K' llai A' any arsit baseball game, you could s e Charlie on the diamond, fielding and hitting the ball with equal facility, his tanned face always lit with a smile, a laugh always at his lips. But off the athletic field, you come into closer contact with this smiling youth. Now he is quiet, unassuming, exceedingly popular. From nothing in his actions could you deduce that here was one of the most valuable members of the nine. A devotee of athletics, Charlie is a Hne example of the mental, moral ', and physical perfection which such recreation can produce. CHARLESJ. SHEERIN, A.B. Manual Training High ' School Sodality, 1, 2, 3, 4,' Freshman Baseball! Varsity Baseball, 2, 3, 41 Brookbfn-Long Island Club, 3, 4,' 5'pa1zi.rb Club, I, 2, Secretaffy, I 280 FOPXDHAM 1 i ul llll I FURD HAM I by THOMAS A. SIANO, B.S. Waltham High School Freshman Footballf Vanity Football, 2, 3, 4, Captain, 3, 4,' Intramural Baeketball, 1, 2,' Frerlaman Trackj Clare Trearurer, 31 Marracbzerettr Club, 2, 3, 41 Committee Chair- man Easter Dance, 3 281 llislf .'.':.ll To encounter his faimous son of Fordham o the campus, you would .never t ink of him as the peerless leader and shining star of our wonderful football team. Quiet and reserved, you must talk to him and draw him out. Then and only then, can you really understand the kind of man he is. When you do, you find a man of striking modesty, delightful personality, and firm convictions. We regret deeply that we are to lose him, for he has endeared him- self to every one of us. A F., l' I u ATIRAYED ilu an ld shirt and a paint-stained pair of pants, Bill was the m n behind the scenes. Lo, the ldirector cried, "Light," the trusty hand of Bill threw the switch, and there was light! Unsung, getting no praise for his work, he labored quietly and efiiciently at the arduous tasks assigned to the stage crew-tasks so necessary and vital to the suc- cess of the plays. Pursuing this same policy of unstinted, quiet, efficient work will insure Bill a bright and promising future. FCDRDHAM 'I "Ill nu WILLIAM A. SIBRANS, B.S. Xavier High School Mendel Club, 2: Stage Crew, 1, 2, 3, 4,' Clsemirtry Club, 4,' Vanity One-Act Plays, 2, 3, 4,' Editor of the "Raton," 4 282 5 FORDHAM EDWARD A. S1LL1isR13, A.l3. Freshman Terzrzisi Fordhom "Monthly," 3,4,'Frerhmor1 Formnj Cozmcil of Dehofe, 3, 4,' Orchextrd, 2, 3, 4: Bowel, 2, 3, 4,' Sodoligf, .1, 2, 3, 4: French Clyh, 1, 2, 3, 4, Vice-Pre.rl- dent, 4, Airoeiote Editor of the French Cluh Yeorhoole, 4,' HW- verter Clreh, 3, 4X VfC0'Pf'f-ff' dent Muxiool Auociotion, 3, 4,' Vdrriry Termir, 3, 4,' MA- ROON Staff, 4 283 MII? .'::.,'l D possesses hat rllre combina- E tion of qu.lities which go to make up thewell rounded man. His keenness of intellectual perception, his appreciation of the beautiful which he has often expressed in his poetry, mark him as a truly cultured man. Ed is moreover a talented musician and has repre- sented Fordham athletically as a member of the tennis team. With his facility in expression, brilliant humor, and social graces, Ed is splendidly equipped for the future and we are confident that Fordham will be justly proud of his achievements. .ii 5 FORD!-IAM ip V' ,R l llll I I . Ill , I X N ' l F ' K 1 l an W l f v l l 'v ix 4 , Q 5 3 , i i 3 H B ll 5 1 FRANCIS T. SIMONS, A.B. 3 e 3 , Regis High school f SJ'i 'ii9 4 .1 fl E 1 Sodaliry, 1, 2, 3 I 3 l , V, " y We meet maiiy men in our , i college lifd. Some of these '13 3. we forget, some have an ineradi- .g 3 E cableplace in the listofourfriends. Q , Frank came to Fordham quietly, ' A lg and as quietly made for himself a ' yi place in our hearts. His gentle l bearing, his easy smile, his friend- i liness have marked him as one of the Hnest. If in distant days you should i meet him, let him know that he has a place reserved before the liteside of your heart. i' 284 JOSEPH SIRAGUSA, B.S. Stuyvesant High School 4 4 5 i 1 Italian Club, 3, 4: French. Club, L' Mendel Club, 2, 31 Chemistry Club, 4 A l I FORDHAM I Ill up ml . I il C i l 285 I u I I I 0 I 'X E559 fu: :l"ifi I oE's quiet ex erior tries but in J vain to hide those qualities of friendliness and congenialitywhich are irrepressiblelin his nature. His warm-hearted Latin temperament makes him a welcome addition to any group and has found for him a host of friends. His keen,analyt- ical mind is sure to bring success to this embryo medico and he will continue to make lifelong friends as he did here at Fordham. Joe departs from our midst with the love and respect of all his class- mates. lll will X STRIDING 'lp thel path with his spurs jingling Find boots glis- tening, George seemed to be a stern martinet. ldut appearances are deceitful. He is far too kind to be a stern disciplinarian. When George first appeared here, he was the shy country boy, but now he is the polished cosmopolitan, the only fellow in the Class that wears a coon-skin coat with the proper verve. If you see all the feminine heads turn on Fordham Road you will be sure thatGeorge is passing. Wherever he goes George will be as popular as he was here because of the gifts of character he pos- sesses. ii il FGRDI-IAM V. llll GEORGE R. SMITH, B.S. St. Bernard's Academy Glee Club,1, 2, 3, 41 Sodalizjf, 1, 2, 3: Mimer and Mummerr, 1, 2, 31 Ojfcerr Club, 4 286 il' FORD!-IAM Ili Brooklyn Preparatory School ' 287 LAWRENCE D. SMITH, A.B. li is 'as i I Amzv has t e stlcadiness of character nd calmness of mien that are tl e marks of a man of genuine ability.That he has this ability is amply testified to by an examination of his scholastic rec- ord. The marks are not brilliant but they show a consistencyg a good steady "8O" man is worth twice an erratic "90" man. We wish Larry the success he deserves for his consistent and un- tiring efforts at Fordham. 1 i ll? Slllil I l l I I l l t 1 Bill: : I l 9 f I E firstl met eorge in the ll swimming ank at Ford- ham. His persever nce in practice led to membership on the Fresh- man team and only the weight of his scientific studies prevented him from joining the Varsity squad. George concentrated all his energy, after' he had given up swimming, to his work in prepa- ration for a medical career. And if what we have known of George ia the lecture hall or laboratory is any sign, we say that the medi- cal profession is gecting a man of whom it can well be proud. FORDHAM I V 'Ill llll GEORGE E. SNIDBR, B.S. Evander Childs High School h Frerhman Swimming Tmmj Mendel Club, 1, 2, 3 288 W JOHN L. SPALDO, B.S. A ' ,K Xavier High School mmf Forum l FORD!-IAM III it i llll 289 Mendel Club, 2: Sollality, 1, 2, 3, 4,' Cbemiftfgz Club, 4,' Vigilance Committee, 2: F reth- f funn l 0 l .S oi-iN is the i al ty we to follow J scientific st dies. Always re- taining his sensit of humor,he read- ily distinguishes between minor things and those which require serious thoughtanddiligent study. His natural inquisitiveness aids in his biological and chemical studies. This has made him a lead- ing student in the science classes. His dislike ofsham is overshad- owed by his readiness to recog- nize any praiseworthy RCI. His kindness and courtesy have en- deared him to his fellow members of the Mendel and the Chemistry Clubs. X gym H . I n 1 0 . if Fort four years yve have hasked in the quiet warmth of jim's kindly personality. Serious, yet always with a smile of encourage- ment, a Word of cheerg quiet, yet full of sincerity and depth of feel- ing, jim has found a place in our hearts that no mere passing of time can erase. It is hard to part with such a friend as Jim. Knowing that he is the exemplification of all that is manly and worthy, we are confi- dent that he will hold the stand- ards of Fordham high above all that is Worthless and make us proud to remember him as our friend. U FGRDHAM I Ill 4 llll JAMESJ. STEWART, A.B. Manhattan Preparatory School Immaculate Conception Soda!- ify, 1, 2, 3, 4: Interclau Banf- ketball, 4 290 l l FORDHAM MARSHALLJ. ST. JOHN, B.S. Weaver High School Connecticut Club, 1, 2, 3, 4 Secretafy, 3, Cloairfnan, 4, University Band, 2, 3, 4: Or- chestra Mana gen, 2, 3: Parthe- nian Sodalizjf, 1, 2, 3, 4: St john Bercbmanu Sodaliry, I 2, 3, 4,' Nfendel Club, 2 291 a I : Ill n Illl' o know the cal Al is to under- Tstand the rel meaning of the oft misused term-friendship. He is the sort of person who becomes more likable the more one knows him. Couple a personality of insou- ciant warmth with a youthfulness of communicable vibrancy,rich in anecdotes, incidents, and humor- ous gems, and you will know Al nearly as well as his friends do. Our earnest hope and ardent wish is that the future, come what may, will be just another page in his book of achievement. la grI!HE god ngothlg 0 d 1 lll ll chance. Apipr priately, War- ren was calllecl St ng. Character, poise, ability, co rtesy, an .oy- alty are but few of his virtues. He is Strong to himself, to others, and for Fordham. The sham and hypocrisy, com- mon to men's character, are not Part of his make-up. He holds to the true, and rejects the false. What is more natural then, that his character should be exempli- fied and reflected in his scholastic record. Such success is truly envi- able and worthy of emulation- but we all cannot be Strong. It is with regret that we bid you good-bye, but we are consoled in the thought that it is but for a time. ' W. WARREN STRONG, B.S. Richmond Hill High School Brooklyn-Long Island Club, 3, 4,' Parthenian Sodaliqy, 1, 2, 3, 4 292 FOPXDHAM I Ill Illl ul i V WILLIAM E. SULLIVAN, A.B. Xavier High School Sodality, 3, 4 FORD!-MM L, Ill nu 293 I mg, .ll Illl l F you take pl asure in the com- I pany of the an who is always clever, yet has :rn instinctive sense of the limits proper to any joke, who is well informed on all the subtle points of any subject under discussion, and who, in general, manages to contribute a spirit of gaiety to the quietest group, seek out and attach yourself to Bill Sullivan. For he has a sense of humor which does not depend upon the presence of any particular com- bination of things outside him- he is a cause of jollity unto him- self. His friends, need we add, are innumerable. lf: I I I I 1 N these dlays cynicism and I destructive crit ism, it is quite refreshing to find 'an enthusiastic youth whose ideals demand some- thing more noble than a hyper- critical outlook on life and on his fellow men. Such a person is Har- old. His interests were not narrow- ly bounded by the ordinary con- ventions of every-day life.Helooks at'life in proper perspective. To converse with such a student is indeed a pleasure, and to know him as a friend, is an even greater privilege. Business seems to be I-Iarold's life work. We may be assured that the undertaking will be in com- petent hands. FGRDHAM HAROLD W. SYMS, A.B. All Hallows Institute Immaculate Conception Soda!- zzy, 1, 2, 3, 4 294 JOSEPH L. TAVORMINA, A.B. Battin High School Partbmian Sozlality, 1,' lm- maculate Conteption Sodalizjf, 31 Italian Club, 3, 4: New mfg' Club, 3, 4,' Boxing Team, I , I FORDHAM n, yi Ill mi J 295 qw Ill se with a wonderful ou is J disposition. Long years of daily commuting from Elizabeth, coupled with afternoon sessions at Law School during his Senior year, have failed to dim his sunny smile or mar his good humor. Despite his good marks, Joe is no bookworm. His studies come easily to him. To watch his care- free countenance during lecture is to know his keen intelligence. I-le has an air of assurance about him which is not belied by his scho- lastic accomplishments. In the long years that are to come, Joe will,with the same equanimity, face the problems of life. l gym 3 l 0 o mattlr wn t Bill attempts, N you may b sure it will be done well. Furthe more, it will be done thoroughly. Bill has an amazing capacity for work-for labor that is really worth the' ef- fort. He is no dabbler in the sci- ences, but one who takes his studies with the seriousness they deserve. Psychology and allied sciences have received Bill's attention, and every one of us can vouch for his thorough knowledge of them. With such genuine ability, Bill will not stop at mere knowledge, but will be a pioneer in the great field of scientific fact. r WILLIAM T. TAYLOR Xavier High School 296 FORD HAM if III nu 'u 'II FORDHAMo JOHNJ. TORMEY, A.B. Cathedral Preparatory School Fresbman Football: Freshman Basketball: Fresbman Base- ball,' Varsity Basketball, 2,' Varsity Baseball, 2,' Immacu- late Conception Sodality, 3, 41 Interclass Baseball, 3, 4,' In- terclass Basketball, 3, 4: Ital- ian Club, 3: Council of Debate, 4,'Haroester Club, 41 "Ram' Stajf, 2 297 L tp lll .'::.,'l 1 il N of' the st unassuming and char ing personalities in the class,Ja k presents the pic- ture of a truly oised gentleman. He will be rem mbered especially for his neatnes in dress and his preciseness in intellectual achieve- ment. He will be remembered also for his stellar work in the inter- class basketball league, being, per- haps, the outstanding player on the '31 team-the team that won the intramural championship twice. He also has the rare ability of making friends with facility because of his pleasant smile. Such a happy combination of qualities as his, is sure to make him a success in any future under- taking. llll rf I l 1 v fr is scldo tha one finds a fel- I low so easily li able as Attilio, and a chap that is so willing and anxious to return friendship as he. His desire to co-operate at all times and in all things, is partly the cause of his success in making a vast number of friends during the .four years we have known him. Not the least of his many vir- tues is his cheerful smile, and it is with this that he always greets us. Armed as he is with his smile of cheer, and fortified with his good fellowship, he cannot but succeed in conquering all manner of foes, if need. be, to attain the coveted laurels of success. FoQDHAM I ATTILIO B. TUcc1, A.B. james Monroe High School Sodalizjf, 3, 4,' Mendel Club, 4,' Italian Club, 3, 41 Trem- urer, 3, 4 298 FORDHAM WIA VINCENT F. Tuzlo, A.B. Xavier High School Mendel Club, 1,' Sodulizjy, 3, .S'p.1ni.rb Club, 1,' College Band, 1.' Broakbfn-Long Island Club 1 299 I I I I I 'Q v If ulzmf as tha ectionately Tcalled,is al ays leasant and has the gift of ayin the proper thing at the rght time. He is quiet, but in h m it is a virtue. His unobtrusive, and unassuming manner won him a warm spot in the hearts of his classmates.Above all, he was a resourceful student who could look any "exam" in the eye. Happiness and contentment have their manifestations in the quiet, gentle smile that ever adorns "Tuzzie's" face. Rarely, if ever in his four years at Fordham, has the sunshine of his smile been clouded. He has chosen medicine for his career and we sincerely wish him much success. ff sl Ill! X llll 'lm c. icons one of New VYork s to the glory of Of a silent and henever troubled trouble, nor on the other hand, allowed trouble to trouble him. Hidden away in that merry, carefree disposition, however, was a serious and lofty ambition. A man of principle and firm convic- tion, unwavering in his faith and loyal to the core, he was a rare example of one who really prac- ticed what he preached. His lofty ambition is to win his way to fame as a surgeon. This conquest should be easy for such a worthy student and thorough scholarf PROSPERO VIGGIANO, A.B. Roxbury School Sodality, 1, 2, 3, 41 Italian Club, 3, 4 300 F O R D H A M fp , n an eltl nu i I -Il I FORDHAM FRANK A. VISCONTI, B.S. Highland High School Italian Club, 3, 41 Chemistry Club, 41 French Club, 1, 2, 31 Interclurr Basketball, 1, 2, 31 Mendel Club, 1, 2,' Sodullzjy, 1 301 3-N IUI I I ' 1 I I r I RA K's care t F rdham has F been one cha acter ed by mod- esty and serene acco plishment. He was never o e to proclaim his worth, so we, as his classmates, must dedicate our efforts in gladly doing it for him. Beneath his modest and manly temperament there abounds a wealth of good fellowship and scholastic ability. Always per- severing and conscientious in his endeavors as he was, we marveled at the ease with which his tasks were performed, and at his cheer- ful and unassuming manner. Frank is jovial, intelligent, and sincere-trulyawell-roundedchar- acter, worthy of the many friends he has made here at college. sl f B 3 a 9 3 o say t at D c is a "charac- Tter" would e, at the very least, inaccurate. 'Fhose who know him, as all of us din, regard him as a personality. His laugh-provok- ing, and his encyclopedic knowl- edge of all sports and athletes will never be forgotten. His was the spirit that never cried "quits," and itwas this same spirit that led his fellow Seniors to victory on the court and earned for him the title of Fordham's most loyal rooter. We shall miss the sound of his bantering voice and his cheery smile. JAMES F. WALD1E, A.B. St. Ann's Academy Frerlaman Tenn!!! Vigilance Committee: Sodaligy, 3, 41 In- terclarr Barketlmll Team, 3, 4: Interclasf Bafeball, 3 302 FORDHAM I FORDHAM .Lili I II ill "' ,.,, THOMAS E. WALDIE, A.B. St. Ann's Academy Frerl 772411 Szuimming Team: Varsity Szuirnming Team, 2 7 3, 4,' Play Shop, 2, 3, 4,' Mifnef and Nlummerf, 2, 3, 4, Pmridefzt, 4,' Freshman One- Avt Play Contertj Varsity One-Act Play Context, 2, 4,' Varfigf Play, 2, 3, 41 Sodal- ity, 2, 3, 4 303 ll iw cron, swim er, srludent-that A is Tom Wa die. Not many in- dividuals coulcl labor as success- fully at such aldiversity of tasks as has Tom. He shined particularly as an actor and as a student. His female impersonation of Rose Trelawny in the Varsity Play brought down the house. In class, Tom's forte was "Psych," and with perfect ease in many a group he masterfully refuted objectors-- proving theses to the satisfaction of everyone-not an easy task, we assure you. We have no doubt that a man of his talents will Find life an easy and a pleasant one. 1 ill I flash 1 - l 1 RTY is the iessende of versatility --a brilliantlstudent, a good mixer and a fine! dancer. These are only some of the qualities that would make a composite picture of Ray. New Jersey has sent many notables to Fordham's campus, but in Ray she has given up a prizeg what is New jersey's loss is Fordham's gain. Ray's keen mind and pleasant personality will send him high in his chosen field. His departure will be regretted by his host of friends. RAYMOND M. WALL, B.S. Lincoln High School New fancy Club, 1, 2, 3, 4, Vice-Prcsidefzt, L' Cl9C7I2fJ'fIfj' Club, 4. Prexident, 4 304 FCDRDI-IAM l ii CHARLESJ. WALSH, A.B. Regis High School Freshman Forumj Freshman :::.g'll One-Act Playsj Sodalizjy, 1, 2, 3, 4, Camultor, 4,' Harvester FCDRDH M I l I r ua llll "' Club, 4,' Council of Debate, 3, 4: MAROON Staff 305 that can be he has a intellect well-de- is such a character. A leader in the class for four years, and especially brilliant in Philosophical studies, he has stood out as a recognized and ex- ceptional student. His power of will, made mani- fest on numerous occasions, has raised him to a place of real esteem among those who consider him an intimate friend. To add to this, Charlie is possessed of a certain benevolence and keenness of wit that has made him more than likable to all. Tpaid strong, W... 1 with a cor veloped wi ELYING the Il le of Sleepy glven to hlm by hxs mates everythmg about,th1s young man evidenced L soul full of lxvely mlrth and a strong tendency for study I-Ins was the knack of umt mg humor 'md work lnto one happy blend .md there are few among us who can say that we found as much fun 1n workmg as dxdjxm No soclal functnon was com plete without hxm No matter how gloomy the company or the weath er be lf 1n or out of class he was always the same Sleepy full of sunshine and good cheer FORDI-IAM I I AMES A WALSH A B Xavner Hlgh School ball 1 Track I Interclan Baxketbull 4 306 Illl I I I I I I I s I I ' V an I' 'nu I I I Il ' I . II .' I I I I : : I Sodaligf, 1,' Interrlau Bare- ' , ,' , I lj ' , I U H H I 1' I FCJRDHAM RICHARD C. WALSH, A.B. Regis High School Sodalizjf, 1, 2, 3, 4,' Interclau Baseball, 1 , 2,' Asrirtant Man- ager Basketball, 1 307 U Y s Is SHOULD you c ance Jpon a group of fellows 1' teni g with rapt attention to a s rious young man expounding the virtues of Univer- sitas Fordhamdnsis, you would find yourself in the presence of Dick Walsh. Dick takes his studies as a matter of course and has never been known to be even slightly disturbed by mere exams. He is usually to be found in the company of Tom Manahan, the other partner in the firm of Walsh and Manahan. Dick is a fellow who is bound to get ahead, and is sure to find a position in life where he can give full scope to that capacity for hard work and concentration which it is his good fortune to possess. 1 j l F lllll ' 3 X e 3 ' Ill vnm' inc'-:resti g and practical A sort of chap as "Whitey," particularly to t ose who were favored with hi friendship. A lover of life, he possessed a scin- tillating sense of humor which en- abled him more fully to appreciate and enjoy it. "Whitey" exempli- fied the leisurely gentleman. An unassuming and reserved personal- ity was his, whose criticism was just and opinion sincere. "Whitey" is somewhat indefi- nite as to his future career but business of some form seems most appealing to him. There is no doubt he will become established with the success consequent on his abilityj ii llinu AMES . WHITE, A.B. All Hallows Institute 308 F O R D H A M f I . III IIII ForwHAM E. DONALD WILSON, A.B. Brooklyn Preparatory School Sodalizy, 1, 2, 3, 4,' Orchestra, 1,',AJJi.rtant Manager Foot- ball, 2, 3,' One-Act Plays, 1, 2: Mimex and Mummerx, 4 309 tw ll! ', l I v I AI:4ONG the ifts which God has bestowed on man, the one which :served to brighten this world the most, is a sense of humor. A Don possesses this gift to at re- markable degree, coupled with a deep insight into human nature, it flashes forth and illumines all within its range. We cannot tell here of his quick intelligence, of his clean outlook on life, of his ability to appreciate the intrinsic value of things. But even without these, Don, the faultless dresser, the cheerful companion, would be as firmly established in the affections of the class. I 1 nom the md nt that e saw "Pistol' we l knew that he possessed al th requisites of a splendid athlete, a strong rugged physique, ability. and brains. The thing that made Pete so popular with us was his modesty and affa- bilityf His superlative and outstanding work on the football team re- ceived national recognition for two years and he gained, this year, a coveted position on the "All American." Yet, despite addi- tional activities in athletics, he maintained a consistently good scholastic record. The A1umni's choice of him as the "Most Val- uable Football Player" gives am- ple evidence of his worth. FCDRDHAM l HENRY F. W1sN1EwsK1, B.S. Camden High School Freshman Faotballj Vanity, 2, 3, 4,' Freshman Basketball, Varriiy, 2, 3, 4,' Track, 3 310 FORDHAM I I Josnpn C. Wow, A.B. Xavier High School Immaculate Conception Sodal- igf, 1, 2, 3, 41 .Ypanirb Club 2,' Intercla.r.r Baseball, L' Freshman Workxbojfj Vigi- lance Committee, 2 311 l ' o THE younges man ln the class, A ! :i'fl u I I l Joe is also one of the most brilliant. We ex ected great things ofjoe after perceiving his capabil- ities in Freshman. He has far sur- passed our expectations. His sunny disposition and pleas- ant smile have cast a ray of sun- shine through our midst, and it is a potent antidote for gloomy spir- its. We will miss Joe when we de- part from these hallowed halls as one misses a true friend and pal. Good-bye, Joe! and the best of luck! will it 1. 1 I ll THIS quie , unp etentious look- ing gentlema is everything that a Fordham man should be. His pleasant smile, his respect for the feelings and rights of others, give toJerry that admirable qual- ity of being a good mixer. Many victories await him in his future work, for no barrier is too high and no task is too difficult for his keen mind. His presencewillbe sadly missed on Rose Hill, but we rnay be solaced by the pleasant memories ofjerry, who will always remain close to our hearts. GERARD A. YORE, A.B. Brooklyn Preparatory School 312 FORDHAM l l FORD!-IAM ,uf II LEO ZILG, B.S. Boston English High School Football, If Track, 1, 2: In+ tramaral Bafketball, 1, 2, 3, 4: Maxeaebiixettx Club, 2, 3, 4, Secretaiy, 4, Cbairman Eaxter Dance, 31 Mendel Club, 2, 3: Pboto Editor MARooN, 4: Committee Boartlerr Initia- tion, 41 Senior Football Ban- quet Committeej Band, 3, 4,' Orcbertra, 3: Senior Week Committee, 4 l 1 313 iiililli ROM Cl1C L L15 111111lA 5 of OUI' FFreshmai1 y ar to the close of Senior,when he'will aid in his de- termination ofl our activities at Fordham in his capacity as a com- mitteeman of Senior Week, Leo Zilg has contributed time and ef- fort to many of the student organi- zations of the college. Under- neath his New England calmness there is an almost unlimited ener- gy, which found an outlet in extra-Curricula activities as well as on the athletic field. Added to this was a courtliness and pleas- antness that never seemed to van- ish and which has raised him to a high place among us. s If ll 1111 III MARCDON ...l , , I I I 5 In Memoriam , Tals were not a true chronicle of Fordham men did we not pause here with bowed heads in memory of those classmates whom the Angel of Death has already called I , to the one Great Teacher. , Peace be to these, who haye gone before us with the sign of faith-and comfort to I , them from this, our memory. i I I 5 FRANCIS X. ATTANASIO 1 I ROBERT S. BRIERTON , FRANCIS -C. DOWLING I W H I I ILLIAM OGAN . I Z LAWRENCE E. KEEGAN 1 I l CLIFFORD LYNCH I ' JAMES A. MALLOY I I I I I I I 1 1 I I 1 R 1 1 "'OF FORD!-IAM 1 11111 1 1 1 1 1 rg 314 u IIIIIIIIIII MAl1QQN,I,,r Moet Debonaire U Moet Likely to Succeed Moet Popular Moet Virile . Moet Representative Moet S erioue Moet Optimietic . Moet Peeeimietic . Moet Unaeenrning Haneieomeet . S Wittieer . Livelieet . Luckieet . Favorite Actor Favorite Actreee Favorite Autlsor . Favorite Divereion Favorite Automobiie Favorite Sport . Favorite S ong . Favorite Smoke . Favorite S tudy . Favorite Profeeeor . Senior Preferences Favorite Morning Neufepaper . Favorite Evening Newepaper Favorite S porte Writer . EDWARD P. F. RICCA EDMUND G. BILL . THOMAS A. SIANO CHARLES PIECULEWICZ . ROBERT E. BOYLE . WILLIIAM BRENNAN FRANCIS H. MCGUINESS . MARSHALL ST. JOHN THOMAS J. EARLY . NEIL RYAN . DASIEL GILMARTIN . VICTOR HURLEY ROBERT MCCABE . WALTER AHAMPDEN , RU.TH' CHATTERTON . DQNN BYRNE . SLEEPING' . BUICK . . FOOTBALL -. RAM . CIGARETTES . . ETHICS FATHER MURPHY HERALD TRIBUNE . WORLD-TELEGRAM . HARRY NASH XXXXXXXXXKXKX I I I I I I I I I 'HOF FGRDI-IAM 1 111111111419 ,.,MApx0QN xxxxxxxxxxx Favorite Girle' College Favorite Type Girl Done Maxt for Fordham Done Mort for Clan Bert All-Round Man Bert Student . Best Athlete Bert Actor . Bext Bluyfer Best Cra.rher Beet Dehater W Beet Dancer Bert Executive Best Mufician Beet Mixer, . . Best Playwright . Beet Orator . Best Poet . Best Proxe Writer . Best Politician Beet .Y mile . . Best .S'en.re of Humor Best .finger ' . . Most Brilliant . X N X X N N X X N N Bm Natured' . X N N N S N X X X Mort Energetic . X N GEORGIAN COURT . . . I . SENSIBLE . SENIOR FOOTBALL PLAYERS WILLIAM S. DREscHER WILLIAM J. MCMAHON . JOHN C. DUFFY ADAM ELCEWICZ . THOMAS E. WALDIE . CARMELO S. PERCONTI THOMAS B. MCGOWAN . . . JOHN LANE NEMO DAT QUOD NON HABET' . A TIMOTHY A. O'LEARY, JR. . JOSEPH D. GATTI . GEORGE F. CUNNINGHAM . MATTHIAS F. CORREA . VINCENT A. CARLIN . WERNER B. GUTENBERG . WILLIAM H. HINES . . RALPH Low . FRANCIS L. GALLAGHER . CHARLESJ. SHEERIN . WILLIAM O. MCCUE . . JOHN E. KELLY VINCENT E. MARONEY . GERALD B. MAOKINNEY N. Txjxx xxxxxxx N CDF FORD!-lAM"' ,M w, ' ..f. K., , -YY'- ,157 Qxw' mi? LJ' 4495 if W ,rffa 1531 L, If 39,2 -1 , ,U fi! P W 4599 45? fr ,AL ,451 ffl? if ,sf N xv N37' 3'5' -5' 519' V ,ty r s X ,, ., M. , ..w,, ,, F r l I k s I I r r . la ' 1-2 U K Y A ,. ESUHAM cghlhm 1 ' " .1 QI!-un Q ll u p - V , ummm 'W 1 u ' Q Q In .A Au' w ,maxi A 1 -ek R A ' It mi N- ,Q 'PZ' I Y'?KH'5 "53Y5i YY YY 'K ,gi Yi I, V V Q sr FO an H A M rv ips' . ,J "L-N A E.. 1 x 1 '1- , 1 1 1 I 1 X 11111111111 MAQQQN ,,, Song at Sunset And so at sunset we stand with the dark valleys before us Wrapped in the coldness of the air of a quiet hill, While the voices we heard acry in our little world. Lost in a greater silence, fail and slowly grow still. Oh let us turn back and seize our hearts again! Oh blessed eyes! look back at the sun and catch its face, That, bearing its flame-like image in our inner minds We may go forth to mysterious valleys and seek our place. And if we have lost the music and the pulsing richness That lies asleep in the pleasant valleys at our backs+ Yet shall all things be beautiful only in the light That teeming over our shoulders etches out our tracks. Yet we shall sit before a fire remembering- And ineffably bitter shall the memory be. Still, sweet, For dreams can draw together the pieces of a broken bubble And snatch the storied hours from beneath Time's feet. Farewell, nurturer of dreams! let us leave you, singing- Singing a song of strength as we depart. Some song, oh mighty Mother, you turned to every mood. Let us go singing, Men of Fordham, her song in our hearts! -PETER J. CUSACK I I 1 1 1 I 1 1 1 1 1 1 1 1 1 I I I I I I "HOF FCJRDHAM 1 iff!! ll 1 ll N X, x X N X N X vw v MAROGN -SN X NNN N X5 3 3 NK N x l X X. X: N N N X N N N X x JUNICRS x x x N K X N x x Ill Il X N X x x X fix x xxxxx xx x x LOF FOllDI-IAM"' lllllllllll MAROCDN an The Junior Class W. BINGHAM Cox . President FRANK Rio i Vice-President JOHN HAYES . Tf6dJIlf6f JOHN P. MCMANUS . .Yecretagf OMB enlightened elder once told a member ofthe Class of '32 that the first two years S of college are the harder and that the last two are relatively easy. He was slightly mistaken, either that or he never came into contact with the intricacies of the Physics Laboratory. This does not mean that work is distasteful to the present Juniors. Oh no-we have a sincere affection for it! We seldom leave class until an hour or so after the final bell in order that we may clear up all class work and begin the morrow properly. lt would be a grave error to omit reference to the new Physics Building and its ex- cellent facilities, which the present Junior Class is the first to use. And it would be a far graver error. even in recounting only the doings of the class, to neglect a hint at the splendid impression made upon the Juniors by the new President of Fordham, Father Hogan. If anything can arouse Juniors from the lethargy attributed to them in song and story, it will be the youthful energy of the present Rector. We almost tremble as we turn to extra-curricular activities. The reason for this is the unprecedented fact that in the Class of '32 there is scarcely a member who has not excelled in some voluntary accomplishment. Since it would be impossible to name them all, we can but mention a few. 'HOF FORDHAMC lllllliil IIYIJ Ji' 1 ' . 3 . ,,,f ' 9 rf 1 1 .94 nv" 1 w if ff fffffflf MARGON vw For example, Robert Ponsiglione and Robert Nebot are the assistant news editors of The Ram. Maurice A. Connell is the staff photographer, and his pictures give to it a graphic quality that it never before possessed. Henry White, besides being a member of the news staff, has charge of the alumni notes. Francis McKenna represents Junior on the sports staff. D. Edward McCarthy constitutes the business staff. And we find the followingJunior names on the news staff: Coughlin, McNamara, Di Giammarco, Leprohon, White, Coman, Tirdel, Moshy, Walsh, Meany, Leary and Cleary. The Fordham Monthly is under the guidance of Editor-in-Chief Richard J. Burke. Without losing its appeal to the inrelligenrmz, it is becoming more readable for the ordinary student, probably because of Mr. Burke's new policy. Joseph Coughlin has another classmate on the staff in Maurice Connell, appointed this year. Probably the entire Junior Class joined the Immaculate Conception Sodality when it was reorganized, and though in accordance with tradition the important officers are Seniors, Juniors do much of the work on the special committees, such as the Speakers' Section and the Social Service Section. Juniors are also prominent in the Harvester Club. The fine work of Bernard O'Connell and Martin Tracey in announc- ing the Fordham-Detroit football game will be remembered for years to come by all who were fortunate enough to be in the Recreation Room on that eventful afternoon. In the Council of Debate, Mr. O'Connell was a member of the team that defeated N. Y. U. He is a member of the Lecture Committee, and is prominent in lecture-debate work. Henry White and Patrick Crowley have already been in more lecture-debates than they will be able to remember by the end of the year, and are scheduled to debate against Holy Cross. Nearly every Junior member of the Council has been or is scheduled to be on a lecture-debate. The varsity play, "Trelawney of the Wells," was a triumph for Junior talent. Joseph F. Coughlin's "scintillating portrayal of Avonia Bunn, captivated the audi- ences on both nights of the play's presentation." Thomas E. Paradine was a perfect Sir William Gower. W. Bingham Cox seemed ideally suited for the part of Tom Wrench. Bernard J. O'Connell's assumed awkwardness in the role of Arthur Gower was a revelation in natural acting. Robert B. Collins was a real Victorian old maid as Trafalgar Gower. Edward F. Miles' loquacity and John F. Costello's nonchalance in the parts of Telfer and Parrott respectively are already a matter of Fordham dramatic tradition. Juniors shone also in the minor parts. The stage manager, Vincent J. Campbell, is a Junior, as are most of his men. No account ofJunior Year would be complete without some mention of the Minor Logic Specimen. Comparatively few men in the class were called upon in this in- quisitorial gathering, so it should be a source of happy memories to the vast majority who breathed a sigh of relief at the close. Fate, in the person of Father Deane, called the students at random, and in spite of the short notice, psychological hazards, etc., all acquitted themselves nobly. This splendid showing was probably due in part to the kindly manner of the Board of Examiners, but it stands nevertheless as a tribute to the talent of '32. Among those called upon were Messrs. Moseley, O'Connell, McManus, Hayes, and Ratigan. The Class of'32 remains distinguished in the realm of song.NormanT. LeBoeuf con- tinues as, accompanist to the Glee Club, while Bannigan, Paradine, O'Connell, McManus, Tirdel, Hartmann, McCarthy, Carey, Gilhuly, and Gorman are numbered among its members. Mr. Tirdel also plays the violin in the Fordham Orchestra. Junior is likewise well represented on the Fordham University Band. 'HOF FORD!-lAM'1 1111111 1.11fD 1 v v MA RO O N N55 N X-3 .- We might refer to the other organizations on the campus in which Junior influence is felt with excellent effects, such as the Spanish Club with Robert Nebot as its President, the French Club with Norman LeBoeuf high in its councils, the new French Monthly, Fordham France, with the same gentleman as its editor and Marcel Delegre as one of his staff, the Playshop and Quill Club which are practically under Junior control. Joseph F. Coughlin is President of the latter organization, and it includes Richard J. Burke, the Editor of the Mantbbf, among its members. When we come to athletics, we must ask the gentle reader to check up on us by means of another department in this volumej In the swimming-pool, Adams,Rutzen, Whelan, O'Brien, Jack Power, Markey, and Harry White have been upholding the Junior reputation. On the basketball court Ransom Parker, Johnny Hayes, and Jim Comerford have been most conspicuous in their contribution to the success of the Maroon team. On the diamond this spring, to judge from past performances, Tobin should bring honor to Fordham and '32. But now for football. How shall we introduce the Juniors prominent in this Held of activity? What shall we say of Bigjim Murphy, the Captain-elect of the football team, and one of the highest scorers in the country?-ofjohnny Janis,Frank Merriwell in- carnate?-of Jack Fisher,whose passing ability rivals Benny Friedman's? Perhaps the best way to get an idea of Junior contributions to the gridiron is to review some of the games, but even this scarcely does justice to their accomplishments. Of the eleven touchdowns made in the game with Baltimore, Murphy made five and Janis two. In the game with Buffalo, Murphy and Janis made four touchdowns apiece. On that hectic occasion when Holy Cross was defeated, it was Jim Murphy who went over for the winning touchdown. When Fordham downed N. Y. U. this year, Murphy was again the scoring agent. ln the victory over West Virginia, Janis made two out of the three touchdowns. Two touchdowns by Janis in the last quarter of the Detroit game were the means of saving the day for Fordham. In the Bucknell game, Murphy was responsible for one of the touchdowns. Of course it would be absurd to give all the credit for these scores to the men who made them. The strong line of Seniors led by Tony Siano deserves the lion's share. But we would remind our reader that the back must be able to run and dodge, and that Murphy and Janis themselves are the best examples of what we mean by this. Moreover, the splendid defensive ability of Davis and Conroy, both Juniors, should not be ignored. Such, then, are the achievements of the members of the Junior Class during the scholastic year 1930-1931. Did we say the achievements? We should have said the beginning of the achievements. The year is young yet. The one-act-play contest, the oratorical contest, the baseball season, and numberless other affairs remain to be run off, and if the Class of '32 runs true to form as it did last year, it will carry off a large share ofthe honors. N N N fl! lil I If . R N N m N N. X X Qxxxxxxxxxix x BOF FORD!-lAM"' 327 wi nf'! mf 1,. f . , k wi A 4? fs M14 Aff' :Q--' x .ff- ff? Wi if .F A B M E v Q19 rr 2 Af? . 4 wi X . 'Lf ,, .f ,. f , 1 5 ffm ? fl. x 1 J 4 S Y W .. , fax '5' Y xv K 53, f ldv. 1 . A JJ' I M ef EJ 5537! .V ' W' ff 1639 W" W W W' M M W W f""N T' YN W-.1 5 ax 11 I- A'i1"1T"A T.: ""- :4t:3"i:'T Q::""i,gg "'A A' .p.5,:,g, ' "' fI.f.gLQ q.g.H -,Q".Qf.l..... W ? 1 ' 2 -K Y I M F I 2' I M E my aff ,T U1 N N1 x3 v v v M A RO O N E Z E i Fi 2 E 11 5 I I. 155 I 1: 4 if ,ii 1i I 5 1 i 3 1 1 i 1 1 I x1 N1 N1 N Ni x x N1 N1 1 E ,S ' S I 1i 1: 5 11 I 1 ,1 1 41 1 1 if 21 Y 1 ! 11k 1x1 'N N1 V N N1 N N N SOPHOMORES K x 1 X N X I f7i N N Q fx X X N N N x N N 'iixx x x OF FOPXDHAMW ' lfffflfflll. MAROONHY The Sophomore Class JAMES E. CLARKE . . President JAMESJ. TREACY . Vice-Prerident JOHN BURKE . , Secretary WILLIAM Moonr . . . Trearurer THE members of the Sophomore Class returned on September 15th. This is putting it rather mildly. In truth,they strutted up the Elm-lined path and accorded each fair tree a passing glance of complete and condescending patronage. They gazed on the ivy-lined buildings with a paternal air of mortgage holders. They commented im- portantly on the improvements, they passed approving judgment on the Physics Building and the Quadrangle. The Freshman Building was the center of their lordly survey, and they turned critical eyes upon the slightly dazed Freshmen. The customary introductory meetings and gatherings were attended to quite speedily and so, too, the pleasant task of acquainting the newcomers with the fine traditions of Fordham and Fordham's finest sons-the Sophomores. Later, the day for which the Upper Classmen had waited, arrived. The little caps looked more ill-fitting than ever, the ties were especially ludicrous and the shiny buttons blazoned the Lower Classmen all over the Campus. For a whole week the stirring Ram Song was manfully mutilated by the aspiring and perspiring Frosh. Underneath this show of humorous despotism a fine spirit of healthy rivalry and general fair play rapidly cemented the ties of friendship between the Under Classes and effectually dispelled the newcomers' fears of excessive hazing and horse-play. The period of transition soon passed over, yet weof the Upper Class wish to take an opportunity to congratulate,sincerely, the Freshmen for the fine spirit in which they took to the proceedings-a spirit which, for ardour and enthusiasm, quite surpassed the wildest dreams of the exuberant Vigilantes. . A XXXXCXXYK I I I I I I I I I K I I I I 'WOF FORDHAMC 1 1111111 IIIITC A 1111.1 111111 MADXQQN ,W J But, alas for the new-found lordship of the Sophs, the Classes began, and with them I li started the struggle with some of the most rigorous schedules of the course. Nothing i daunted however, by the novel subject matter and the nearing threats of examinations, 3 the class found time to gain distinction in the sphere of college and Sophomore activ- ,li ities. The Class was accorded a novel and noteworthy treat in the renewal of the A Q Sophomore "A" Academy under the experienced tutelage of Father Francis P. Don- A nelly, Again the Varsity Play, this time the ever-engaging theatrical drama of ' "Trelawney of the Wells" found the Class well represented in the ranks of the college fl i, Thespians. Chief among them were Edward Purcell's portrayal of the fading Mrs. fl l Telfer,-Iohn S. Stella as the obsequious Captain dePhoenix,and the fine characteriza- tions of Lawrence Ehrhart, and James F. McGrath. Then too, we have the unsung Q heroes of backstage and scene shifting pursuits among whom the Sophs were help- T fully present. N With the advancing fall and the advancing steps of Fordham toward football glory, the Class of '33 found places in the ranks that ably backed up the mighty Senior line 1 I A , and backfield. Chief among the Class gridders was the herculean Connie Murphy in I the line. Then with the later advent of the court representatives of Coach Kelleher 3 the flashing play of Willie Putzer and Jerry Radice earned them places within the .i inner ranks of the team and was the main cog in seeing the team through the re- , ll markable metropolitan victories at the end of the season. Naturally it would be strange to pass over the athletic distinctions of the Sopho- l more class without some reference to its nationally known board-and-cinder pounder, l one Joseph McCluskey. Although he has suffered some setbacks at the hands of more experienced trackmen yet his pace and timing loomed up greater and brighter for Fordham hopes. It was well known that he had his heart set on the Intercollegiates and the memorable evening of Match 7th saw the maroon-jerseyed runner outdistance the fleetest of the collegians to flash home to a victory that also was the smashing of T a record, for he travelled the heart-breaking two miles in the time of 9.17, a new mark I I I I I 'for the I. C. A. A. A. A. Others among the Class of '33 are ably seconding the brilliant work of McCluskey as members of the small and courageous track team. In the realms of the amateur playwrights and make-up artists, the Varsity One- Act Plays, the final contests were run off after weeks of preliminary throat clearing and dramatic gesturing, on the night of February 22nd. Here, too, the Sophomores were strongly present in the production of Francis J. Bauer's "The Spot," and the characterization of Edward Martin, Edward Purcell, John Stella, and other budding actors, who ably supplemented and rivalled the work of the predominant Upper Classmen. To turn to activities more essentially connected with the Class, the work of the Hughes Debating Society during the past year has been excellent. The Holy Rosary Sodality, too, has taken great strides forward in their service of the Queen, under- taking active missionary and catechetical work in the lower city. The Forum of De- . v XXKXXXXXXXXXXXXX I I I 1 1 F 'HOF FORD!-IAM' 1 11111 ll 1111 bate is under the able presidency of Edward A. Martin, while the Sodalityis governed by Thomas V. O'Keefe, as prefect with Thomas Messick and Walter Lawlor as fel- low officers. In these two activities the Sophs have had the able support of theFresh- men even before the latters' emblems of servility, the hated caps and ties, had been laid aside. In the varied other activities of the College, we find the Class well represented in the three modern language clubs, especially so in the sessions of the Spanish Academy and its successful labors for the completion ofthe unprecedented annual. Again in the establishment of the Chemistry Club, Francis P. Delaney was selected for officership, while others were designated to posts as representative committeemen. Back in the field of the nimrods and sharpshooters, we find Edward Flanagan gayly destroying targets at the head of a deadly Soph team which has earned quite a reputa- tion in the interclass tourney and against the many rivals on the schedule. In the sonorous company of the basses and tenors of the Glee Club, we have James F. Mc- Grath as soloist, along with other classmen of the gifted throats. I The journalists and aspiring litterateurs of the year are included in the ranks of the Ram, the foremost of whom are Frank Bauer, Vladimir Svitak, James E. Clark, John F. Arens, Sylvester T. Cohane, and Michael Sheehan. All are in the editorial or sports departments of the college weekly,while having eyes peeled for possibles in Haywood Broun's column or the pages of McGeehan, Williams, or Daniel. Clarke's sport cartoons have been of a special interest and amusement in his faithful caricatures of the grid and court heroes. I With the changes in the Fordham Monrlabf, the work of Edward H. Koch has come to the fore in his splendid art work of frontispiece design throughout the volumes. With this rapid survey of the work of the Sophomore Class in all the activities, one can butget a brief glimpse of the members who are helping to keep the standards of '33 flying, and yet not forget the efforts of very many others not mentioned whose work in all fields has been untiring. All this has been done under the leadership of one of the most popular of presidents, James E. Clark together with the Vice-President, James J. Treacy, whose efforts in the oratorical contest won him unstinted praise. The other oflicers include John Burke, Secretary, and Williamj. Moody, Treasurer. In parting we wish to extend our sincere wishes for success to the outgoing Seniors, whose great memorial, the 1931 MAROON, has afforded' an opportunity for making our Class the better known, and to Father Hogan, SJ., who has been the inspiration of the whole book. To the incoming Seniors we wish success in the conclusion of their courses and in their faint hopes of editing a better MAROON. And to the Freshmen, our sincere hopes for their continued success-for we are broad-minded Sophomores. iii I N X X N X x K N X ,tt .li fl N X X N Hx xsxiifxx xx 'tux OF FORDHAMW' , N- f VA- An 4 .K X , X , 1 J. . xx Wx 1 .Q F , as ,?,+, . g. ,X N K Q K . ., , ,, . ,,, ., r 4 53 1 . . An , ,, , . f . -V A.. ,f 'W if li l A1 v In 1 r f 1:5 'N W3 .ff .J Lf' J' ,J f f' Y ,7 ,J f 4 y x ,f ,ffff g.-7, , .7 Llp v" .4 2 fy, If : mf" if r ,-1 lv" .1 ,r , ,f Q.-6' I V-fl, ., ir I ,v ,, ff' , .. I . Sf' W' W N N ,. P by ,V W' mf W 3 '45, LJ, ,I Aff X X X N N ,,, MAQQQN xxxxxxx xxxx N X N X X X N X N N N X N X X N N FRESHMEN XTR N X 'X X K X X X X llllllll Ill! Fxxxxxxxxxxx x OF FORDHAMW' 1 1 1,441 ff 1.4.41-a Mmzoow . . . The Freshman Class EDWARD A. MALLOY . . Prerident ROBERT E. DELANEY . Vice-Prerident , .JOSEPH F. TIERNEY . Secretagr PAUL D. TRAVERS . . . Treururer LXTE September found a straggling, awe-struck band of exceedingly self-conscious Freshmen gathered before the steps of the Auditorium. They huddled together like so many frightened sheep, under the fierce and appraising eyes of the Sopho- mores, their traditional rivals. Out of this confusion caused by the embarrassment and lack of acquaintance which all Freshmen feel on this occasion, the Reverend Father Deane soon brought order. The new classes were formed and '34 became offi- cially a part of the University. . Later that day and for the few days immediately succeeding, gatherings were held for the purpose of acquainting the Freshmen with the various activities of the Uni- versity, athletic, literary, and social. Caps and ties were distributed, and the speech of the President of the Sophomores, though offered in a spirit of welcome and good- fellowship,was suspiciouslyreceived by the Freshmen. He explained that all the exer- cises of the initiation, as imposed by the members of the Vigilance Committee, were intended only for the benefit of the Freshmen and were meant only to weld them into the spirit of Fordham. Accordingly the next few weeks were filled with novelty and amusements Cfor the Upper-ClassmenD while the Sophs put their red-capped charges through their paces. The campus resounded with inharmonious and ill-timed rendi- tions ofthe pep songs and cheers. 'WOF FORDHAM'2g1 1 1 1 1 rn z, ,--I , 0. 5' .fi Si' .QA :Sv SV .35 ,-3.-' if 1 ffl!!!-lla MAROCDN vw This soon led up to the traditional series of athletic contests which were to de- termine whether the Frosh could emancipate themselves from their bonds or not. The tug-of-war came first. This the Frosh lost in an exceedingly long drawn out battle after they had tied the count at one all. The track meet was held next and a fast stepping Frosh track team raised the hopes of their classmates by a victory over the Sophs. This left the swimming meet to decide the series. Alas-the poor Froshg they lost, but the defeat was not keenly felt for already Sophomore discipline was growing lax and Freshies were appearing about the campus sans cap and tie and going un- molested. The advent of October and the football season brought into the spotlight the achieve- ments of a Frosh football team whose record was no less brilliant than that of Ford- ham's famous varsity. They capped an undefeated season by defeating N. Y. U.'s yearlings to the tune of 26 to O in a game played for the relief of the unemployed at the Yankee Stadium. The victory was none the less costly for it resulted in the breaking of a leg for Walter Uzdavinis, star Frosh center, whom many excellent football critics expect to fill the shoes ofthe All-American Captain Siano. McDermott, a back, and Jim Doherty, end, revealed themselves as a forward-passing combination which will bear plenty of watching when they don varsity uniforms. Johnny Del Isola, line- backing fullback par excellence, Paul Howell, guard, as well as Santarpio and Brennan should prove important cogs in Cavanaugh's machine when they come of age. Track has as yet brought no great distinction to the Frosh, butjake Weber reports that a great number of Yearlings are working out daily in the Gym, and that he ex- pects great things from them in the future. jake also reports that the Cross-Country squad is exceptionally large and abounding in fine material. Next year should see it blossom forth with some noteworthy scores to svvell the Ram's track glories. In the realm of the wooden floor and bounding pigskin '34 also distinguished itself. The basketball team was a snappy, smooth working combination, which, however played in considerable hard luck. Their games with the Penn Frosh, C. C. N. Y. Jayvee and the N. Y. U. Frosh were all lost after the victory had really been won. Ed Kelleher has much excellent material in the Frosh squad. It is fully as impressive in action as most of Fordham's Freshman Fives of past years. Andy Pavlicovic, who also featured himself in the football team's defeat of N. Y. U., and Billy Flemming, last year's Preparatory Captain, have proved a brilliant forward combination through- out the season. Gramala, a center built on the lines of Baker, should prove a valu- able addition to Ed. Kelleher's varsity squad. Danny Williams has also done some fine work at the pivot position. Pepper and Speckman, who played on the left side of the court, have also done some fine work. White, Lobo,Walsh, Dranginis, Lynch, and Mannix have given the spectators many thrills while filling in for the first string boys. The Frosh have also distinguished themselves upon the Rostrum, the gifted oratory of Messrs. Safarik,Scott, and'Appert having carried the day in a brilliant victory over "HOF FORDHAMD lgflll ll 1 1 1 1 rn 11-1 ll 111 lull MAQQQN H.. N. Y. U. We are given to understand that these gentlemen and many others make things interesting by their fierce verbal battles in the weekly meetings of the Debat- ing Society. F Many Frosh names are also appearing in literary circles, with each succeeding issue of the Ram and the Fordham Montbbf. The critical gift of Lawrence Leavey should prove an invaluable addition to the Manthly. The graduation of the Class of '30 left many vacancies on the Ram'.r staff and so we find many Freshmen busy hunting scoops for that weekly publication. The orchestra and the band also report large numbers of '34 men, active in their ranks. Several more who were fortunate in the possession of good singing voices have been accepted in the Glee Club. - ' Mid-Year examinations caused some few of the Frosh to drop by the wayside, but the new February class will more than make up the deficit. February saw the addition of some eighty Freshmen to the already large class. Fordham tennis fans who have been bemoaning the loss of Gene McCauliff will be extremely glad to hear that E. Ramey Donovan, runner-up this year in the National junior Tennis Championships and who during his days at Fordham Preparatory was regarded as the country's outstanding junior player, has entered Fordham with the February group. There is good news also for the golfing enthusiasts for Bernard, "Barney," Lanigan, red-headed State Golfing Champ, who last year led the Pre- paratory team to victory over the varsity, isa member of the first division of the Freshman Class. The newly organized French paper owes much of its success to its- Freshman Business Manager, Finbarr Sullivan, and his staff. The Frosh have been extremely active at Sodality and in the other religious activ- ities of the college. We also hear good reports of them from the French, Spanish, and Italian Clubs. ' The actors are at present busily preparing the parts which the playwrights have written for them, and on the night of the one-act plays theylwill undoubtedly shine forth in all the splendor of their buskins and trappings. The passage of the year will soon make this year's Freshmang,Class a memory. But time can not dim the lustre of the fame they have brought to Fordham. SJ .- , Y... l ! 5 i Y ex 1 I av V if 5 l XXX iii XXXXXX I I I ""'QF.,FORDHAM 1 11111 1 1 111 fi NIZATIONS 'V if' 17 Q N "" I.. 1 I 1 w fab. ...X 4 "'.fw ,Wa i fa l 1 Ffa iight PM 3 I Parthenian Sodality REV. FRANCIS D. O'LAUGHLIN . . . . Director WERNER B. GUTENBERG, '31 . . , Prefect L- EDMUND G. BILL, '31 . . . In Auimmt Prefect l F1 GERALD B. MACKINNEY, '31 Q. . 2nd Arrirtant Prefect 1 ' JUDSON LAHAYE, '31 . I . , ,335 NORMAN LABOEUF, '32 y ' ' Orgdmmr Q . 'X THOMAS MAHER, '32 ........ Acolyte p :THE Parthenian Sodality of Fordham is venerable with years and traditions. It was ' established in 1837 in Kentucky and when the Jesuit fathers came to Fordham in ' fx if 1841,the Sodalitywas transferred hither, and has continued its existencewithoutinter- l ruption up to the present day. A facsimile of the record of the first meeting held in i iw T M, old St. Mary's College in Kentucky on the 2nd of February, 1837, now adorns the present Chapel. The roll-book on which the First name was written bears a list of members, com- plete up to our times and the books of "minutes" contain an unbroken record of the activities of the Sodality from the time of its inception till now. It is almost incredible what results have sprung from this pious and praiseworthy institution in the exercise of its endeavors in honor of the Blessed Virgin Mary. Oneof the many old customswhich still abound at Fordham is thatof holding May Devotions at the foot ofthe statue ofOur Lady. Youthful voices are raised in a hymn after which some member of the Sodality addresses his fellow students on one of Our Lady's countless virtues. Thus it is not without a certain degree of pride that we point to the magnificent body of Sodalists, all of them resident students, that we have here at Fordham, and in particular to the gatherings in the Sodality's own Chapel where Mass is celebrated and the Office is dedicated to our Blessed Mother. The Solemn Reception closes the scholastic year of activity and we hope that this splendid object of devotion will continue to prosper in the furtherance of its ideals as the oldest and most honored organization here at College. l'-ift'l'-ill-I.--- f. -fr -- 1 . x 4 " " is fa g .x 2 xi rf-. .X -A W -. 1 at A ,. .... 1 .L l 1 .. f .. f I ax eww wfm GM I-,ggha xii 2 ad.. raw! I .fx if N 1 , -.fi 3 , . Q 341 lllgl 1111 Ill, MAQQQN ...R The Harvester Club REV. JOSEPH F. BEGLAN, SJ. . . . . Moderator ANGELO C. BADOLATO, '31 . . President WILLIAM F. KUHN, '32 , Vice-Preridcnt EDWARD TIRDEL, '32 . Secretary BERNARD O'CoNNELr., '32 ......, Tfearurcr HE Harvester Club is Fordham's contribution to the mission field participated in Tby Catholic Colleges and as such has established an enviable record. This year the members visited eighteen parochial schools addressing some 6500 pupils on the important problems of home and foreign missions. Under the able guidance of its new moderator, Father Beglan, the club's activities have included many and varied undertakings heretofore not entered upon by the Harvester Club. During Fordham's eventful football season, acting upon the suggestion of its Presi- dent, Angelo Badolato, the members provided a play-by-play description in the Recre- ation Room of the Fordham-Detroit game direct from Detroit. The entire proceeds were donated to the foreign missions. Also, for the first time, the society assumed the mite box collection and the distribution of its proceeds to the needy mission colonies. Literature of educational worth was gathered by the members from different schools for thejesuit Missions, as were textbooks collected from students of the University. A new constitution was adopted with the club's membership one of the largest in its history. The newly approved insignia is now the coveted possession of the senior members. ' 'HOF FCDRDHAM 1 111 1711 lil Ili N 4 Q , Ni i IS 'I I ,f 1. 1 l ,I v rs I I l i N N N N Ni ' I i I ,E Ie l ,V li I i :rg Y N. I 1 Z I N 7 V I I 4 5 i 1 1 X2 K Vi l w I .fm MAPJDON BAN V53 S.XAA!N3 g St. John Berchmarfs Sodality REV. ANTI'iONY L. GAMPP ....... Moderator WILLIAM FARRELL, '31 . . President EDWIN S. QUIN, '31 . . Vice-Prerident LEO ROSENTHAL, '32 . . .... Secretary WERNER B. GUTIENBERG, '31 . . . Marter of Ceremonies JAMES V. HALLORAN, '32 . . . A.r.ri.rttmt Muster of Ceremonier T.John Berchman's Sodality, by no means the oldest or most heralded of the campus S organizations, has come to occupy a new place of favor at Fordham. The past year has marked a lively enthusiasm in this Sodality. Its numbers have increased beyond all precedent, and it has manifested a real zeal in the discharge of its charitable duties, a success which is especially gratifying to our new Moderator, Father Gampp. The roster of this organization includes only Campus students and, although the membership is voluntary, the response has been truly worthy of praise. Its members assist at Mass and other public religious functions held throughout the scholastic year. - For these men there is no material reward, but only the contentment of dispensing their works with devotion and sacrihce. A desire to follow the divine model of charity is their only motive. It prompts them to overcome whatever human weak- nesses they might have, to arise early in the morning, oftentimes at daybreak, to hurry out to the various chapels on the campus to assist at Mass. They accept it as a privilege and duty to serve as acolytes during the Holy Sacrifice of the Mass. Especially noteworthy is the fact, that at the May Mass this year, three former members of the Sodality, now within the folds of the priesthood, ofliciated at the Ceremony, with a student acting as Master of Ceremonies. So much for this year's success. To those who have thus far so successfully advanced the work of the Sodality, we offer our hearty and sincere congratulations, to those upon whose shoulders the future destiny of the organization will rest, we extend our best wishes together with the inspiring message, "Carry On." 3 Ygi-iGCi:'XYii'XX Y CDF FORD!-lAM""" 1 M A A.-,A..z.,,i!,..i!g-a1L- M it 52323 Q N V -.7 W St. Vincent de Paul Society REV. JOSEPH LYNCH, S.J. . . .P Moderator EDMUND G. BILL, '31 . . President WALTERJ. REILLY, '31 . . Vice-President JOHN CoLL1Ns, '32 . . Treasurer EDWARD ORENDORFF, '32 . Secretary f ms Benevolent Society, whose principal doctrine is to evince an abounding Tcharity and unlimited good will, has witnessed the most successful year since its inception at Fordham University. The members have with indefatigable zeal en- deavored to fulfill the numerous duties that their membership necessarily incurred, duties which required extreme sacrifice because of the limited number of members. The altruism manifested by these men, who pledged their services to so worthy a cause, is certainly here deserving of mention. The judicious methods of teaching Catechism at the House of Refuge on Randall's Island effected much good. The assign- ment of its members to Fordham Hospital and similar institutions often terminat- ed in the conversion of mental and physical derelicts to a sanguine disposition, that some relief might be effected in their particular cases. The impoverished were visited, and clothing and food were distributed to them, words of consolation always accompanied these needed contributions and were fre- quently followed by renewed efforts on the part of the destitute to reinstate himself as a self-supporting individual. Much praise is due the Moderator, the Rev. J. Joseph Lynch, S.J., whose efficient and zealous work to effect the charitable end of the Society has inspired its members to greater efforts in the relief of the sick and poverty-stricken. o if an ii A M if fi 344 1.1 , xv f -,V N , 1 -. s The Holy Rosary Sodality REV. TGNATIUS W. Cox, SJ. . Moderator THOMAS V. O'KEEFE, '33 . First Prefect FRANK-I. CRANE, '33 . . Afrirmnt Prefccf THOMAS P. Mnssicic, '33 . Treasurer WALTER E. LAWLOR, '33 . . . Secretmjy PON the inception of the new year of activities the Sodality has inaugurated new branches of influence, all of which have taken Hrm hold among the under- graduates, and are well on their way to success. Chief among the plans which have been put into effect is the arduous develop- ment of active missionary work among the sodalists themselves. This work, which is being carried on in the downtown portions of the city on Cherry Street, has brought the enthusiasm and the sacrifice of the members to the test and the results have been more than satisfactory. This branch consists of general religious and catechetical work among the boys of the East Side together with a supervision of their endeavors. Then,too,the regular work of the Sodalityhas been kept up splendidly as is evidenced by the number present at the weekly meetings, and the donations to thejesuit Missions in the Philippines. The practice of student volunteers for short weekly discourses has been carried on, while the members have been accorded visits from priests who have been to the great mission fields in the Far East. All of the present success has been due mainly to the untiring work and whole hearted leadership of Father Cox, SJ., who has taken up the position of moderator this year. 345 ll 11-1 Ill! lj-. MAQXQQN 1... 't.,lp.uuq 1 Immaculate Conception Sodality REV. J.JosEPH LYNCH, SJ. . . . Moderator RAYMOND HURLEY, '31 . . . Prefect JOHN CAWLEY, '31 . . 1.rt Arrirtant Prefer! JOSEPH O'DONOHUE, '31, . . 2nd Assistant Prcfcct HE present year has witnessed the coming of our new moderator. Father Cunning- Tham, after having served faithfully and well in this capacity for many years, has been called to other duties, and Father Lynch has succeeded him. The new Mod- erator has zealously undertaken the work of the Sodality and the results of his labors have been extremely gratifying. The Sodality has widened the scope of its activity during the present year, so as to exert a more powerful influence on present conditions and to co-operate in the move- ment for Catholic lay action and leadership. Groups were formed, each with a differ- ent purpose in view, and every sodalist was urged to identify himself with one of these activities. One group engaged in welfare work, another in visiting the sick and other charitable works, and another in lecturing before Catholic audiences. Another group was formed to encourage the practice of daily and weekly Com- munions and so to foster an increase in devotion and the greater spiritual development of the members. A crowded chapel each week gave testimony to the devotion of Fordham men for the Mother of God. The prayers and litany were recited fervently at each meeting, and a speech by one of the members on a topic of current religious in- terest completed the order of devotions. The Sodality has sought in every way to exert an influence for good through its members. We are confident that the Sodality in its new strength and vigor cannot fail to instil a great devotion for Mary in the hearts of its members and to become a powerful factor in the spirituallife ofthe college. 'WOF FCDRDHAM' lilllll iiii I i7 ill i V af 1, ,wx A RO O N 1 sb- fee-N 'fr We 'lt i 2 The Council of Debate 5 JOHN LANE, '31 . . . Preyident ' WILLIAMJ. CIOLKO, '31 Vice-President f THOMAS M. HURLEY, '31 . .Yecretmjf N JOHN HAYES, '31 . Trcafurer .ANTHONY PORCELLI, '31 Cemor THOMASJ. MCGRAW, '31 ....... Historian l HE Council of Debate has passed another mile-stone in its glorious and useful ' history. After seventy-seven years, the venerable society still ranks as one of the ' most popular and active organizations on the campus. The present year witnessed a change in moderators when Mr. Kohlbecker took over the direction of theCouncil,replacingFatherWalsh.The retiringlvloderatorhadserved with distinction for two years. The growth ofthe activities ofthe Lecture Groups as l well as the formidable list of intercollegiate triumphs are due in a large part to his l efforts. The Council is indeed fortunate in securing so able a successor in Mr. Kohl- ' becker. . The ofhcers for the present year are as follows: President, Mr. John Lane, Vice- President, Mr. William Ciolkog Vice-President Emeritus, Mr. Thomas Ronan, Secre- tary, Mr. Thomas Hurleyg Treasurer, Mr. John Hayesg Censor, Mr. Anthony Porcellig Historian, Mr. Thcmas McGraw.The Council has continued its remarkable growth, and over sixty men have been enrolled as members. An ambitious intercollegiate schedule has been arranged, and though the complete list is not available, it is certain that the Council will engage in at least lifteen debates with other institutions. This year has marked an almost phenomenal growth in the activities of the Lecture Groups. It is the object of the Council to train its members to speak in public, and to develop Catholic leaders. The Lecture Groups have proven themselves the finest and best method of realizing this object. Consequently, members of the Council have spoken before Holy Name Societies and other religious organizations in and about ,,,, ,Nm ,,,,, ,Aw.,,,,,-,W ,,,, ,, , M-.. ,-,.,r.,.,,,,,,,T.,u-,,,-,,,.,-.- , .- ,... . i .-. L. M .... .. ..,...,. ..-. . ,. -.. .... -1 ...C ...,. . ., 1--- W.. , i . . A .. ii ws Q is K N N N N M N N OF l-fciilbildrflililrf t t 347 . . - . ' 5 ' . .fa Y - .W- ff ff .fd , ,f ,af ff .aff .1 . , jf- , f Q .fab . ,,.., aff' ,fiffi fwfr ,lily Q fi Q ' s- , .. , ,,.,. ., .,,.,.. ,,.,. .... X tp z 1 Q.-unnnm X.. lu W' ze W. 3 wi- ww . V Gd Q . 2 4 -4.....,. w--amen-V --- 2kg..,fc,.. New York, on topics of current interest. In this way a double purpose is achieved, on the one hand, men are trained for Catholic leadership--on the other, the Catholic public is better informed. The Lecture Groups have proven themselves extremely popular and the Council has won the praise and recognition of many prominent men through this medium. The debating season opened with the Varsity meeting New York University in the college auditorium. The Council was represented by William Ciolko, '31, Bernard- O'Connell, '32, and John Lane, '31, who spoke in that order. The Council, opposing Unemployment Insurance, was awarded the decision after an interesting debate. Be- cause of the efforts of the PublicityCommittee, a representative audience was present and the Council was honored by the presence of a distinguished board of judges. On the first trip of the present season a Varsity team traveled to Boston and Canisius colleges. The Council was represented on this trip by Martin Tracey, '32, Bernard O'Connell, '32, John Lane, '31. Boston college was met on February lst, the Council speaking on the Elastic Clause of the Constitution. After an exciting debate and con- siderable deliberation on the part of the judges, the decision was awarded to the strong Boston College team. On the following evening, the team traveled to Buffalo, where they spoke on the opposite side of the same question. They lost another close decision, after an extremely well contested debate. On Sunday afternoon, February lst, a team composed of Henry White, '32, James Sullivan, '32, and Patrick Crowley, '32, met the Holy Cross team in the college auditorium before a large crowd. The Council team spoke against the entrance of the United States into the World Court under the terms of the Root Protocol. Holy Cross was awarded the decision of the judges after a splendid debate. Several excellent speakers will be lost this year through graduation but there are many other prominent members ready to till the vacated positions and to maintain the high standard of Fordham debating. 1 . HQ- . . H, V - yy. I, 348 V 'if' V' fiiilfgiili ,": iii iw The Hughes Debating Society MR. JOHN P. CARROLL, SJ. . . . . . Moderator EDWARD A. MARTIN, '33 . President THOMAS B. O,KEEFE, '33 Vice-President JOHN LEIBFRED, '33 ........ Secretary THE Hughes Debating Society, composed of Freshman and Sophomore debaters, enjoyed an unusually successful year.Weekly debates within the Society provided ample opportunity for all members to take active part, and the eloquence and logic displayed in these debates indicated a high grade of forensic attainment throughout the entire membership. q The Society also engaged in several intercollegiate contests. A Sophomore team made up of Edward A. Martin, John Leibfred and Frank Bauer met Sophomore teams from Boston College and Holy Cross. The question debated was the popular one of Unemployment Insurance. Both contests were held away. The Fordham team gained the decision at Boston, and dropped by a close margin the debate with Holy Cross. Other active and talented Sophomore debaters were Thomas O'Keefe and Robert Malone. All these men should see some intercollegiate service with the Council of Debate in their next two years at Fordham. The Society was also ably represented by a Freshman team. It gained victories over Freshman teams from Princeton, Loyola of Baltimore and Rutgers. A "no- decision" contest was held with New York University. St. Peters College and Georgetown received a decision over the Fordham team in debates which were held at Newark and Washington. The quality of the Freshman members assures continued success for the Society next year. The most popular questions debated within the Society during the year were: Un- employment Insurance, the World Court, Prohibition, Free Trade and the Seating of Senators in the United States Senate. A f R 4 5'3" 5. " 349 4 if MA RO O N V V V The Quill ciub REV. JAMES A. TAAEEE, . . Moderator JOSEPH E. COUGHLIN, '32 . President JAMES BACON SULLIVAN, '32 . Vice-Prexident ROBERTJ. PONSIGLIONE, '32 . . Secretary GEORGE T. MCNAMARA, '32 . Cemor on six years now, an institution of Fordham has been functioning in a quiet but effective way. It is appropriately called the "Quill Club." On many a peaceful Friday afternoon the members of this organization have come together to dissect and criticize their brain-children, in the form of short stories. This eminently sane method of developing latent ability and of maintaining a high literary standard has been the practice of the Club from its very inception. It is hardly neces- sary to remark that there is no better method of stimulating interest in literature than that of helpful criticism of original composition. It gives the beginner, in his writings, confidence and an ideal to strive forg it maintains for the more experienced one, a strict standard and a convenient check on any lapses of technique which may creep into his work. Many a fine story printed in the Monthly owes its origin and excellence to the eHorts of the Quill Club. The importance of such an institution cannot be overemphasized and it deserves the Commendation and praise of all who have the interests of Fordham at heart. Is it not a worthy thing to foster the priceless spirit of true literature and by so doing build a monument to Fordham and all it stands for? This is the true aim of the Quill Club and it is incumbent upon its members to maintain, as they have, a loftiness of spirit and independence of mind which is the mainstay of the writers of true literature. is u. 'Q fc I Q l W M 1 i V i iw V YR ai. We i . 1 V V r i " ' " Q F FG RD H A M 7?'7'7?c77: vvv X X X fi lx , A l i N lg a, N it N T 53 3 N i V i if gb gm fl Qi 'l rl g : 1 N 4 The Freshman Short Story Guild 3, T 1 X l REV. JAMES A. TAAFFE, SJ. . . Moderator j N EDWARD V. O'SULLIVAN, '34 . President JULES BECKARY, '34 . . Secretary 5 Q l N ROBERT FABER, '34 ....... Cmror Q X .ANY a well written essay and sparkling short story published in the Monthly 'X p M can be traced to the Freshman Short Story Guild. Here it was, under the patient l guidance of Father Taaifc, the Moderator of the Guild, that the latent ability of N ambitious Freshmen was carefully nurtured and developed. X The procedure of the Guild is similar to that of the Quill Clubg short stories are 5 N assigned to several members ofthe organization and are read at the next meeting. 1 The stories are then criticized by the members and various corrections are suggested x that would improve them. In this way the writer is immeasurably benehted. If his story is well done he receives just praise, if it is poorly done, the helpful criticism N of the members and theModerator will prevent him from committing the same errors X 4 in his next effort. Following this method the Guild could not be but successful in its efforts to turn out men who are really capable of writing prose as it should be written. acquired a style and polish which fits it to grace the pages of the Montbbf. X By the time the men on the Guild have finished their Freshman year their Work has A word of praise for the Moderator is but just. Through his patient efforts, the X members of the Guild are developing a capacity to express their ideas clearly and N concisely-a faculty that is so sadly lacking in many. N ii 'T Y """ """' "" """" "'.... 'T' ' We x x x evi"fi'Qt'vx'K ii' O F FORD HA M ' ' ' ' ssl ,X xx tx 9 'Li 'X 1 1 ! The Mimes and Mummers THOMAS E. WALDIE, '31 . Prerideut JOHN P. CRAWLEY, '31 . Vice-Prefident W. REDMOND POWERS, '32 . , . Secretary VINCENTJ. CAMPBELL, '32 . . Stage Manager HORACE V. MCNALLY, '32 'IOSEPH M. O'DONAI'IUE, '31 l i . GEORGE E- COLLINS, ,31 P . Board of Dnectorr MR. WILLIAM KELLY, SJ. l ms article is confined to the numerous and noteworthy activities of Fordham's Dramatic Organization, The Mimes and Mummers. ' An adequate resume of the various and innumerable artistic achievements of these sons of "Thcspis" is an evident impossibility. We are primarily concerned with the actor-members of the Class of '31, so that this account of the progress of Fordham's dramatic activity will resolve itself into a description of their work. It is indeed a pleasant retrospect as we survey the dramatic presentations during our Undergraduate days. In the year 1927, the histrionic capabilities of our classmates were first evidenced. Bulwer Lytton's poetic drama, "Richelieu" was selected by the Moderator, Mr. Glenn Walsh, SJ., as the subject for their endeavors. Under his able guidance in this presentation, two members of the Freshman Class, Joseph O'Donahue and Bernard McKernan successfully entered upon their college dramatic career. The former will be remembered for his superb portrayal of the dutiful "julie", the latter for his splendid characterization of "Francis." The Freshman One-Act Play contest followed this Varsity presentation in the spring of 1928. Each member of the Freshman Class hopefully submitted a play to the govern- ing board for their examination. The best plays submitted were then selected for 352 AX actual presentation. "The Game of Chess," a playlet written by Jerome Amante was designated the prize winner. Vincent Carlin who was later to distinguish himself as Fordham's foremost actor, was adjudged the best actor. "Nobody's Business Man" written by Fred J. I-Ieinbuch, was awarded second prize. Thomas Waldie received second honors for acting in his characterization in "The Departure," John Lanes con- tribution to the contest. The arrival of our new Moderator, Mr. William J. Kelly, S. J., was simultaneous with the advent of Sophomore year. It was after careful deliberation, that it was decided to present the well-famed "Othello" by Shakespeare, as out first Varsity effort. When the time came for the casting of the various characters in this production, the Auditorium was thronged with enthusiastic and accomplished aspirants. But under the critical eyes of Mr. John Taylor Breen, J. Gerard Cregan and the Moderator Mr. Kelly, only two members of the Class of '31 survived. Vincent Carlin and Wil- liam O'Donnell manifested exceptional artistic abilityin the parts of "Rodruigo"and the Duke of Venice, respectively. Due to the inexperience of the prospective authors and playwrights, the year 1929 passed without any of our members entered in Varsity competition. The fall of 1929 witnessed the presentation of another of William Shakespeare's famous plays, namely "The Merchant of Venice." Once again the versatile ability of Vincent Carlin sprung to the fore. His portrayal of Lorenzo received the approval and praise of the audience. Thomas Waldie deservedly won the applause of his observers in the part of "Nerissa." William Ciolko, assigned to play the part of Launcelot, succeeded admirably in the portrayal of a diflicult role. The spring of the year 1930 evidenced the submission of innumerable playlets by the members of our Junior Class. Many strove diligently to have a play accepted for hnal presentation. Matthew Correa alone succeeded in upholding the laurels of his class. His facile pen produced the playlet "Loyalty," whose entire cast was constituted of members of his class. 353 Lil' 114- MARUON v we Our Senior year arrived.The Senior members of the Mimes and Mummers anxiously awaited the decision of the Board of Directors, as to the particular selection they would make concerning the Varsity presentation, Sir Arthur Wing Pinero's drama -"Trelawny of the Wells" was to be produced. It was the graduating year for many, and they were desirous of making their bid for an active participation in this, their last Varsity endeavor. From this medley of contestants Vincent Carlin and Thomas Waldie emerged successful.The former in his presentation of Ferdinand'Gadd was the recipient of the plaudits of his admirers, the latter played the part of Rose Trelawny to perfection. William Ciolko played the part of Augustus Galpuys, a bosom friend of Ferdinand Gadd. Together with Mr. Carlin, they furnished a good part of the humorous setting, which genuinely amused the audience. In the Varsity One-Act Plays, Joseph O'Donahue, Philip Ryan, Vincent Carlin, Thomas Waldie, and Bernard McKernan, all members ofthe Class of '31, participated in the various plays presented. Vincent Carlin received the first laurels for acting. The Mimes and Mummers is indebted to the stage crew for their unceasing efforts in producing the scenery, without which the success of the organization would have been impossible. To Mr. William J. Kelly,S.J., Mr. James T. Breen, Mr. J. Gerard Cregan, who unselfishly gave their time and ability and under whose dramatic guidance the society has successfully progressed, we are sincerely grateful. -'N T3 11 I y I I I I I I I I h I I I I I I I I , I I i V I I r' 'NOP FORDHAM 1251111 1 1 1 1 1 fi V V' V G N Nl 3 7 ' 1 T 4 " ' ' i F3 A, , t A , . A I A wana-af .' . 2 . , . I The Fordham Monthly RICHARD BURKE, '32 Ealimr-in-Chief N Amirtmzt Editorf PETER J. CUSACK, '31 MAURICE A. CONNELL, '32 WILLIAM C. CUSACK, '31 JOSEPH E. COUGHLIN, '32 NELSON J. EDGE, '31 JOHNJ. BURKE, '33 WILLIAM H. HINES, '31 ROBERT C. FABER, '34 EDWARD A. SILLIERE, '31 , LAWRENCE A. LEAVEY, '34 EDWARD H. KOCH, '33 Art Editor TIMOTHY A. O'LEARY, '31 GEORGE MULLIGAN, '32 Bzuinefr Mafzager Afriftmzt Bufirzen' Manager TIAIE Fordham Mozztbbf, one ofthe oldest and most influential of our college organ- izations, has concluded with us, its forty-ninth year of service. Since its birth, this serious voice of the student body has been interpreting the social and intellectual vicissitudes of succeeding generations. With the evolution of style in Writing from those early days until the present, the Monrlab has kept apace-not remaining tied to the post of tradition but adopting the changing moods best suited to reflect the feel- ings of the times. Nor yet has it been flying before the Wind, it has remained an- chored by a due regard for solid principles and high ideals. It is our fond pleasure to believe that, in this, our year, The Fordham Monrbbf has continued along its course in the same glorious fashion which has marked its path during all its life. 'Lx x x C F FO RD H A M ' " ' 111 1 If 1111 1 1.13, MAQQQN W... The personnel for the year 1930-31 was for the most part made up of Seniors, and it was upon them that most of the work necessarily fell, Three, Peter Cusack, William H. Hines and Edward A. Silliere, devoted most of their time to writing verse. Their efforts produced many bits of excellent poetry. They carried on the great tradition of the Montlaly. As for the prose-William C. Cusack and Nelsonj. Edge have as capably performed. The former was the author of many delectable short stories and light essays, and the latter wrote in a more serious and erudite vein. The financial department of the magazine was for the second successive year, carried on by Timothy A. O'Leary, whose energetic management was responsible for its success along this line. The Humor section, the Antidote, was handled by William O. McCue, whose wit is equally appreciated by both the readers of the Monthly and the Rom. The "Theatre" was conducted by Peterj. Cusack, who reviewed current plays and operettas. At the beginning of the year a general revision of the form of the magazine was put into effect. A new cover, featuring the tower of the Church, and a Gothic type of lettering, was designed by the Art Editor, Edward H. Koch, '33, who also drew the frontispiece for each number. The changes improved the appearance of the magazine to a marked degree. Richard J. Burke, '32, was the Editor-in-Chief. His timely essays have been com- mended for their appropriateness. The members of the staff will best remember the Monthly as the medium of forming many valuable friendships. The inspiration, the mental stimulus, and the helpful criticism of the Moderator ,will always remain as part of their cherished memories. The most noteworthy work of the Monthly has been to encourage the beginner. Many a hesitant and inexperienced young author has received just that amount of assistance to further him in the art of writing. taxa 1 l 1 I I I I I I I I I I I I I I I I' I I I I I 'HOF FORDHAM 1 1117177 lifilll I I rw RE E. R. R E. A R. .""': -...f .,,..r I W X R Y ..,.. . .. The Ram JOHN LANE, '31, Editor-in-Chief JOSEPH G. KELLY, '32, Buxinefx Mdlldgll' EDWARD P. F. RICCA, '31. Mdlldgtllg Editor RALPHJ. LOW, '31, Neuu Editor JOHN S. FIELD, '31, .S'port.r Editor GERALD B. MACKINNEY, '31, Circulation Mazzagea' W. O. MCCUE, '31, Humor Editor MAURICI3 A. CONNELL, '32, Stag' Photographer Aniftatzt Neuxr Editorf ROBERT L. PONSIGLIONE, '32 ROBERT NEEOT, '32 Neuu Staff JOHN P. MCMANMON, '31 JOsEPH COUGHLIN, '32 GEORGE MCNAMARA, '32 JOHN D. GIAMMARCO, '32 PAUL R. LEPROHON, '32 JAMES E. CLARK, '33 M. SHEEHAN, '33 HENRY WHITE,. '32 JOHN B. COMAN, '32 VLADIMIR SVITAK, '33 PHILIP E. RYAN, '31 EDWARDJ. TIRDEL, '32 MONEER MOSPIY, '32 5' ta jf Artiytf Sports 5' ta jf ED MCGRATH, '31 SYLVESTER T. COHANE, Circulation 5' ta jf F. BAUER, '33 JAIvIEsJ. MEANY, '32' JOHNJ. LEARY, JR., '32 JAMES CLEARY, '32 JOHNJ. CALARCO, '33 CHAS. H. SANFORD, '34 FRANCIS MCKENNA, '32 JOHN M. COLLINS, '32 JOHN F. ARENS, '33 D. EDWARD MCCARTIiY, '32 Buxinexf .Y ta ff ANGELO C. BADOLATO, '31, Reference Manager HENRY WHITE, '32, Alumni Notes MAURICE A. CONNELL, '32, Exchanger 357 dll!! 1111 Ill- MADXQGN tt. l I ,A E offer a toast to the Kam. We offer a toast to the members of the staff for the Q unselfish devotion they have shown in that most difiicult of tasks, the successful i . . editing of a university newspaper. 1 I I Throughout the year, this worthy activity goes smoothly onward, with the speed if I and precision ofa mighty machine, never faltering, ever maintaining the high standard I I traditional to the Ram. But it seems that the Ram of the past year, with novel and in- i teresting features, with more and finer news, has surpassed all previous marks. And I this is our Ram, the Ram of the Class of '31. So there is a thrill of pride in our voices as we introduce the men, who, inspired by the vigor and forcefulness of the new ' Moderator, Mr. Harold J. McAuley, '29, have made possible this, the finest Ram on ly l record. A As Editor-in-Chief, John Lane proved a line choice. Under his efficient leadership if the paper prospered steadily. His editorials, crisp and clever, his fine business ability, i and his general sense of fitness marked his occupancy of this important post. 3, In the capacity of News Editor, Ralph J. Low found an opportunity to give full ex- l I pression to his efficiency and enterprise. In addition to the ordinary duties of his post I as News Editor, Mr. Low conducted "The Interview," the newly inaugurated column g of the Ram. Faithful and competent,he handled both positions admirably. I J . Edward P. Ricca displayed really remarkable acumen in his ofiice of Managing I 1 Editor. The excellence of the make-up, the fine general newspaper style of the Ram, I r which have attracted so much praise in college circles, is directly attributable to y Mr. Ricca. y 1 John S. Field, as Sports Editor, easily upheld the high standard of the "Looking Them Over" column. His sagacious comments, his scintillating chatter, have made s for "Scoop," a reputation which will long be remembered in the annals of the Ram. I f i I To William O. McCue we are indebted for another year of that delightful humor in r I A E the column "Ramblings," This was Mr. McCue's second year at this post and his wit I I A has increased with age. Always effective, this year his column was at its best, I 1 . l Nothing but the finest can be said of Gerald B. MacKinney. As Circulation Manager I , he performed his many and exacting duties faultlessly. He deserves every commenda- I I 3 Angelo D. Badolato was Reference Editor, with the important duty of keeping a I record of the activities of everyone and everything. The ingenious filing system which he arranged will be of inestimable value to the Ram for many years to come. I I john F. McManmon, Philip Ryan, and Edward McGrath were the special corre- 1 spondents of the Ram. They excelled in their department. Mr. McManmon and Mr. I Ryan handled the news "scoops," each with his own individual style, but both had the sure touch of newspaper men. Mr. McGrath, the sports specialist, could treat his I I to Fordham. And it is but just, that these men receive recognition. Hidden in 1 their office, they have labored diligently for four years, hiding their own light under I stories with that deftness so necessary in his work. Again we offer a toast to these men who have conducted an organization so valuable I a bushel, but making manifest throughout the years the glory and achievement of all i that is Fordham's. ' ll . I rr-'GF FORDHAM 135111111 lllfo l . 1 tion for his untiring devotion to his work. I . , , , wi. s - , . , , i ' , ,f -. i f 'L Wi. S' R 1 ., ' .. ,. i xii. .f"f Zi. l-if i 7 " 4435 ,, . ..,. 1' ,. ici. Milli .mmf lx "C X xi' 5 T 'i - K l "-. x ,,.f" "-.,.,vf' ' V 1 i 1:.. , .. . . ..,. ..-, la... . . .., .. . .. . . . .. . . . ., The Fordham University Glee Club REv. ELWOOD F. MCFARLAND, S.J. . Moderator DR. FREDERIC JOSLYN ...,.. . Conductor BOARD OF DIRECTORS JOHN E. KELLY, '31, Chairman ANGELO C. BADOLATO, '31 EUSTACEJ. FARLEY, '32 CHARLES A. McALooN, '31 CHARLES G. NAGEL, '32 EDMUND G. BILL, '31 JOHN F. BRENNAN, '33 T is with an almost unexpected drop of the curtain that the Glee Club members of the Class of '31 march off their stage. Their years of service to the Club has resulted in the attainment of success hardly ever imagined heretofore. As a whole, the mem- bers ofthe Glee Club are to be congratulated for the honors they have bestowed upon themselves and on Fordham. As usual, the membership roll of the Club is always hard hit by graduation, and this year saw fifteen depart. Nevertheless, new voices were selected and after constant training, that degree of perfection was reached which was a deciding factor in the climaxing of so successful a season. Much praise, credit,and thanks is due the Reverend Elwood F. McFarland,S.J.,who succeeded the Reverend Theodore T. Farley, S.J. as Moderator. Through his efforts, the Club's activities have been greatly aided. Also, to the genius of Dr. Frederic Joslyn, the Musical Director, too much acclaim cannot be given. The fame and glory of the Glee Club has been achieved under his artistic guidance. It was through his efiicient leadership that the many audiences have been able to enjoy the true melodious effects of a skilfully conducted male chorus. 1 'wi W Cl F FO RD H A M 'G W The members of the Board of Directors, especially its Chairman, John E. Kelly, '31, are to be praised for their competent management of the Glee Club affairs. To John E. Kelly are to be credited twofold honors, inasmuch as he also has been Tenor Soloist. lt was his golden voice that touched the heart strings of the audiences the Club hashad for the last three years. The Glee Club began its season by singing the Mass of the Holy Ghost. Other appearances, in order, were at the Carroll Club, Good Counsel College, College of Mount Saint Vincent, Holy Name of Mary Rectory, Croton-on-Hudson, Holy Cross Academy, Harrison, N. and Georgian Court College in Lakewood, N. Those chosen to participate in the Intercollegiate Glee Club Contest duly accredited them- selves as worthy of ranking among thc select. The outstanding event of the season was the Annual Town Hall Concert, which was offered to one of the largest and most appreciative audiences the Club has had the pleasure of appearing before. The committee in charge of this Concert was under the Chairmanship of Angelo C. Badolato, '31 ,who was so ably assisted by Charles A. McAloon, '31, Frederick G. Helbig, '31, Charles G. Nagel, '31, Edwardj. Tirdel, '32, and James V. Halloran, '32. Following close on this Concert, the Club appeared at the Rye Neck High School in Mamaroneck, N. Y. The National Broadcasting Com- pany's WEAF Studio next harbored the members in a nationalbroadcast from that station. Ozone Park, L. I. was the next appearance. And so,with an expression that comes forthwith no mean effort those members of the Glee Club of the Class of '31 bid adieu to the fond acquaintances made while par- taking of so artistic an endeavor as the art of music. 360 nv MARQON NNN XXSBXBNXX 1 E 1 l Z,-v' -Y-.M-.-1-nook The French Club MR. BAs1LE G. D'OUAK11. , Moderator NELSON EDGE, '31 . . Preridczzt EDWARD A. SILLIERE, '31 . . Vice-Prerident NORMAN T. LEBDEUF, '32 . . Secrctag' FRANK DORN, ' 32 ....,... Trcarurer ms organization has a distinguished and enviable record. For the Cercle Francuir Tis the pioneer language club of the campus, being founded live years ago by Mr. Charles Hausman, S. J. It likewise has the most comprehensive of the extra-curricula activity charters, namely, to exercise the members in the conversational use of French and to bring them together for social and cultural purposes. To this end, the program has already included debates in French, addresses on French topics by members and prominent non-members, theatre parties to French plays, numerous luncheons, and an annual banquet on board a French liner. Their third claim to distinction is "Le Rayon du Cercle Francais," the Club's yearbook. This pictorial and literary chronical of the year's activity, entirely in French of course,is believed to be unique in college circles. Nelsonj. Edge, formerly vice-president, and now president ofthe Club, is the editor- in-chiefof the"Rayon.' ' NormanT.LeBoeuf,secretaryof the'Club this year and last, is literary editor of the "Rayon." I-le is also the editor-in-chief of "Fordham France," the monthly publication of the University's French Department. These men as well as Edward Silliere, vice-president, and Frank Dorn, treasurer, are this year's collab- orators with Mr. Basile G. D'Ouakil, moderator for the past three years, under whose guiding influence the club began the climb to its present position of promi- nence. llllllllllll IN fx x x x x x x x 'Kxxxxxxxxxx x OF FOPXDHAMW' jg. ai J fa ,.f..,, . ..... fllfflli . ., V ,Wil l I 'll . l l 1 l T l .. W' V s fi l ,l is il l 1 1. ,fa ll il at i 'i 5. fl :nl li il M ! ali l il zz ll l i I l 'l . v 1 il 'x r iz -, v I fel Ms 5 Cl l fl . l Qi il : I E l l The spanish ciub BASILE G. D'OuAK1L . . . Moderator ROBERT A. NEBOT, '32 . President CHARLES E. O'BERLE, '32 . Vice-Prexident JOHNJ. COSTELLO, '32 . . Secretary FRANK DURSON, '32 . . . . Treamrfr THE year 1930-31 marks the third in the existence of the Spanish Club of St.,Iohn's College, Fordham University. The purpose of the club is to aid its members in the conversational use ofthe Spanish tongue-an asset not to be scorned, to encourage interest in Spanish literature, and in the reading of the best Spanish authors. The past scholastic year was noteworthy in the annals of the club for the publica- tion of an annual, the first in the history of the Club. It consisted of a section given over to a series of articles on the Spanish-speaking countries ofthe world headed by a word of greeting from members of the diplomatic corps of those countries. Interesting talks were delivered throughout the year by prominent Spanish-speaking personages, among whom was the eminent Dr. Bueno y Medina, Professor of Lan- guages at San Bartolome College, Bogota, Columbia, a member of the Royal Spanish Academy. The Club members and its oflicers are to be commended for their vvork, as is Mr. Basile D'Ouakil, the Moderator, for his earnest and praiseworthy efforts in behalf of the Club. ' ' ' O F FO RD H A M f?'f W. a A RADICDN .CNW as 'NN It W- W ha me -..-.cu-- -.--as-nun The Italian Club THOMAS MCHUGH, A.B. Moderator JOSEPH D. GATT1, '31 . . . Prerident REV. D12M13TiuUs ZEMA, SJ. . . Honorary! Preridmt ANTHONY PORCELLI, '31 Vice-President GINO L. GIORGINI, '31 . Secretary ATTILIO B. Tucci, '31 , Treorurer 1. Circolo di Cultura Italiana" is a comparatively newly organized modern lan- guage club in Fordham. After receiving the sanction of the Dean two years ago, Joseph D. Gatti called to order the first meeting of the Italian Club. The wonderful attendance which was incurred at the initial meeting has continued each week. The Rcv.Dcmetrius Zema, S.J.,willingly took over the reins as Moderator of the organiza- tion, though he was very heavily occupied with other duties. This circle was greatly needed at Fordham in order that the students having a small knowledge of Italian culture, could become more familiar with the numerous and eminent Italian writers and their works. In a few words, the purpose ofthe organiza- tion is to foster a genuine interest in the wide-spread and mind-nurturing Italian cul- ture. Its secondary purpose is to enable its members to acquire fluency in the conversa- tional use of Italian. Meetings are held weekly at which time a member reads a paper or talks on some phase of Italian culture which he has previously prepared. The mem- bers then question the speaker concerning some phase of his topic. All this is done in Italian. The president often postpones the weekly talk and has some prominent non- member address the Club. During the year there are given, under the supervision of the organization, several social affairs, at which it is customary to have some well-known speaker preside. Jig' .Wt Ex 3. i Slat . ,H . Tia 5 E , A za. 11 1"v is L 'Ibm I 4,- i , Wa i i 1 ir-glix 53 R. .Y 1 IK o P Po an H A M - - If 4-141111 1 ll MAQQQN ..., The Mendel Club REV. JOSEPH AssMUTH, S.J. ...,. . Moderator 'JAMES Forcmss, '32 . . . President EDWARDJ. FLANAGAN, '33 , . Vice-President Lou1sJ. FAz1o, '33 . . . Secretary EDWARDJ. HURLEY, '33 . . . . Treasurer JAMES HALLORAN, '33 ..... Editor of the "Cabmuth" HE Mendel Club was founded ten years ago at the instigation of the Rev. G. A. TCaballero, S.J., that those students who were interested in biological research might devote themselves to special phases of that science covered only cursorily in the classroom. In this way an ambitious student might acquire a thorough knowl- edge of biology. In cases where student experimentation would prove impractical and inadvisable, the members of the organization have as their source of knowledge the library of the Biology Department. As this is augmented from time to time by the latest book on the subject, it is found of much use to the members. During the course of the year, papers are assigned to the members, based on inter- esting biological questions. These are read at the meetings and the writers are questioned. This procedure is varied by having some prominent lecturer in biology address the Club. Recently the Club inaugurated a monthly paper, published under the direction of Mr. James Halloran, '33. Comprised of articles written on biological topics by the members of the Club, it is a noteworthy addition to the publications ofthe University. Too much credit cannot be given to the Moderator of the Club, the Rev. Joseph Assmuth, S.J., a noted and prominent member of numerous scientific associations. Under his guidance the Club has attained a prominent position in extra-curricula activities. "HOF FURDHAM' lI7'f v v V M A RO Q N Af! ...A BX S, of l 'N . QM lb. The Brooklyn-Long Island Club REV. Cx-tAnLEsJ. DEANE, SJ. , . Moderator JOSEPH A. O'DONOHUE, '31 . . Prexident I my WILLIAM R. NEEDHAM, '31 . . Vice-Pfcridmt I' B THOMAS B. MCGOWAN, '31 , . Secretary 'lm EDWARD T. MILES, '32 ...' . . . . Treasurer K ONTINUING the success of the previous year when it was initiated and firmly estab- I , C lished under the excellent guidance of Howard A. Seitz, '30, the Brooklyn-Long Island Club enjoyed a season of happy development. Its membership was increased beyond expectation, and the eagerness which all showed in the resumption of activi- ties last fall, offers proof of the healthy spirit of the Club. The peak of the University's social season, as is acknowledged by all, was reached on January thirtieth, when the club held its second annual dance in the magnificent ' grand ballroom of the Hotel St. George. ln this gorgeous setting, in harmony with the delightful music by Bert Lown and His Victor Recording Artists, a host of Fordham men and their friends rallied in joyful celebration. The smooth efficiency of the Com- mittee and itsChairman, Gerardj. Griffin, '31, was evidentinevery detailoftheevent. When the organization was begun, its purpose was to foster a closer bond of friend- ship between the graduates and undergraduates who live in Brooklyn and Longlsland. No one will deny that it has fully attained that purpose. But it has gone further than that, By virtue of the success in its proper activities, it has been able to advance a work that is of primary interest to the whole University, namely, the assistance of those zealous apostles of our faith who labor in far off lands. onevveviievif o F FO an H A M v V -P 1 H A .nf ' 7 P H' . 111' ,M -.. -. . as - M 3 V --- - V 1 .. ..,, . . ,, ....,.,...,.,.,....,.,,.,,....., ,,,, .. .. . - w. ...F .,,,.1 1 6557 ' 114' t , 'A i i ,ai - .6551 s I i at at A ' The Massachusetts Club are REV. CHARLESJ. DEANE, SJ. , Mgdgrqpgr ff" 5 W1LL1AM-I. MCMAHON, '31 . , Prgyjdmp JAMES A. CRANE, '32 . ' Vice-President My LEO ZILG, '31 . . , .Slegrgmfy WALTE13 SIDLAUSKAS, '33 . . . . . Treqfurer :ll ' 'gl fi INCE the Massachusetts Club was established in our Freshman Year, the Class of X S 1931 is proud of the success which the Club has attained. Though one of the youngest of the State Clubs at Fordham, it has steadily increased in prestige and p widened its sphere of influence in campus affairs. ll Its purpose, as is that of the other State Clubs, is to foster a strong bond of good- fellowship among the student body from that state and to bring the Alumni from Q Massachusetts into closer contact with the undergraduates and the University. l Among the Senior members ofthe Club who have distinguished themselves in other 1 activities are many football men-Captain "Tony" Siano, Miskinis, I-lolmberg, McMahon, and Elcewicz all being "Mass" men. The Annual Easter Dance held at the Copley-Plaza Hotel in Boston in 1930 exceeded all expectations. Under the capable general chairmanship of Timothy A. O'Leary, Ir., '31 and committee chairmen James A. Crane, '32, Leoj. Zilg, '31, Oscar Holmberg, '31 and Edward Murrman, '31, the dance was the most successful social affair ever conductedlin the history of the Club. The Annual Winter Dance of this year was also a social and financial success. The Club extends its sincere thanks to its Moderator, the Rev. Charles Deane, SJ., for the interest he has shown in the development of the Club. 'wr it rl O F FO ll D H A M ":?"i?7l7 l The Connecticut Club REV. CHARLESJ. DEANE, Moderator' JUDSON LAHAYE, JR., '31 . President DONALD T. RowE, '31 Vice-Prarident GEORGE DUNN, '32 . . .Yecremry EDWIN CHARRIOTT, '32 . . Treamrcr VINCENT ENRIGI-iT, '32 . Correiponding .Yecretmgf o foster Connecticut's interest in Fordham and Fordham's interest in Connecticut is the avowed purpose of this Club, the oldest organization ofits kind in Fordham University. The Club was founded by our present registrar, Mr. Thomas Reilly. Much of the success it has attained must be credited to its Moderator, the Rev. Dean. Two formal dances were held this year, one at Christmas in Bridgeport, and one at Easter in Waterbury. Both were unprecedented social and linancial successes. ln forming a closer bond of friendship between students from Connecticut and bring- ing the Alumni of that State into closer contact with the student body, the Club per- forms an important function in the life of the University and for that alone is worthy of praise. Similar organizations have been founded at Fordham, but the honor of having been the first falls to the lot of the Connecticut Club, they have paved the way for many such organizations. lt is the influence of such clubs that maintains the happy social relations that are so much a part of college life. 367 V - lr ,... W ' ,," 1 The New Jersey Club REV. CHARLESJ. DEANE, SJ. . . Moderator THOMAS M. HURLEY, '31 . . President RAYMOND M. WALL, '31 . Vice-Prcrident NELSONJ. EDGE, '31 . . Secretafy ALBERT COYLE, '31 . Trezzrurer MIGHTY army converges on Fordham by way of the Hudson Tunnels and the A Forty-second Street Ferry, arrived, the members seem to lose a bit of their enthu- siasm, and bid each other cynical good-byes as they separate for their respective classes. But at high noon there is a revival of the martial spirit. With a whoop and cry they make for the Biology Building and a professor and several innocent bystanders who have been trampled underfoot, pick themselves up to find that they had gotten in the path of the Jersey Club on its way to meeting. Inside,President Torn Hurley is rapping for order. Ray Wall, being Vice-President, is the first to subside. Jim McCarthy is elected Chairman of the dance and the election is contested so the matter is deferred, while the rival steam rollers gather more votes. Presently jim Lillis, subbing for Nelson Edge, writes into the minutes the confirma- tion of "Mads" election. The Newark Elk's Club Ballroom is reserved for the Fifth of December and Al Coyle begins salting away the money for the patronage and the bids. And then, the dance-the first social on Fordham's calendar, and a brilliant success in every respect! Congratulations to the Committee and the Club! The oflicers and the members of the Club deserve much credit for the enthusiasm and interest they have shown for the advancement of the organization. Year by year the Jersey Club's prestige has grown. if sf A fin if sfo an H A M 368 Z s l If W .A la . I M 1 WA. 5. l rp l I bg? W r l Ars' ' r grit' 1 :fy 'aff' in W Wi l W W lar if l ,v fp .a MAaooN ss xwss-xsxxv The Pennsylvania Club REV. CHARLES DEANE, SJ. . Moderator WILLIAM KEOGH, '31 . . Prcrident NEILSON D. ANDREWS, '31 . Vice-President JOHNJ. BOYLE, '32 . . Secretary THOMASJ. EARLY, '31 . . Treasurer oun years ago, a small group of sturdy Pennsylvanians organized a club in order to Ffurther the spirit of friendship and loyalty to Fordham during their student days, and to bind themselves in after years by means of their pleasant associations, into a loyal Alumni. y That they have been eminently successful is evidenced not only by the increased number of members, but by the exceptionally colorful dances that have been held in their name. With characteristic individuality, the Club this year conducted a highly successful affair at the Redington Hotel in Wilkesbarre. As well played as the music was, the beautiful and tasteful decorations of the hotel added that final touch which has left for all who attended, another beautiful and pleasant memory. In a great meas- ure the palm for this social triumph must be awarded to Mr. Thomas Brennan, '31, in whose capable hands the management of the affair was placed. Sound judgment was displayed in every detail. We cannot fail to mention the friendly and helpful advice which their Moderator, the Rev. Dean, so capably gave. The Pennsylvania Club is grateful for his untiring efforts in their behalf. From its humble beginning the Club has progressed until now it is on a par with any of Fordham's institutions in upholding her principles and furthering the interests of her good name. 69 "':'xi:ifK"K X YXN N iii if OF FCDRDHAMW' W f MA RO O N V V v The Upstate Club' REV. CHARLESJ. DEANE, S.J. . . . Moderator JAMES S. MILLEA, '31 . . . Founder WILLIAMJ. CIOLKO, '31 . Prerident J. RAYMOND DIEHL, '31 Vice-President JOHN MARRA, '32 , . Secretary DENNIS DILLON, '32 ...,.... Treasurer on many years the desire to band together has been suppressed in the hearts of all FUpstaters. It remained for one of us who came from a small town near the State Capitol to take the initiative. To Mr.James S. Millea is attributed the honor ofhaving founded the Upstate Club of New York in September, 1930. Fordham is indeed grateful to Mr. Millea for his untiring efforts in organizing this new club. Under the efficient guidance of its Moderator, the Rev. Dean, it has become one of the foremost ofthe State Clubs. At present it numbers fifty members on its roster. Its chief aim is to foster a spirit of friendship among Upstate students and to promote Ford- ham's interests in the upper regions of the Empire State. The first Christmas Dance of the Club was an overwhelming success, socially and financially. The affair, which at first caused a great deal of apprehension as to its outcome, was skillfully brought to a dazzling conclusion by the executive ability of Mr. Millea, who was Chairman of the dance. Already its influence is being felt, not only on the campus, but in the upper regions of the State. All too soon the Upstaters of '31 relinquish their leadershipg upon their successors falls the weighty burden of guiding to maturity the work which they were privileged to begin. They have shown their ability, and the present enthusiasm of its members augurs well for the future. -f -f V o rr FO an H A M The R. 0. T. C. Officers PHILIP E. RYAN, '31 . . Prerident WILLIAM F. KUHN, '32 . . Vice-Preridmt NELSONJ. EDGE, '31 . . Secretag' ms club is unique onthe campus in that it has as eligible members only the thirty Tstudents in the advanced R. O. T. C. course and it is a striking proof of its popular- ity that they have all availed themselves of the opportunity. The chief activity of the club for the past few years has been the trip to the United States Military Academyat West Point. Colonel Jay P. Hopkins and Captain Napoleon Boudreau have accom- panied the men on the trips and through their connections at the Academy secured for them even more Courtesies than would have been theirs as R. O. T. C. cadets. For instance the Fordham students dined at the oflicers mess and were admitted as ob- servers to several of the regular classes. And finally, of course, came the superb "pa- rade," as the Pointers call it and which is the ambition of every Fordham cadet to initiate in their own demonstration drill. Another event in the club's year is the banquet tendered to the senior members by the Reserve Odicers Association of Manhattan. The Seniors about to receive their commissions and eligible for membership in a Coast Artillery regiment, are the guests of such regiments in and about New York. Here they meet the oflicers of these regi- ments and perhaps decide to join one outfit or the other, which is frankly the purpose of the dinner. These afliliations as well as the fact that alumni are considered active members, tend to keep the club united even after graduation. 3 l l 1 1 l 1 l 1 I I i l l i l 1 l 1 1 1 i D i 1 I 1 1 1 1 l i 1 i 1 l I i i l 1 1 l 1 E l 1 1 1 l 1 1 1 'A 4 1 l l 1 1 O F FO ll D H A M " " " aa W" wil 1 IL gif' if ..fta!l!!4.f1ff.llfL MAROCDN Us 4 M. A If 1 If In A , ai il V, ,M V M32 girl u ' i .foil .-il,.,- 3 W 1 Y l if au" ,WV i .-if r 5 at i it 'I .l 5 . li .4 I. L 1 . W l. 'i The Band REV. HAROLD MULQUEEN, SJ. . . Moderator LIEUT. ERNEST A. HOPF . . Director ANTHONY PISANI, '31 Drum-Major JOSEPH D. GATT1, '31 . . Student-Leader GEORGE COLLINS, '31 . . Manager T is generally believed that the appeal of a football game lies not so much in the game I itself but in the colorful spectacle that is built around the game, and the organiza- tion of any college that lends a great deal of this color, is the band. This year the best band in Fordham's history crossed barons with the bands from N. Y. U., Boston Col- lege, and Bucknell, and emerged second to none. It proved itself to be one of the best in the East, from a musical standpoint, and in matters of marching and dress it cer- tainly was the most collegiate band to be seen anywhere. We can all vividly recall the trim movements of the white-clad legs marching as one into various formations, and the brilliant maroon sport coats giving a real warmth and cheer to the chill grey of a November afternoon. The Senior Class was well represented in the band: Zilg, Porcelli, St. John, Pisani, Dursi, Clear, Gatti,Waldie, Berger, Silliere, and a host of other Seniors sounded tubas and clashed cymbals in a manner worthy of mention. This year's band has been a great one but it cannot become a stagnant organization. Everyone is looking forward to the next one as a better band in both a musical and a military way. i I '52 ""' """' 'f""" H """"""""""''-----Q-----. ...- .--.-.WMA ..... --.W ...... ,.....,,. ,,,,, L-,H , , mu, ff 5 f..,' 'L il? l 'i fl 5-5 Q - .... - ff f" r -i... ...f mt! ri M Nl QV '1FQ?'i?'7'f?'i?"7'F Y I 372 'R 2 we ,X +R .75 , .IV X I Aw v. N. "SE, TR. ' I IQ L4 X Em .If ,. 41 S3 'NE 'v N JK I fu fv U A-Al 'R R. N f lvvx ' i., ,I ,QW I .. I . I " W. ...M N...- The 1931 Fordham Maroon REV. JOSEPH LYNCH, S.J. . WILLIAM S. DRESCHER GEORGE T. CLARKE TIMOTHY A. 0'LEARY, . Moderator . Editor-in-Chief . Amociate Editor-in-Chief R. . GERALD B. MACKINNEY .... An RALPH LOW . WILLIAM O. MCCUE EDWARD MCGRATH .JOHN C. DUFFY . THOMAS D. ROWE REGINALD T. KENNEDY LEO ZILG . LOUIS M. DURSI EUGENE L. DALY WILLIAM P. CONLIN Editorial .Ytajf ANGELO C. BADOLATO RICHARD G. KUERZI EDWARD A. SILLIERE EDMUND G. BILL JUDSO THOMAS EARLY . NELSON EDGE . WERNER B. GUTENBERG THOMAS V. NOLAN WILLIAM F. O'DONNELL THOMAS MANAHAN .J .,,, ,W IH.. .-XX xx .Wx .Ish ,svn Buxinefx Staff BERNARD F. HEREERICH WILLIAM KEOGH GEORGE NICOLAUS ff: N. A - . Bruinem Manager istant Buxineu Manager Senior H iftorief . Humor . Sportx Organizations . Art ClaJ.re.r . . Photography THOMAS R. CREIGHTON CHARLES WALSH PETER CUSACK N LAHAYE . Advertisi ng . Patrona ge . . Subxcriptions JOSEPH W. ALBERT GERARD GRIFFIN JAMES S. MILLEA .jf-, ,N ., KN lx 'N ' S" ' 'F T I 373 ...sf 'x.1. '. 7- ,,,,1l,f,,, MAROQNfvv'A I A I I I I I , 5 I 1 I The Fordham Ram 5 Hail, men of Fordham, hailg on to the frayg I I Once more-our foes assail in strong array, I Ohcc m the old Maroon waves on highg Q I , Wc'11 sing our battle song' e do, or die. N I 5 A With a Ram Ra R f ' tory, I A Ram, R ' R f I y l y I I ' To th Hgh h Hgh I f T 1 1 h gh A 1 I I I I I I R 1 I I I I I ' I I I R 1 'FOP FORDHAM 17411111 1 1 1 1 1 'I NRA! H QV ' EI? 31 Ill . W! " Q in Tl-ILETICS N O 1 5 Q ! N. I 1 I r it v 151 E UM law Um Wm 3 ., 1 :VK 5 J r 1 ' s 1 We , QQ 3 i . 7 1 N., Ng . . . M35 The Fordham UD1VCfS1ty Athletlc J 1 Association Mig 3 REV. JOHN P. FITZPATRICK, S.J. . . . Mademtar l ' I NJ 1 JOHN F. COFFEY, '10 . . . Graduate Manager Q 1 , gm! We O if" If JOHN LANE, '31 . . . President 1 1 Wa' 7 v N THOMAS M. HURLEY, '31 . , Vice-Prcxident ' ' gf 1 'Q EDMUND G. BILL, '31 . . Secretmg' X 1 Ii Ni ,f 23 N. 5? W a , 1 'M wi N N! N? 'J "YN:'YYY:i'i"S'Y'i'S-T 1 1 C F FO RD H A M ' "' ' N ,rf ,iw A R w i N 4. l ..-gif Aq,,.,. I ,VM Af' E 3 . v' I -Z4 ,fsff 5 4 , 1 Agfa? f A1 'V 1 .ry ,451 nw ' Uw- fgzt r 1 .M , ff,-R: , V..-R I 1,2 ' 1 L ,,a ,.' ' " , , 1 wi ! ,ffl f L, 1 'Z 1 ,L xv? F If 1 F41 ,J!f'.'. f .,, ,fi .A . 1 -' ..Lf' fi 4- K, ... 'x 1. Ma I 1 I4 A, , , V 9' .Q ' . .-' M f W ., v , . ,., . .. ,H .. . ., . , ,,,, . .. , ..,. ,,,,, ,.....-,A ,,..-,,.-,.., ,..,,,,..,,...,,.....,,.. . 1 . N ,.,! r' X . 4 M, A .f A 'W 'fv 'Q' 'fr Wx' ...U The Varsity Coaches MAJOR FRANK W. CAVANAUGH EDWARD KELLEHER . JOHN F. COFFEY, '10 JAKE WEBER . EDWARD MCDONOUGH . EUGENE MCAULIEFE, '28 Football Bfuketball Banball Track Swimming Tennif ,,-y L' Aw Kr Rs W1- f 9 Lp He? -T 376 ' e' 4 7 ! r 4' J 1' ,ff my w ,J V .47 f 5 Af W' f W' iff ,pf .-if ,K rdf .7 yy 1 1,2 K VI: A .R . 3 The Varsity Managers WALTER P. MACDWYER, '31 . 4 THOMASJ. MANAl1AN, '31 ANTONIO J. PISANI, '31 . GEORGE J. NICOLAUS, '31 . FRANCIS H. MCGUINESS, '31 . GEORGE A. SCHOLZE, '31 JAMES G. FAGAN, '31 Football Basketball Baurcball Track Swimming Tennif , Golf aaaaaaaaaawQ'QwmwmwM aaal 377 THE VARSITY Fordhanfs Greatest Team - THE COACHES X , " 378 HN , L .fx ..,: 414 The Maroon Eleven opened the season with a smashing victory over the University of Bal- timore team before a capacity crowd in the new Fordham Field. Scoring eleven touchdowns and adding seven additional points, the varsity be- wildered their Southern guests with the might and variety of their attack. When the bell saved the guests, the Maroon had gathered 73 points while holding the opposition scoreless. The Baltimore backs found the Maroon line impenetrable throughout the afternoon. Neither through the line nor through the air could they avail and did not succeed in gaining a single first down. During their drives the Maroon ball-car- riers made a total of 23 first downs and were never obliged to kick. jim Murphy, Maroon back, was the star of the game. Scoring five times from scrimmage, he thrilled the crowd with the brilli- ance of his broken field run- ning. As a result ofhis scores in this game, jim Murphy took the lead in Eastern scor- ing with a total of 30 points. '."'.i X if 697 FORDHAM gf 73 5. CU 2 j O 2 Q f'l'l E 'ark "ii, fl? 45 fl fl at 'Q Mg dl 0 'ri fl? 217 iii fi., .ras ' 7 l 5 t .I ' X. .-' 4 :""". 5 'ta' W W .W at .ta fi .ai M Ni all ai .,v W? Jil" i .ffl Iggpfl ,ga . +I? P ' Q , 1 as 1 V w yi ' : l 1 'VVVOF dl .: 'V V' The Fordham Football Eleven became one of the high-scoring gridiron machines of the country after the second game of the season. In this game at the new Fordham Field the Maroon scored a 71-O victory over the gridsters from the Univer- sity of Buffalo. With the record of the previous season carried over, the game marked the elev- enth consecutive contest for the Maroon without the nasty odor of defeat. As was the case with the Baltimore team, the Buffalo outfit was no match for the gridiron giants of the Maroon team. With Murphy and Janis leading the backfield and Captain Siano and Pete Wisniewski inspiring the line, the Maroon rode over the upstaters to score eleven touchdowns. In the third quarter, the Maroon attack did the most damage. Leading at the half by 33-O, the Maroon opened W a withering onslaught with Janis, Murphy and Piecu- lewicz running wild behind perfect interference from their mates. Pieculewicz, taking a punt, ran 85 yards for a touchdown in this quarter. FCP R D H A M iT77?Mf 80 I Z W af if W af J if I I I I I I I I I I I P' I B i Q efre,asatesi,f1sfgsafgsafj is N , N. N: N N Y wm V V V AAI G wg In a game played under the most fatiguing atmos- pheric conditions, conditions more suitable for baseball or golf, the Fordham Football team de- feated the Boston College Eleven at Boston be- fore 30,000 fans by a 3-0 score. The victory came in the last quarter, when the Maroon, unable to gain further through the line, elected to try for the field goal and was successful. Frank Bartos, standing on the 16-yard line, sent a perfect drop- kick through the uprights to .end what seemed like an inevitable tie game. The game was a gem of defensive play. The two lines were evenly matched and stopped the opposing backs in their tracks throughout the afternoon. But it was the Maroon line that stood the rough going the longer. In the last quarter, Johnny Janis crashed the Eagle line for the gains which put Bartos in position to make his sensational score. In this game the Maroon punting had its first test of the season, with Bartos and Tracey performing nobly. FORD!-IAM 3 BOSTON COLLEGE 0 O F FO ll D H A M " "' W 'E el be V 4 i. 4 2 I I E l E a i l l l E S 5 I S I l. l l i 5 l I l i E l l ll ll l A r i S . i , . FORD!-IAM I 6 HOLY CROSS 0 . In the second major contest of the season, the Maroon Eleven traveled to Worcester and by the slim margin of one touchdown defeated the Cru- saders of Holy Cross College. It was the second successive victory for Fordham over their Massa- chusetts rivals and it gave the winners the edge in the long series between the colleges. A touchdown by Jim Murphy in the first quarterdecided the game. Following an exchange of punts the Maroon marched down the field to the 9-yard line on runs by Bartos, McMahon and Murphy. With the ball finally on this stripe Bartos tossed a pass to Murphy, who raced around the Purple right end for the score. Holy Cross made a strong advance in the final quarter and threatened to upset the fine record of the Maroon team. Led by that splendid quarterback, PhilO'Cormell, the Crusaders advanced to the one-yard line only to meet a sturdy defense which their attack could not pene- trate for a score, before the game ended. sf -f V o rr FO an H A M tevpggz iffffffi V, V af f'v'x,ffi. lMfflOlXl Nh NNW N 'N 'ah N in We ,Y??.'V" The most important victory of the season came to the Maroon when they met the New York University Eleven in the Yankee Stadium before a crowd of 75,000 fans. Scoring in the first quarter on a line plunge byjim Murphy, the Maroon de- fense stopped the Violet backs for the remainder of the afternoon and Fordham won the annual Metropolitan Classic by a 7-O score. The lone score of the afternoon came after but a few moments of play in the opening quarter. Pete Wisniewski had opened the game with a fine kickoff and N. Y. U. returned the ball to the 20-yard. The Violet tried the Maroon line twice but could not gain. Then on the third play, the Violet center passed the ball over Marshall's head and after a feverish scramble, Adam Elcewicz, the Maroon right end, snared the ball on the 4-yard line. On the first Fordham play, Jim Murphy took the ball through the Violet line for the touch- down. Pete Wisniewski kicked the point. O F F O R D H A M ' W' " ':.: '.A'Ai 'V' 'V V FOIQDI-IAM 18 X R WEST VIRGINIA Q Without the services of Jim Murphy, who was injured in the N.Y. U. game, the Fordham Eleven defeated the Mountaineers from West Virginia University by the score of 18-2. By virtue of a safety in the last quarter, the West Virginians had.the distinction of being the first team to score on Fordham up to that point of the season. Johnny Janis proved a capable substitute for Murphy. With the aid of the fast charging Ma- roon line he was by far the best back on the field that day, scoring two of the Maroon touchdowns and aiding greatly in the attaining of the other one by McMahon. The Fordham Line met a stubborn foe in John- ny Doyle. I-Ie gained repeat- edly in midfield but under the shadows of the goal his charges were unavailing against the big Maroon guards and tackles who smothered his every attempt within the 20-yard line. The Mountaineers safety came when Walter Tracey attempted to punt from bc- hind his own goal and was smothered. 'rf if -f -fo rr FO an IMI A M , - A nw , ,X X-, ,, .N , .. l-. I-Kxf, it l wa XXX, x N Wa 'TN i l " X Q: uf , r ' . - ' .' , ,' A 1 1 5' ' . . . . , The Fordham Football team won its seventh straight game when it defeated the Titans of De- troit University at Detroit by the score of 13-7. The Maroon was forced to come from behind to attain the victory,for, as the last quarter opened, the Eastern team was on the short end of the score which was 7-0. The Detroit Eleven scored early in the game on an intercepted pass which was good for an 80-yard run and a touchdown. Not many minutes passed in the final quarter before Johnny Janis was away for the first Ma- roon score of the afternoon. But even then victory seemed beyond the Maroon's grasp when Wis- niewski missed the try for the extra point. ' With the score 7-6, and the minutes flying by, the Maroon began to fight hard. Down the field they went, the backs gaining on every play behind an aggressive line. Finally, Jack Fisher dropped back and hurled a perfect pass to Janis, who ran the distance to the goal- line. -1 - 385 w- ' f f X N 'Q J 1 XXXXXXXXXXX FORD!-IAM 13 DETROIT 7 . Q-A x ,, L sql Ixjwj L x 1111 1111111 MAQQQN W. FOPDI-IAM ST. MARVS Fordham met defeat for the first time in two sea- sons when they fell before a last quarter rally by St. Mary's College of California, losing the game by the score of 20-12. The Maroon gained the lead in the first half on touchdowns byjanis and Murphy, but in the last half, the Fordham line, weakened by the hard games just gone by, could not hold the plunging Angel Brovelli. Going into the last half, the victory seemed al- most certain for Fordham. The Maroon Eleven outplaycd the Gaels during the Hrst half and it appeared that the final score would be substan- tially in theirfavor. Even when the Westerners had scored one touchdown and again another, mak- ing the score 14-12, the pic- ture did not look so black for an Eastern victory. With five minutes to go, Fordham had the ball and they were advancingitstead- ily toward the goal. Then came the forward pass, inter- ception, and the game was won by the Gaels of St. Mary's. ima sf xxx 1 1 I I I nl I -I I I I I I I I I I I I I 'HOF FORD!-IAM 1385 ll 11 1 1 ll 1 The Varsity Eleven closed the season with an impressive victory over the team from Bucknell University. The contest, won by Fordham by the score of 12-O, marked the close of the intercol- legiate football careers of eight of the Maroon's stars of the past three seasons. The men who have played together since their Freshman year made an impressive record for their Alma Mater during their last two seasons, winning fifteen games, tying two, and losing only to St. Mary's of California. This final contest of the season was an easy vic- tory for the Maroon, Janis and Murphy scoring the two touchdowns and the line checking the attempts of Hinkle and the other Bucknell backs to gain. The men who played their last game for Fordham were Peculewicz, Bartos, Shable- ski, Holmberg, Elcewicz, Tracey, Miskinis, Foley, Wisniewski, McMahon and Captain Siano. After the game, Jim Murphy, the Ma- roon's star back, was select- ed by his mates to lead the gridiron warriors of the team next season. He was unanimously the lettermen's choice. FORDHAM 12 BUCKNELL O I il 7 7111 if N M lu N i N X. I i Hxx x xx xxxx387x'iOF FORDHAMW' IL! fllllrlllw, MADXOQN vvv Baseball The Fordham varsity baseball team enjoyed a successful season during the spring of 1930. Engaging in a total of twenty-one games, the Varsity Nine by hard hitting and splendid pitching gained the laurels in thirteen of these engagements. The efforts of the Maroon Nine to defeat her traditional baseball rivals, Holy Cross. Boston College, and New York University were in part successful. In the two games with Holy Cross the Maroon did not fare well at all, dropping the first game played on Fordham Field, 7-4, and returning from the annual spring trip to Worcester on the bad end of the 18-6 score. With the Metropolitan rival, the Maroon divided the honors in the two game series. The Fordham invasion of Boston was most successful, result- ing in a double victory for Fordham. The season opened on April 8, when the Maroon Nine left New York for the South on a four-day trip. The first team to be met on the trip was the team of Princeton Uni- versity, which resulted in the initial victory of the campaign. The day was bitterly cold and during three of the late innings the diamond was sprinkled with a light snowfall. The cold and the snow were not at all conducive to good pitching and the contest became a free hitting affair with the honors for clouting going to the Maroon men. Princeton used three pitchers in an effort to check Captain Laborne, Maynard, and Aube who led the attack for the winners. Coach Coffey started Aube but he could not find the plate owing to the chill in the air and was retired in favor of Neil Andrews in the sixth inning. On the day after the Princeton victory the team visited Philadelphia and was re- pulsed by a strong Villanova team. Neil Andrews was on the mound for Fordham but E W 1' W I I I' I I I I I I I T 1 I I I I y I 'HOF FGRDI-IAMf135i1l1 1 1 1 lil? 71 -V V X. AA A RO O N B- 'Ar N B- i' due to the fact that the Maroon sluggers were tamed by I-lillen, the New Yorkers went on to Temple on the short end of the score. At Temple the Fordham Nine joined with the local team to dedicate the Owl's new baseball diamond. Following their participation in the ceremonies, the Rams pro- ceeded to outplay their hosts, and behind the hne hurling of Andrews won the game, 3-2. Sabatini, Aube, and Maynard led the Maroon batters, each accounting for two hits. Leaving Philadelphia for Baltimore, the Varsity met the Naval Academy on the next day. The Maroon led the Navy in the number of hits but they could not bunch them and were only able to send three runs over the plate while the Navy gathered live runs in the early innings. Jim Comerford was on the mound for the Maroon and pitched a fine game. The team was scheduled to play two games in New York after their return from the Southern trip. These contests were washed out by the spring rains and the schedules of the opponents did not permit their being played at a later date. The first of these was with Columbia at Baker Field and the second would have brought Colgate to Fordham Field. The Maroon Nine defeated the Boston College Eagles in the game at Boston on April 19 and in the return game on May 24, Andrews pitched both of these games. In the First game at Boston, Andrews held the Eagles to hve scattered hits and struck out ten of their batters, winning the game, 7-2. Boston College used three pitchers, off whose offerings the Ram batters, led by Laborne and Sabatini, gathered seven hits. In the second contest, Andrews was again on the mound and behind his splendid hurling, the Maroon hit to victory, 6-3. MX X xiii i'iFi'iTR-imigm O F FGRDHAM "" "' lllllllllll, MAPNOGN vw The games with Lehigh and Muhlenberg were easily won. Comerford held Lehigh to seven hits and three runs while the Maroon batters gathered fifteen hits and crossed the plate nine times. Behind the twirling of Pat Foley, who was in fine form, the Maroon Nine won the game with Muhlenberg, 17-5. Holy Cross won the annual home-and-home series from the Maroon in the first game by a narrow margin and in the second contest most decisively. In the game at Fordham Field, the Maroon held the lead for seven innings but a Crusader rally in the closing innings snatched victory from defeat for the New Englanders and they won 7-4. In the second game Maroon, errors were costly and the Crusaders overwhelmed the visitors, the final score being 18-6. St. Bonaventure and Yale were tamed by the Maroon Nine in April. Jim Comerford pitched the Fordham team to a 10-6 win over the Saints and Neil Andrews stopped the Eli team by a count of 3-1. On May 1 the Rams reversed a decision held over them by the Villanova team. Com- erford pitched and held the Owls to five hits, while his mates gathered six hits off the tosses of Hillen. Fordham won the game by a score of 4-2. The first New York University game was a victory for the Maroon, as Andrews baffled the Violet sluggers, allowing them six hits,while the Maroon, batters gathered thirteen hits. Fordham won the game 10-3. On Decoration Day, the Violet took the second contest played on Fordham Field, 9-6. After winning from St. John's by 4-3, the Army marred the Annual West Point trip for the Maroon team by defeating them 7-3. "'OF FORDHAM 1351111 1 1 1 IFIIJ X X X X, Xi X 1 X ll l ,,, MARQQN XX X X.X:XXXtXX XXX? r St. Lawrence lost to the Maroon when Pat Foley pitching Hue ball shut them out on , Fordham Field, 5-O. This victory was followed by the loss to New York University Q and on the last day of May the Maroon Nine fell before the bats of Manhattan College, L 8-5. l The team closed the season by losing to the strong Syracuse team, 9-5. On Alumni Day, the Varsity defeated the graduates, 5-3. X, X xg xr x , X X , X X l ,R X r X X X X X IXX KN CX xkixex X FOP FORDHAM"' X X x x x X N lx of hi fx V gr ix r N lx lX i i V """"t'C' F FQFUIW-lA V. 1,4 M 7 I ,. '7 .ff-N-Q. .-W"-xt 1 I ,-,F if ,.-1:5 " ' gall' ' 1 2 f -X .W a .,. '. i. - V N I rl In Af, Basketball Good teams area habit at Fordham and the club of 1930-31 proved no exception. Its crushing victories over Yale and Pennsylvania opened the season most auspiciously and served to establish this team as a worthy successor to the great teams of yore. The Quakers were particularly impressed, hailing the Ram as the best team seen in years in the Palaestra. St. Francis, who had the honor of opening our schedule, succumbed to the superior might of the Maroon. Our next foe, those friendly enemies, the Alumni, almost proved to be more hostile than amicable. The 38-29 score clearly indicates the closeness ofthe contest. Coach Kelleher did not regret the defeat of his Alma Mater, rather the convincing manner in which it was administered gratified him. Little Niagara by no means yielded easily, but forced theVarsity to extend itsclf to assure victory. Syracuse, playing brilliantly, was the winner all the way through. The varsity never did really threaten, though their perse- vering attempts to lessen the gap which the Orangemen opened at the start of the game were deserving of real praise. Because of this hght, the Maroon made quite a contest out of an "on night" for the Salt City College. The Colgate game in many respects resembled the pre- vious struggle. Although in this case the defeat was not so cleat cut, nevertheless both Maroon teams played fine ball, featuring many fine shots. The Ram was close to winning this one, but all their skill availed not against the Fates. Through an unfortunate misunderstanding, Penn State F' ,Q ,sy ,. 'ft' l ' ff! af' . X." W. W W WB' W' W W W W iiivix "" 392 ,,, MAQQQN xxxxxxxxxxx s found itself involved in a conflict of dates, but Fordham removed this embarrassing difficulty by graciously releasing Penn from its obligation. The Pitt game was of a very defensive nature. Close guarding, the result of mutual respect for each other's scoring ability, characterized this affair. The Panther finally came out on top, due to the foul shooting ability of Tim Lowry. The battle of Gettysburg ended with theMaroon banner waving on high. TheRam, panting for breath after three unaccustomed defeats, found this game a welcome breather. Forclham,with a three-year winning streak, faced the Manhattan fray determinedly. An epic struggle, in which the lead alternated eight times, ensued. The Jaspers won only in the closing minutes of play, and thereby preserved their lengthy winning streak. The green outfit showed championship courage in this battle and we certainly admire their spirit, but Fordham, playing probably the leading Eastern Team, was glorious in defeat. Never did they lose heart, on the contrary they rallied to overcome a lead Manhattan held from the first half. By this game Fordham warned its future opponents that they were possessed of class and so not to be treated lightly. From the banks of the old Raritan came dear old Rutgers to challenge the Maroon. Minus the services of Jack Grossman, they never really had a chance, though they spurted valiantly as the contest drew to its close. Comparative scores indicated little hope for Lafayette and indications in this case were prophetic. The Maroon of Fordham submerged that of Lafayette. Remembering well the one point loss of the previous season, Fordham was most anxious to subdue the Lavender, a team always diflicult to defeat. That Fordham was able to accomplish this was most heartening, but that it was achieved through the medium of converted fouls was nothing short of miraculous. How many times has City been victorious because of their ken and yen for tossing the sphere through the hoop from the penalty line? Probably never before has a Holman coached team scored more baskets and yet lost. Never once during this thrilling contest was there a dull moment. Spectacular baskets and swift passing had the spectators dazzled. As the final seconds ticked away, the score was tied. The wild throng anticipated an extra period. It was at this juncture that the big standing guard Parker, with stoical calm- ness made good the foul try which won the game for Fordham. jerry Radice in this game rose to rare heights by his very timely baskets and the deadly accuracy of his foul tries. , Many there were among the crowd who felt that never again would they witness such a close game. However the N. Y. U. game the following week proved that history does repeat itself. The score of 27-26 was about the only difference there was between the two games, and that difference was infinitesimal. Whenever traditional rivals meet, past records are as misleading as real estate catalogues. That is why this game cannot be considered an upset, even though the Violets were the conquerors of St. X X X X K X N X ll IIIFIEIYYY X nxxxxxxxxxxk Y OF FGRDHAMW' llllcllll 111 MADXOON H. john's. Shortly after the start of the second half, N. Y. U. tied the score. From then on the game was nip and tuck, every point scored by one team being matched almost immediately by the other. The final minute found Fordham leading by two points only to have this lead reduced toa point in the last seconds of play. Radice again played the stellar role. His follow-up shots often stirred his fellowplayers to still greater efforts. Babe Hurley was not far behind in the matter of points scored, while on the floor he completely outplayed the much-heralded I-lugret. The wind-up encounter with Columbia was a return engagement. The Maroon, eager to continue their winning streak and thereby top off a hne season, played very well. From start to finish they fought gallantly, always trying to offset the great advantage Columbia had by virtue of its lanky center. It was in this way that Columbia was able to obtain possession of the ball and so hold temporarily at least the Maroon offensive in abeyance. Bill Putzer played an exceptionally great game, his pass work being al- most perfect. His baskets, moreover, kept Fordham easily in therunning. At standing guard John Conroy was noteworthy, and as a result, the Eastern League leaders found themselves abruptlychecked time and again. For as the seasonwaned, John had devel- oped the very heartening habit of dropping in the long ones. And Columbia learned this to their regret. In regard to the number of games won and lost, the Ram has been frequently more successful. But never was Fordham represented by a team which, in the throes ofa losing streak was able to rise up and conquer its tormenters. No team was too powerful in the face of the enraged Ram. Columbia, rulers of the Eastern League, found the Maroon a mighty and formidable foe. To this team, then, our praise is due. To win when it is easy to do so is wholly naturalg to win when the opposition is considered too powerful, or the under-dog too weak, is achievement. This was exactly what our team accomplished by its victories over C. C. N. Y., N. Y. U., Columbia and the rest. The individuals who were most instrumental in this great performance were Jerry Radice first and foremost, Babe Hurley, the man who, a forward by nature, was a center by necessity, and Red Weiss, the freckled forward. Too, Bill Putzer and john Conroy deserve much credit for the way they fed the above trio. These five formed the combination that started the season as doubtful regulars only to finish it as undisputed first team men. Radice, probably imbibing some strange elixir, suddenly arrived amid a flurry of baskets. The box scores of the final games of the season bear testimony to his flair for scoring. Weiss on the other hand was not as consistent a point getter, being prone to brilliancy or mediocrity as the mood possessed him. On his "on" nights, Red's ability to swish them through was uncanny, while other nights he could put them on the rim, but not through the hoop. A player who found himself late in the season was John Conroy. John displaced Parker at the standing guard post by virtue of long range shots. I I XFX XXXXXXX I I I I I I T 1 I I I 1 'WOF FORDHAM 1 Qllllllllllm .W MAROON Xxxxxxx xxgnxx By so doing he upheld the Maroon tradition made by Reardon, Woods, Leary, Rohan and company. The two-pointers are very handy and do much towards upsetting the poise of the opponents, while at the same time it encourages the fellow players. Willie Putzer, the finished floorman, played good basketball all season. His steadying influ- ence,his basketball sense saved manyabad situation for Fordham. Billwas imperturb- able and this quality is rare in the heat of game. Never did Bill waste a shot on a I I7 B I I foolish attempt, never did he lose possession of the ball by a wild heave, rather he X preferred to bide his time and then make the most of it. Mulligan, Parker, and Hayes Q all belong in the same category. Brilliant but erratic typifies their game. Mulligan, X except for the early games in which he shone, did not live up to his previous year's H X promise. Hayes, however, came along well near the end and much is expected of him l X next year. Of Parker little need be said. His ability is too well established to be wg doubted. That he slumped is admitted, that he is a great player and will continue to be ' N one, follows from the natural course of events. The remaining men of the squad saw little service, yet their endeavors are equally appreciated. That the acclaim of the crowd was not theirs serves only to exploit their real spirit in giving of themselves and their time so willingly. T N To the team of 1930-31, then, much praise and glory is due. Though not as success- W ful in point of games won as other great teams have been, theirs is the peculiar glory l of the lighting team that has overcome something greater than other teams, a losing ip 3 streak resulting from an unusual combination of inopportune bad breaks, of fatigue X' ' and of some natural discouragement. A great team is one that can come back, that can overcome this mental handicap. Such a team was ours, and they will be remem- ii bered for it longer than if they had won any number of easy games. They had the spirit, the fight of true sportsmen, and they never quit, even when the going was l i hardest and the outlook blackest-they were the team that came back! x li N N l x QX fp l N Hx KK x x ixxxx x OF FGRDHAMW' ...J , W ' W . N W. aa by , arf" ,W-, , 'gtg i 1 Q W W' as at 3 I. Hifi' ' l, 4' i ici X 1 5 f , Varsity Track At the outset of the 1930-31 season Fordham's track outlook was certainly dark. Of last year's relay team which had taken sixteen prizes during the indoor season, alone, there was not a man left, Captain Simons, Farley, and Denzer having graduated, and Captain-elect Ray Hurley unable to compete due to an unfortunate illness. The men remaining from last year's squad were Felix Larkin,'31, who was appointed captain in place of Ray Hurley, Bob Coburn, '32, Joe Smith, '32, Joe McCluskey, '33, our Freshman sensation of the previous season, and Jerry McGrath, '33. On the shoulders of these men rested the responsibility of providing a relay team equal to the - 3 ' high standard established by the 1929-30 quartet. How ik 1 well they have succeeded is a matter of record. They A have scored a place in every meet entered and bid fair to I f' make Fordham men forget about teams of the past. L Individual performances of note were scored by Carl ' Thaten, '32, who captured the SO-yard dash at the Mill- rose A. A. games, and Joe McCluskey, who scored a 1 .- thrilling victory over Leo Lermond at the K. of C. A l p games in Brooklyn, a second place against Gus Moore yi if if in the Brooklyn College Games, second in the National Q Championship two-mile run to-Leo Lermond who won the race in 911318, and finally captured the two-mile Intercollegiate title in 9:17:O8, breaking the record by five seconds. " ' s' G F FO RD H A M it ' l i 4 l i i . l l !. . M.. , ,F , , l J 4 l i in iv-- il inf' l 1 ,air V i ii il ' 1 l . x 'XX Ta l V' V 1 ll , ,. , M A pxgg N ,3,x.-3,gs,3rx.3.,s,3i.,x,5,x , The Tennis Team Fordham has always been represented on the tennis courts by very powerful teams, winning as they did in the past such noteworthy titles as the Eastern Inter-collegiate singles and doubles, besides defeating most of the rival universities and colleges. The season of 1930 saw a less seasoned team emerge victorious ,in half their engagements. They would undoubtedly have won most of the matches that were halted by rain. The burden of carrying on fell on the shoulders of the two veterans of the year before, Capt. Vic Brady and Tom Cahalan, both of whom acquitted themselves admirably. From the class of '31 only one man succeeded in making the team, George Scholze, who was also Freshman manager. The remainder were '32 men-Del Guercio, Mc- Closkey, McDonald, Ostrofsky and Purcell. In the Eastern Inter-Collegiate tourna- ment the team received a high ranking. At the close of the season Tom Cahalan, '30, now Law, '33, was elected captain and George Scholze playing manager-. The prospects for the 1931 season appear very bright. The team is an experienced one and a pre-season judgment indicates that Manhattan, N. Y. U., Columbia, Army and St. John's, to mention a few of the opponents to be met, will have to play a stellar brand of tennis in order to win. Captain Cahalan and others of the team are entered in the National Indoor Tournament and in this and all their teamsmatches, vue wish them success. Wx x Vx Six x X57 OF FORDHAM X 1 N. N i N. is. i N Q 1 i l N lv 1 E. 4 i M A . . um ll 1. 2. l N., fl Li .g-., . wg, S . . -...E .lv ii 1 in va, . -tin, l ll' s A W1 A 5 .E vf' xv, . i.. x V ami.. is .,l. ll 's 1 s tial .aa 413352525 4 ll 'mix Il ,1 .. l ll ll l I. si l 1 l l 1 l l n Z l . l VV 'Y' I fi. lh ll. I A I Ill! 1 1 111-111 MARQQN ,tv 1 1 5 I 1 . 1 1 1 I I , 3 I 2, , The Swimming Team l Coach McDonough turned out his usual well-rounded team and in Captain Harms l and Schcel he had two exceptional men. Y i In the meets to date, the team has beaten Rider, C. C. N. Y., and N. Y. U. The i i Army won a close victory 37 to 34, but losing to such a team is no disgrace as the Army has one of the best teams in the East. i The Army meet was the most thrilling of the season. Gus Harms by taking the 200- i yard breast stroke, the 440-yard free style, and swimming on the winning relay team I I . I with Schcel, who conquered the joint holders of the Army pool record for the 100- ' yard free style, the star of the meet. In spite of the efforts of these men, the meet was My l ii 1 V rr I .1 1 I I A 1 1 1 p lost, but by only three points. I ll T A v 1 Our ancient enemies from N. Y. U. were literally T A i swamped and found themselves on the wrong end of the I r " A I 45-26 score. Again the dependable Harms and Schcel were I , A A double winners. 1 Praise must be bestowed on the Maroon mermen, not I only for their victories but also for the way they accept- I N K ed defeat, giving their best for Fordham, and also to I Q ii Coach McDonough, whose efforts have produced one of . the strongest swimming teams ever to represent Fordham. I ' s I . Y I g I I 'HOF FORDHAM I35lIIf7I 1 1 1 fe l 1 I 1 . i l . X321 . X . .ir kai, .M , ,M : i -fi-J . ul 1 1. ? ' ww. 1 , tg ' l i . I 5 1 v 'in AE vs I 'lisp i 1 1 xx ' ll P i 1 T N, I 3 .wil W W3 .ax 2 -..ll Wil V , , M, ,, , f- .X . , vs V V 1yN,tf1lfl..1Q.11Q....1lfa ,W W Ri Rifle Team Hail the champions of the Second Corps area! Which means that our own Fordham Rifle Team ranks first among the R. 0. T. C. teams of New York,New ,Iersey,Penn- sylvania, Delaware, and Porto Rico, having beaten such teams as PortoRico,Syracuse, Cornell, and City College, the former champions in the government matches held last spring. In the subsequent national match Fordham placed hfth, which is not so bad for a national match! And then, in the Outdoor Metropolitan Championship Match at Peekskill, New York, Fordham, represented by Nelson Edge, '31, the captain, George Nullmeyer, '30, the manager, Anthony Porcelli, and Philip Ryan, placed second, beating N. Y. U. and bowing to City College by only eight points out of the possible eight hundred. This was a very creditable performance,considering the fact that with the exception of Nullmeyer, none of the men had any experience with the .30 calibre army rifle. This strikingly attests to the soundness of the team's instruction in the gallery rifle by Coach Sergeantjoseph I-1. Smith, U. S. A. This year the team is doing very nicely, keeping a comfortable margin' of victories over defeats. In the shoulder-to-shoulder matches, the nimrods vanquished St. John's College and the Clarendon Club of Brooklyn, the Metropolitan Life Insurance team twice, and the 212th Coast Artillery Regiment of the New York National Guard, losing to City College, N. Y. U., and the Stock Exchange team. Fordhams total for these matches vs' as 6666 points to the opponents 6294. In correspondence matches they beat Boston College, the Universities of North Carolina, South Dakota, Delaware, and Cornell, losing only to Army and Kemper Military Academy. The total here was 19093 to the opponents 18195, or altogether ten matches won and Five lost, scoring just 1250 points more than the opposition. Ofhcers for this year are Poreelli, captain, Edge, manager, Ryan, assistant manager, and Reynolds, treasurer. Other members of the team who are consistent marksmen are Budetti, Hughes, Flanagan, Christoph, and Malaspina. Ji' 'u is 11121 x., . fx Yuki st H w 'X .gag 'ah was 75 Willa aura. is Na l. . .M 2: av' V 've 399 THE CROSS COUNTRY TEAM THE GOLF TEAM 400 ., i we W V M 55.5.3 Q N .NFA F 'Q' Freshman Football Under the guidance of Coach Creedon, a former quarter-back and captain ofthe Boston College team, the "Frosh"were initiated into the thrills and spills of college football. The team's able manager, Clay Buckhout, '32, arranged a very representa- tive schedule which would establish the rating of the embryonic eleven. The game with Lafayette showed the Fordham eleven quite strong, for the oppo- nents were apparently a well-coached team. C. C. N. Y. proved an easy victim. In the game with Samueljohnson, our"Frosh" proved superior in line plunging. The keenest playing was done by Ward and Captain McDermott. The most notable game of the season was the battle with N. Y. U. "Frosh," some- what of a post-season game. The two teams met before a crowd of six thousand at the Yankee Stadium. This game was for the benefit of the New York American Christmas Fund for the Unemployed. Among the first games played for charity, it illustrated Fordham's desire to aid in the relief of the unemployment problem. Cap- tain McDermott played a superb game, bringing victory to his deserving team. The season resulted in a complete list of victories for Fordham. The brilliant record of the Varsity was thus mirrored in the achievements of the humble "Frosh" who will undoubtedly supply the material for a powerful 1931 Varsity Eleven. The schedule and scores are as follows: Fordham Freshmen 25 Lafayette Freshman 7 Fordham Freshmen 46 C. C. N. Y. Jr. Varsity O Fordham Freshmen 30 Samuel johnson Academy O Fordham Freshmen 27 N. Y. U. Freshmen O i O F FO ll D H A M " ' " f Freshman Track . In the only meet of the season the Freshmen bowed by a close margin to the har- riers ofCity College. Many promising runners were uncovered in the squad during the season and there are hopes for an unusually fast group of varsity men for next year. With thellargest turnout in years, the Freshmen continued their good work in cross country. Almost any day one could go into the gym and find a score or more Fresh- men working out under the expert guidance of-lake Weber. Such a condition is almost a sure sign of a revival in track at Fordham. Candidates were recruited from the un- beaten Frosh football squad in the persons ofjim Couhig, Santarpio, Del Isola, and "Red" Keenan, and from the class as a whole, Mulvihill,John McCluskey, Hogan, Matthews, McG1ade, Lowe, Rogers, Dolan, Godfrey, Leary, Murphy, Lofurno, Lehman, and DeFabio. With a squad so willing and hard working, and with coaching as onlyjake Weber can give, it is impossible to predict how far they will go. It is not too great a stretch of the imagination to see in these men the foundation of a new era in track at Fordham. Couhig, McCluskey, Mulvihill, Hogan, and Leary were middle distance men. Del Isola, Rogers, Matthews, Dolan, Lofurno, Matthews, and Lowe were active in the sprints. Donald Waldie took care of the men as manager. 1' ii,-1' af f, llifl iw .i- 1 L1 if l. Q, llf 5.1 il' il Sl rr' ., Q i,22lE,f'ftfvi af If MWA aff: 402 0 Freshman Basketball As the Freshman team is the varsity of the future, interest is always keen regarding its personnel. Games won or lost are of incidental importance, rather the manner in which the Freshman perform is what attracts attention. Because of this, such scintil- lating stars as Fleming, Lynch, Pavlicovic, and Pepper immediately attain prominence. These men played well, indicating real promise, even in defeat. Though their efforts were necessarily individualistic, due to the limited time Coach Kelleher could spare from his big team, nevertheless they won many contests. This proof of their natural ability is indisputable. The guards cn the club were Pepper and Pavlicovic, both versatile athletes. These football men are destined to uphold a Fordham tradition that the guards should be football men. Cf the two, Pavlicovic is the more spectacular due to his flair for shoot- ing accurately from the most unorthodox positions. At center, the Weak spot of the varsity, Hurley being rightly a forvvard, three men vied for the honor. Williams, Gramala, and Lynch realized that a varsity berth was part of the victors' spoils. Williams, not as tall as the others, will probably be shifted to forward. Gramala and Lynch, both fine players, easily met the demand for a tall center. Gramala, a man who knows how to iight for the ball, uses his height to advantage. Lynch is the most im- proved man on the squad. This left-hander will clinch the center berth before he graduates, if he continues to develop as he has so far. The forward of whom much is expected is Fleming. A product of Fordham Prep, he is reminiscent of Nick Landers of Freshman days. He is a beautiful shot and a brilliant passer. ,- .- , f' 1 ,. 'Q -1. ,.-R. ,, I4 ,---.H K' ' , v W se li Xxx-its rms., lfsn--F X Kaul Rfk, 5- I xxvvvlf ,A 1 x 403 g IIIIIIIIIII MARQQN... GEORGEJ. NICOLAUS, Manager CROSS COUNTRY GEORGE E. COLLINS 5 Letter Men Class Of I 931 I FOOTBALL I ADAM M. ELCEWICZ FRANCIS P. FOLEY OSCAR T. I-IOLMBERG , RAYMOND T. I-IURLEY JOHN T. HEALEY WALTERJ. MACDWYER, Manager MICHAEL MISKINIS WILLIAM J. MCMAHON CHARLESJ. PIECULEWICZ I STANLEY E. SI-IABLESKI HENRY F. WISNIEWSKI THOMAS A. SIANO , BASEBALL NEIL D. ANDREWS HORMIDASJ. AUBE ADAM M. ELCEWICZ I FRANCIS P. FOLEY DELOS MAYNARID CHARLESJ. SHEERIN I ANTONIOJ. PISANI, Manager f BASKETBALL ' , HENRY F. WISNIEWSKI THOMAS A. MANAI-IAN, Manager f J TRACK , RAYMOND T. I-IURLEY FELIX E. LARKIN I PETER J. CUSACK SWIMMING FRANK H. MCGUINESS, Manager THOMAS E. WALDIE TENNIS WILLIAM A. GANEY GEORGE A. SCHOLZE I I I . I I RIFLE TEAM ANTHONY J. PORCELLI PHILIP E. RYAN NELSON EDGE CHEER LEADING VICTOR C. I-IURLEY PHILIP E. RYAN I GOLF FRANK L. MURPHY JAMES G. FAGAN, Manager THOMAS F. CLEAR A. A. OFFICERS JOHN LANE THOMAS M. HURLEY EDMUND G. BRILL XXXXXXXXXXXXXXXX I I I I I I 'HYOF FORDHAM 145111111 III fn H Q r M AROONED .WI if sa Xi If .::. ! M IH: Y a I I ,,, MARQQN' xixxxxx xxxx X X X Contents X PAGE ONE . . . . . Right Here Q CONTENTS . . . . Page Om X ' Therefore, l X CONTENTS . . . . Right Here X X Dedication n Q Father went to Yale 4 And I'm on my way to jail." 1SHAKESTOTLE'S THANABOTTOMSIS, CANTO 16-48. our jeer book. And it is with a feeling of inevitable failure that we accept this task, Senior Gby requestb. ......... 1 " I we have not found anyone we can dislike heartily enough to defame in so brutal a manner. And yet it may be that this task can be accomplished with malice toward none and charity for all Cro coin a phrasej. So it is with this noble thought in mind, X N X X X N N X X N X N N N N N X N N N N N nixxx xx xxxxmsx OF FORDHAMW' "Mother went to Vassar X Here I am at Fordham X T X With these words of the immortal "Bard of the Harlem" as our inspiration, we set X , forth in search of someone to whom we can, with malice aforethought, dedicate this, X for in our fifteen years at Fordham, X Freshman. . . ..... 3 yrs. X Sophomore .... .... 4 " Junior .............. .... 7 " MA RO O N v v -f fellow stewdents, that we affectionately dedicate this volume to that noble group of men pictured below, to wit and viz., those professors who have only the interests of the students at heart. They will go down in history as the originators of the phrase, "They shall not pass!" Editorials You are about to leave Alma Mater. Will you close the door? Remember that many a stray cat has found its way into the Dean's office because of open doors. Men of Fordham, when you go into the world, FRAME your diplomas. Don't carry them under your arms. That retards freedom of motion and induces apathetic desuetude. And don't wear your CAPS and GOWNS to BALL GAMEs. You may be mistaken for ushers. Be polite to both BROTHER AND UNCLE. But REMEMBER, a gorilla can probably lick them both. Remember, too, that nothing succeeds like success. If your name isn't success, change it. If you don't you'll be left in the LURCH. And some lurches are particularly hard to get out of. NEVER END SENTENCES WITH PREvos11'1oNs. Begin at the bottom. There is plenty of room at the top. There is plenty of room in the middle. There is plenty of room at the bottom. The next vvar Will be fought in the air. College men should get jobs in the subway. if V " O F3 FO RD H A M ffii it I ,,, MMXQQN xxxxxxxxxxx c "Sic Transit Gloria Mundi" ATID by the same token we find that sic transit gloria sundi. Beyond this however the analogy doesn't hold, because on close examination we find that gloria sic tuesdi transits in a manner altogether different from that of the first two. And "What of it?", the uninitiated mind asks."Will that help to build bigger bridges,or will the manner in which a fridi sic transits aid in the publication of bigger and better volumes of Chaucer?" Let us attack the problem with an a priori frame of mind. If you can't work yourself into that state, resign, sing a song, do something, but don't stand there with your hands in your pockets utterly oblivious to your surroundings. Let us answer their difficulties in a manner worthy of college men. They ask about bigger bridges. What is the matter with those we have? Are they not big enough? What would they do with a bigger bridge? Where would they put it? Besides they couldn't cross it before they came to it. And when they do cross it what will they do? The chances are ten to three that they will get lonesome after a while and want to come back. So you see, by the simple means of an argumentum ad hominem we leave them up a tree. As for the second argument advanced by our adversaries we chop that tree from under them by merely asking, "Aren't the volumes of Chaucer that we have now big enough?" Men, nothing will ever be able to take the place of a college education. Class History ONE day early in September 1927, Brother Quinn, unmindful ofthe ugly rumors that filled the air, left the gates unlocked. On the surface this act seemed of little con- sequence, but ah me, it has taken this knowledge foundry of ours four years to undo the damage done on that day. For it was then that the Class of '31 started to owe the bursar money, a habit that has grown with the years. For four long, dark, and often- times discouraging years, a furious faculty labored diligently to remove the blot from the fair 'scutcheon of Alma Mater, and the fruits of their labors are about to be realized. It won't be long now before we array ourselves in flowing robes and listen to numerous dignitaries swallow their pride and tell us what a pleasure it has been to work with us and predict brilliant futures for each and everyone of us. Their secret belief though, is that within a year every member of the class will be safely restrained behind the bars of one or the other of the state asylums. In other words, we get out this year to the profound relief of the professorial personnel, and the future once again takes on a rosy hue for Universitas Fordhamensis. We struggled through Freshman for the want of something better to do. We groped our way into and out of Sophomore. It was during this year that we, in a spirit of deep humility and self sacrifice, decided to forego our periodic dances and, drawing up countless resolutions, renounced forever this Satanic form of diversion and entertainment. So salutary was the effect of this experiment, so noble in purpose, that it was immediately taken up by other schools in this section of the country and X N X X K X X X IIIIIIIIIIIII I I I I I I I I I gel I O 'ri -ri O P U J: P Z 4 4 4 111 11111 1 II MARO-ON vvv now one may, lacking the price of a taxi, walk the entire length of Bagdad-on-the- Subway and not see a single dance gyrating. They run them in pairs now to accommo- date the crowd. Next we stumbled into Junior. We had to, Sophomore had just passed and Senior Wasn't due for another year. One bleak day last fall a hoard of undernourished, poorly clothed wretches, with a look of acute pain born of resignation etched deeply into their haggard faces, weakly crawled their feeble way along the Elm-lined path. The lookout in the Administration Building, fearing a Communist uprising, sent in a hurry call for the riot squad. Finally one of the wraith-like individuals summoned up enough strength to prove in syllogis- tic form, that the rabble was nothing more nor less than the remnants of the Class of '31 come back for more. After they had locked up the poor boxes and we had been permitted to go our way unmolested the tension was lifted and everything again assumed its normal air. That is, everything but the Class of '31. Never more will we be the stalwart, robust specimens we once were. If you have forgotten how you looked the last time you were in good health, we respectfully refer you to a picture taken prior to September, 1927. But there is a consolation in this, that after all we have been through, life cannot possibly hold further terrors for us.With our diploma tucked safely under our arm the door of opportunity is open to us, the future lies before us, and there are plenty of employment agencies on Sixth Avenue. INSPIRATION Ba-Ba, sheep-skin, We did our best to please, We are a bunch of bachelors With bachelors degrees. Sing ye a song of nonsense, While us boys make our bow, So long, dear Alma Mater, We gotta leave you now. fX XX XXX SXCX I I XXXX I I I I I I I I I 'HOF FORDHAM 1451111 1 1 1 1 1 , . ...- v v . MA RO CD N N X NSN XXAA- X N N Pyorrhea 4 out of 5 i Left Glove 8 W i Roxyhr 9 to 11 X Magis Basement 2 .95 lj ff f'-G ISIDORE O' BRIEN i N ou, good old Joe, will be long X J remembered for his sterling work on the debating team. Whenever a X debater got stuck in an argument it X X was always Joe who pried him loose 1 Q X with some of his sharp explosive wit. N' Tk! g Joe got his major "F" after four years lx 1 'Ref i. of faithful work when in the last E X ij game of the season he developed 9 N athlete's foot and couldn't play. p N N lfzfrmag' 1, 2, 6 x X sfdgwffk-7 2409 X Dcan'.f Office 1 to 26 Incl. + Unstrung Racket Club 5-0 N p MONTMORENCY RENFRU X UGWENDOLINEH X X s wmv" came to Fordham due to G an oversight on the part of X the Dean's oflice. An unassuming i xi chap, he kept to himself for the l greater part of his career here'lest he ll Xi be forced to go out for football by popular demand. Always a student it X' was no time at all before "Gwen" X 'passed his first condition. "Gwen" failed to take the knitting prize only S because he dropped a stitch in the final game which was held in a driving rain- storm. "Gwen" majored in hemstitching. He minored in aesthetic dancing. There- K fore you can draw your own conclusions as to what the future holds in store for X "Gwen," N N Ifwxxx xxxxxxx x OF FORD!-lAM"' 409 i ff if MA RO Q N W V V -- .l I . ' A+ 1 I V r ll l ll 1 J x 2 l V4 X L' f X Larceny 7 in 10 fl Aman 1924 I 5 i Moe Levy 22.50 ,ai an M . .rl . X A Emmy Balm! 0 ,00 ,000 i 1 . .frfli ij gli 3 ii 'i PETE ROLEUM UGAS., all , . Pu'1'1z came to us in the hush of the night. He was a quiet fellow, and we never would have become aware of his presence among us had he not tripped over a chair and sent the silverware clattering all over the floor. "Gas" prepared for 1 52 college at the House of Correction where he took all honors and the warden's watch. 5 Although Pete is leaving us now, fthe wagon just arrivedb we feel that we shall ' hear from him in the near future unless we keep all windows and doors securely 'E locked. With good behavior he gets out in Eve years. I ill si E T f fl Incinemtor J, Z, 3, 4 Pneumonia 2, 4, 6, 8 E ul Hole in Sock 2, 4, 36 F Bdfb Tub J 5 Q! I J. PRETTYFACE PLoTz We can't understand how this picture came to be here. It won't happen again. if -if ef o ff fro an H A M r r ' x P if 'W sry 'V VW V W l . 'v 5 Q W 1, V V W Vw M 'V 1 L i l 'Ta ,- v, 'N vs., l iw? les i 1-5, I .Q ,T , My F3437 'fig-.Q l V I We 'tl 'QT Fry. l M wx E W rv I i 1 ml I i i fit , ,, , ,. iv, A an Q N ws s. at is at . Athletics BRIDGE TEAM oM1No within an ace of winning the National Championship, the Bridge Team gained wide recognition and completed the most successful season in its history here at Fordham. Shufiling all her opponents but one,on the discard, the team showed the effects of the expert coaching of Jack Bicycle, the Maroon Mentor. The schedule was the most diflicult ever undertaken by a team here at old Rose Hill. Dick Mobey, universally acclaimed as the best right finesse east of the Rocky Mountains, played his usual stellar role. Always on deck and leader of the pack, he was the main cog in the machine. The team as a whole showed a marked improvement over last year. Bicycle had to shoot only one man for leading away from a king. The only defeat suffered by the Maroon stalwarts was the game with Paducha Tech. And it is quite probable that had Joe Bonomo not played with his sleeves rolled up above his elbows, this game might also have gone down in the records as a Fordham victory. . The games were' so well attended that it is probable the gate receipts will be suf- ficiently large to carry football another year in spite of the almost negligible interest in that barbarous pastime at Fordham. It might be well to add here thatjack Bicycle, Fordham's premier coach, was the hrst to use a round table in intercollegiate bridge competition and so prevent the opponents from getting a square deal. Bicycle will spend the summer in marking cards and otherwise preparing for next season while the team will get itself into shape for the coming campaign by practicing sleight of hand tricks. 1' w POLO TEAM We ain't got no PoloTeam. The boys wore out their ponies in Freshman and Sopho- more. f5i"'.f1Ii """ 1i'TC"1i 'Qi' i M- 9 ' ., ...5"'11:f'cTL:"" f"' 5' if r, 5 I A A ff 'si mfg-. 'ik N 'N WK 'QNX 'fins lCfbx.Dlrl!5Xff 'J' 'Q' 411 lllllllllll MAROON H. HOCKEY TEAM The Hockey Team has never been as active as it has been during the past year. Scarcely a week-end passed, particularly during the football season, when there wasn't at least one needy sextet making a bee line for Uncle Ben's to do their HOCKeying. Uncle Ben declared himself pleased with the result of this year's work and antici- pates an even bigger year next year. He has already made arrangements to have his three balls regilded. DEBATING TEAM The Debating Team this year is composed for the most part of those students who expect to be married shortly after graduation. The big debate of the year was with Whatsis College for Women. Our huskies took the negative, and complications im- mediately set in. The girls wanted the negative, and when they found they couldn't have it they began to sulk, pout, whimper and cringe. Our boys retaliated by tracking mud all over the living room floor and dropping cigar ashes on the rugs. This brought instant action. The girls packed their bags and went home to mother. The boys had no place to go and lost the decision by default. It was default of the judges. The team ended its season last week by popular demand. The authorities have the situation well in hand and there is little danger of there being a debating team next year. GLEE CLUB The Glee Club was composed of all those students who felt the need of registering glee on various occasions, such as, the ending of school, a member of the faculty slip- ping on the ice, etc. The high point of the seasons activities was the almost universal registration of glee that took place Commencement Day, when at the prospect of being free from the tyrannical toils of the faculty the entire student body threvvepilep- tic fits. The fits were thrown with wreckless abandon and narrowly missed striking two visitors from out of town. Next year all fit throwing will be done on the compara- tive safety of the football field. Zin illllrmnriam Our Student Days R. I. P. ixxxxi xxxx 1 I p I I I I I I I I I I I I "'OF FORDHAM 1451111 1 1 lil 1 I., t ,,, MAQQQN xxxxxxxxxxx N N N X K N I7 lllllll N THE Staff of the 1931 MAROON wish to thank all those who have materially aided in the publication of this volume. The Staff especially thanks: REV. Josnpx-1 LYNCH, SJ. l REV. AUGUs'rUs M. FREMGEN, SJ., for their advice and co-operation Mn. JAMES CLARK, Jn., '33 for his drawings in the humor section, I . Mns. PAULA LACQUES and MR. RALPH GERSHAW of the Arthur Studios, MR. KARL HAUSAUER and MR. E. M. HILER of Baker, Jones, Hausauer, Inc., for Mn. WILLIAM C. Donns of the Bureau of Engraving, X . their unqualified co-operation in the production of the MAROON. X xxx xxxxxxx x CF FGRDHAMW' lllflllllllg MAROON v.. ABBOTT, EDWARD F. ACAMPORA, WILLIAM W. . ADINOLFI, ANDREW A. AIELLO, LOUISJ. . ALBERT, JOSEPH W. . ALLEGRO, JOHN D. . ALOIA. ANTHONY F. . AMANTI, JEROME J. . ANDREWS, NEILSON D. AUBE, HORMIDAS J. . BADALOTA, ANGELO C. BAKEWELL, JOSEPH . BALF, EDWARD . BARRY, WILLIAM A. . BERGER, JOHN . BILL, EDMUND G. . BOHAN, JOHN T. . BORGESE, PASQUALE V. BOYLE, EDWARD F. . BOYLE, EDWARD P. . BOYLE, HUGH M. . BOYLE, ROBERT J. . BRADLEY, ARTHUR W. BRENNAN, THOMAS P. BRENNAN, WILLIAM BROSNAN, EDWARD P. BROWN, JOSEPH S. . BUGNIAZET, JOSEPH G. CARLIN, VINCENT A. CARMODY, JOHN A. . CASERTA, AUGUST A. . CAWLEY, JOHN P. . CHESKEY, JOHN . CILIBERTI, BENJAMIN CIOLKO, WILLIAMJ. . CLARKE, GEORGE T. CLEAR, THOMAS F. . CODY, JOHN M. . COLLINS, GEORGE E. . CONLIN, WILLIAM P. CONLON, MATTHEW H. CORCORAN, JAMES E. . COROYANA, FRANK CORREA, MATHIAS F. . CORRIDON, JOHN F. . CRAIG, CHARLES . CRAWLEY, CHARLES J. CREIGHTON, THOMAS R. CULLINAN, THOMAS P. CUNNINGHAM, GEORGE CUNNINGHAM, JAMES CURLEY, JOHN A. . CURLEY, JOSEPH E. . CUSACK, PETER . CUSACK, WILLIAM C. . Class Directory . 348 Ovinton Avenue, Brooklyn, N. Y. . 2307 Belmont Avenue, Bronx, N. Y . 1124 Metcalf Avenue, Bronx, N. Y. . 37 Maple Street, New Haven, Conn . 679 9th Avenue, New York City . 376 Clinton Street, Brooklyn, N. Y. . . 653 East 182nd Street, Bronx, N. Y. . 2361 Washington Avenue, New York City . 150 Division Street, Kingston, Pa . 181 Brawn Street, Westbrook, Me . 10 Stuyvesant Avenue, Larchmont, . 32-35 30th Street, Long Island City, 10 Walbridge Road, West Hartford, , , . 333 East 79th St., . 503 Main Street, New Rochelle, . 4575 Park Avenue, Bronx N.Y NY ZZ ZZ O S '-4'-4:1 I-' ..p-I ff' 5 . . .go :HOSE if .NN N257 mmim 3? sage? 3 2:-ez-s"'g,rv-IGB vuu-UNL:-.'3fE,g 3:52:20- v-v-rf-vD"rvbD,?Q 529219353 ZWRFSFIDD 300005563 0:-tc-onnfbfbm FY -zzzzzzl :Ennnnnng 522222231 ""-4'-4"4'-4'-4'-4 'ohooooool-' "1"K"!"l"l"!"T ?'3"F'F'FFFi" QZZZZZZZ D '.:'N-4"4'-4'-4'-4"4"4 u- xl XI Cn ff an FP n cn FY "1 n n f' 'U ... be 5 O s: FY 'cr 'U film 5 o D' XI H- 3.- 0001 94 Wo ND- OD Gm 35 .RNIB F? 5383? POH4 CD4 '-1:70 gn Sm: :1 s: Rc D519 PI' mg Um-'Z www! O 21-. OO J-.De -,3 22 REQ -'Zqsggfow H f'F'?1fT ZZ ZZZZ '-4'-4 '-4'-4'-4 '-4'-4 2873 Briggs Avenue, New York .ss XII I-4 5 T l'7 kll Nl :s O.. cn FY "1 0. 0 f' Z 0 2 '-4 O ..,- FT' Q. H. 'TQ . . . 134 Willow Street, Yonkers, N. Y. . . 169-A Union Street, Poughkeepsie, N. Y. . 112-12 196th Street, St. Albans, Queens, N. Y. . . 18 Myrtle Avenue, Stamford, Conn. . 149 Laidlaw Avenue, Jersey City, N. J. 183 Bainbrid e Street, Brooklyn, N. Y. 167 East 83rd Street, New York, N. Y. . . 198 6th Avenue, Brooklyn, N. Y. . . 370 Avenue A, Bayonne, N. J. . . 2011 West 9th Street, Brooklyn, N. Y. . 183 McDonough Street, Brooklyn, N. Y. . 105 Erie Street, Jersey City, N. J. 2611 Davidson Avenue, New York City . 394A 9th Street, Brooklyn, N. Y. 429 Poplar Street, New Haven, Conn. . 125 East 90th Street, New York City - . 237 Baltic Street, Brooklyn, N. Y. . . 4156 Bruner Avenue, New York City 1822 Gleason Avenue, Bronx, New York City 201 Kilburn Road, Garden City, L. I., N. Y. . . 2318 Giles Place, New York City . . 611 East 178th Street, New York City PYKXXX KX X XX I V 1 I v K 1 1 1 I Y 1 'WOF FORDHAM O1 11111 ll 1 lil ,,, MAQQQN xxxxxxx xxxx D'ALESSANDRO, JOHN DALY, EUGENE L. . DALY, KENNETHJ. . DELANY, ARTHUR . DEMME, WILLIAM F. DETROIA, FRED C. . DIEHL, JAMES R. . DIGIULIO, FERDINAND DISKIN, RAYMONDJ. . DIVINEY, WILLIAM P. DONNELLY, WALTER G. DOYLE, EDWARD . DOYLE, JAMES . DRESCHER, WILLIAM S. DUFFY, JOHN C. . DURSI, LOUIS M. EARLY, THOMAS . EDGE, NELSON . ELCEWICZ, ADAM F.- . FAGAN, JAMES G. . FARRELL, WILLIAM H. FAVORINI, FRANCIS R. FAZIO, VINCENT . FENNELLY, JOSEPH F. FENTON, EDWARD . FICCO, JOSEPH M. . FIELD, JOHN S. . . FLAHERTY, FRANCIS J. FLECK, LOUIS A. . FLOOD, ARTHUR E. . FOLEY, ELMER . FOLEY, FRANCIS P. . FOLEY, JAMES T. . FOUNTAIN, JOHN D. . FULLAM, JOHN . GAINES, THOMAS P. . GALLAGHER, FRANCIS L. GANEY, WILLIAM A. . GATTI, JOSEPH D. . GAVAN, JOHN P. . GERVAIS, GEORGE P. . GILMARTIN, DANIEL M. GILROY, DANIEL A. GIORGINI, GINO L. . GIORGIO, EDWARD GLATZMATER, MARTIN F. . GLYNN, MARTINJ. . GoETz, PETER J. . GORMAN, VINCENT J. GREEHEY, HUBERT GREEN, DANIEL M. . GRIFFIN, GERARD GRIFFIN, JOHN B. . GUTENEERG, WERNER B. HANISH, RUDOLPH L. HARRINGTON, JOHN A. HARVEY, JAMES A. . HAYES, JOHN J. . 104-21 41st Avenue, Corona, N. Y. . 5 Lafayette Street, Stamford, Conn. . . . 76 Jane Street, New York City . . 245 East 21st Street, New York City 1131 Roanoke Avenue, Far Rockaway, L. I., N. Y. . . 40 12th Avenue, Newark, N. J. . . 33 Liberty Street, Middletown, N. Y. . 765 East 237th Street, New York City . . . 18 Cliff Avenue, Yonkers, N. Y. . 42-O5 Layton Street, Elmhurst, L. I., N. Y. . . 241 Greene Avenue, Brooklyn, N. Y. . . 867 2nd Avenue, New York City 963 Cauldwell Avenue, New York City 2045 Prospect Avenue, New York City 3408 Newkirk Avenue, Brooklyn, N. Y. . 3233 Barnes Avenue, New York City . 640 Main Street, Dickson City, Pa. . 180 Ege Avenue, Jersey City, N. J. 335 Columbia Street, Cambridge, Mass. 2754 Grand Concourse, New York City . 344 Berkeley Street, Rochester, N. Y. . 37 Macdougal Street, New York City . 227 Augusta Street, South Amboy, N. J. . . 1404 Avenue O, Brooklyn, N. Y. 127 West Kingsbridge Road, New York, N. Y. . . 383 East 195th Street, Bronx, N. Y. . 2341 Andrews Avenue, New York City . . 248 Oak Street, Clinton, Mass. . . 18 Palmetto Street, Brooklyn, N. Y. . . . 452 81st Street, Brooklyn, N. Y. 3752 89th Street, Jackson Heights, L. I., N. Y. . 2 Hillside Avenue, South Portland, Me. . . 7 St. Mary's Avenue, Troy, N. Y. Trillora Court, Port Washington, L. I., N. Y. . 877 New York Avenue, Brooklyn, N. Y. . 59 West 87th Street, New York, N. Y. . 214-134th Street, Belle Harbor, L. I. . . 459 East 136th Street, Bronx, N. Y. . 9Jackson Avenue, Hackensack, New Jersey . . 4166 Edson Avenue, Bronx, N. Y. . 66 Victoria Street, Lowell, Mass. 2942 West 32nd Street, Brooklyn, . . . 7025 Perry Terrace, Brooklyn, . . Copiague, Long Island, . . . 1021 86th Street, Brooklyn, . . 3309 Bainbridge Avenue, Bronx, . . . 287 East 18th Street, Brooklyn, . 8574 111th Street, Richmond I-lill, L. I., . . 8414 85th Road, Wood Haven, L. I., . . . 371 Grand Avenue, Brooklyn, . . 603 West 184th Street, New York, . . 8415 Fort Hamilton Parkway, Brooklyn, . . . 325 East 163rd Street, Bronx, . . 23 Cherry Street, Woodmont, Conn. ZZZZZZZZZZZZ '4K:K:I4K:r4K:h4+4K:hc+4 . 67 Java Street, Brooklyn, N. Y. 840 Mott Avenue, Bronx, N. Y. 27 Benjamin Street, Meriden, Conn. 987 Summit Avenue, Bronx, N. Y. X X N X N X N Ill!-I Ill X X X X N Hxnvx x xxvxxx x OF FGRDHAMW' I 1 44.1.11 if .4 MA PAO O N v v v HEALEY, JOHN T. . HEINLEIN, JOHN A. . HELEIG, FRED. . HERBERICH, BERNARD F. . HEUGEL, ANDREW A. HINES, WILLIAM H. . HOGAN, WILLIAM . HOLMBERG, OSCAR T. HOY, LEO E. . . I 21 Fiske Street, Worcester, Mass. . 510 Fifth Street, Brooklyn, N. Y. . 64 Fulton Street, Weehawken, N. J. . . . . . Marlboro, N. Y. 222 East 204th Street, New York, N. Y. 939 St. JOhn's Place, Brooklyn, N. Y. 1519 East 15th Street, Brooklyn, N. Y. . 224 Menlo Street, Brockton, Mass. . 3533 64th Street, Woodside, N. Y. HUNTER, EDWARD K. . 278 Alexander Avenue, New York City I HURLEY, RAYMOND T. , 4300 Napier Avenue, Woodlawn, N. Y. C. l 1 I-IURLEY, THOMAS M. , . 53 Duncan Avenue, Jersey City, N. J. I HURLEY, VICTOR C. . , 2133 46th Street, Long Island City, L. I., N. Y. A l JOHNSON, NELSJ. . . 306 East 207th Street, New York City A KEHOE, JOHN W. I KELLY, JAMES . . KELLY, JOHN E. . i KELLY, WILLIAM A. . I KENEL, ROY . KENNEDY, REGINALD T. KEOGH, WILLIAM . KERVICK, JAMES F. . KERWIN, JOHN W. . KIERNAN, HENRY . KUERZI, RICHARD G. .I I' It If I LABRIOLA, CHARLES S. LAHAYE, JUDSON A. . 21 Jefferson Avenue, Jersey City, N. J. . 1289 Brooklyn Avenue, Brooklyn, N. Y. 162 West 93rd Street, New York, N. Y. . 565 East 188th Street, Bronx, N. Y. 370 Central Park West, New York City . 63 Morningside Avenue, New York City 17 South Jardin Street, Shenandoah, Pa. . 753 Jefferson Avenue, Elizabeth, N. J. . 835 Lincoln Place, Brooklyn, N. Y. . . . 1615 Avenue T, Brooklyn, N. Y. , 978 Woodycrest Avenue, New York City . 311 Stagg Street, Brooklyn, N. Y. 1512 North Avenue, Bridgeport, Conn. , LANE, JOHN P. . . . . 129 Elm Street, New Rochelle, N. Y. . J LANIGAN, MATHEWJ. . 194-13 114th Road, St. Albans, L. I., N. Y. I LARKIN, FELIX E. . . 1070 Madison Avenue, New York City A l LAWLOR, JOHN G. . 1435 University Avenue, New York City A J LILLIS, JAMES T. . 149 Belmont Avenue, Jersey City, N. J. ,I LINTOTT, JOSEPH D. . . 5 Bloomfield Avenue, Nutley, N. I LOW, RALPH . . . . 1077 Hall Place, New York City MCALOON, CHARLES A. . 42 Davis Avenue, New Rochelle, N. Y. , MCCABE, ROBERT D. . . 2018 East 34th Street, Brooklyn, N. Y. MCCARTHY, CHARLES J. . . 349 East 65th Street, New York City . MCCARTHY, JAMES M. . 180 Dwight Street, Jersey City, N. ll MCCARTHY, ROEERTJ. . . . 61 Winter Hill Road, Tuckahoe, N. Y. A MCCONNELL, EDWARD J. . . 1508 St. Lawrence Avenue, New York City I MCCOURT, HAROLD C. . MCCUE, WILLIAM O. MCCUSKER, HUGH F. . MACDWYER, WALTER P. . MCGLYNN, EDWARD MCGOVERN, JAMES F. . MCGOWAN, THOMAS B. . MCGRATH, EDWARD MCGRAW, THOMAS J. MCGUINESS, FRANCIS l-l. . MCKERNAN, BERNARD F. . MACKINNEY, GERALD B. . MCLAUGHLIN, EDWARD F. MCLOUGHLIN, JOSEPH W. . MCMAHON, PATRICK W. . MCMAHON, WILLIAM . . 379 Madison Street, Brooklyn . - . 118 Chase Street, Clinton 3 .i-I. B. E O I ..g2g. 2528 90685. E2CAD"v-xg: QZTQR 'O332' Sqn? y-.Fl ow' -' W 0 ??9?a 000'-1 npDgQ Pao 5 :I-T'pEQ2'Z 553252 542 1-1 '- mgrgrg "" v-4 I-4" Q32 9: 9 2222522 t4+1s2'f4f2i4t4 S S N . NJ. . . I. 2.2, 2 S- Q.: xl QQQXI oo? Wmmmmmq W 5225i-I-1331-I-1 CGOHQH in T- DNmb,x4m UID-'.p."'U1ClJn imfgmgim 'S4z:"1 I nip ,...l'bCll1-affine-r 2D2:'.ff2- H 402' gcngpcn S5529-'22 can 3 O2 Oi' - -Om- 225320' 2 22252552 xunpkggevzzst-434 ZZZZZZZZ 5524524555 Mass. 64W I dS N Y,kC' MCMANMON, JOHN P. . I 5 est 73r treet, ew Or ity MCNAMARA, EDMUND , . 1278 East 35th Street, Brooklyn, N. Y. ""'0F FOPCDHAMJ fl? ioi 711 ll llllm nv MAROCN N"-NNNNN 'NNXNX MADIGAN, JOHN T. . MAHON, JAMES J. . MANAHAN, THOMAS MARINO, JOHN . MARONEY, VINCENT E. MARRIN, WILERID E. MASON, MAURICE L. . MASSEY, THOMAS H. . MAYNARD, DELOS . MAzzAcANE, JAMES E. MAZZARI, HUGO L. . MEMMOLI, THOMAS , MILLEA, JAMES S. MISKINIS, MICHAEL . MITTEN, HOWARD . MOORE, FRANCIS C. . MORAN, JAMES P. . MORTON, ROBERT F. . MOYNIHAN, TIMOTHY J. MUCCIGROSSO, GERARD J. MULCARE, ANDREW J. MURPHY, DANIEL P. . MURPHY, FRANCIS L. MURPHY, ROBERT A. . MURRMAN, EDWARD MYLES, JOSEPH F. . NAPOLOTANO, GUIDO NEARING, GERALD F. NEEDHAM, WILLIAM A. NICOLAUS, GEORGE NOLAN, THOMAS V. . O'BEIRNE, WILLIAM V. O'CONNOR, JAMES C. O'CONNOR,JAMESJ. . O'DONNELL, EDWARD F. OIDONNELL, WILLIAM F. O'DONOHUE, JOSEPH M. O'LEARY, TIMOTHY A., JR. O'SULLIvAN, ROBERT PACIA, SALVATORE . PALLADINO, ANTHONY M PALMER, RAYMOND J. PARIS, GEORGE L. . PERCONTI, CARMELO S. PIECULEWICZ, CHARLES PISANI, ANTONIO J. . PORCELLI, ANTHONY . PURICK, HUBERT W. . PRYOR, JOHN F. . QUILTY, THOMAS P. . QUIN, EDWIN S. . QUINNAN, JOSEPH T. . RAFFERTY, ANDREW RAFTERY, CORNELIUS R. RAMMELKAMP, EDWARD W. REARDON, EDWARD D. REILLY, WALTER . REYNOLDS, JAMES F. . . 1124 Findlay Avenue, Bronx, N. Y. . 116 West 103 Street, New York City , 2417 Valentine Avenue, Bronx, N. Y. 6701 Ridge Boulevard, Brooklyn, N. Y. , . 643 57th Street, New York City , 2330 Andrews Avenue, Bronx, N. Y. , . . New I-lam ton, N. Y. , 7224 Fourth Avenue, Brooklyn, N. Y. . 1982 University Avenue, New York City . 1366 Dixwell Avenue, New Haven, Conn. 315 East 105th Street,,New York City . 30-31 North 152nd Street, Flushing, N. Y. . , 140 2nd Avenue, Rensselaer, N. Y. , , , 9 Burton Street, Brockton, Mass. 6 Howard Court, W. N. B., Staten Island, N. Y. . 195 12th Street, Long Island City, N. Y. . 17 Huntington Street, New London, Conn. 8802 Fort Hamilton Parkway, Brooklyn, N. Y. , 460 East 141st Street, New York City , 2449 Hoffman Street, Bronx, N. Y. 363 Bainbridge Street, Brooklyn, N. Y. 2410 Davidson Avenue, New York City , 31 Maple Avenue, Harrison, N. Y. , . 149 84th Street, Brooklyn, N. Y. . . 61 Prescott Street, Clinton, Mass. . 5 Park Place, Springfield Gardens, N. Y. . 2431 Webster Avenue, Bronx, N. Y. . . . Long Eddy, New York . . . 2809 Avenue L, Brooklyn, N. Y. . 6925 Fleet Street, Forest Hills, L. I., N. Y. . 911 Walton Avenue, Bronx, N. Y. . 87 Hamilton Place, New York City . 80 Norman Avenue, Brooklyn, N. Y. . 121 5th Street, Long Island City, L. I. . 421 East 78th Street, New York City . 2472 Marion Avenue, Bronx, N. Y. . 726 Foster Avenue, Brooklyn, N. Y. . 111 Ocean Street, Lynn, Mass. . 308 89th Street, Brooklyn, N. Y. . 2159 Crotona Avenue, Bronx, N. Y. . 29 Catherine Street, New York City 53 Highview Avenue, Tuckahoe, N. Y. . 212 Duncan Avenue, Jersey City, N. J. . 72 Goerck Street, New York City . 88 Boston Street, South Boston, Mass. . . 2 Oliver Street, New York City . 2159 Belmont Avenue, Bronx, N. Y. 114 West Marie Street, Hicksville, L. I. . . 1001 Faile Street, Bronx, N. Y. . 601 West 163rd Street, New York City . 16 Carteret Avenue, Carteret, N. J. 611 Hemlock Street, Scranton, Pa. . . 2082 Ryer Avenue, Bronx, N. Y. . 446 West 57th Street, New York City . . 4373 Vireo Avenue, New York City . 78-80 Christopher Street, New York City . . 170 Meadow Street, Naugatuck, Conn. . 174 Rochelle Street, City Island, N. Y. C. Oxxxxxxxxxxx x OF FGRDHAM 'YV . X X X X X il X N X N X X X N N X X X X X 'Y 11111111111 MARQQN ,,,, RICCA, EDWARD P. . RICHTER, FRED. W. . RIORDAN, JOHN L. . RODIER, WILLIAM I. ROGERS, JAMES P. . ROGLIANO, ALBERT G. ROHAN, FRANCIS P. . RONAN, THOMAS P. . ROWE, THOMAS D. . RYAN, JOHN RYAN, NEILJ. . RYAN, PHILIP E. RYAN, THOMAS D. . SABATINI, WILLIAM A. SATTLER, LUDWIG J. . SCHIPA, RALPH P. . SCHOLZE, GEORGE A. SCHWARZENEACH, HERMAN F. . SCIARRILLO, LOUIS F. . SHABLESKI, STANLEY E. . SHEA, JAMES C. . . SHEERIN, CHARLESJ. . SIANO, THOMAS A. . SIERANS, WILLIAMIA. SILLIERE, EDWARD A. SIMONS, FRANCIS T. . SIRAGUSA, JOSEPH A. . SMITH, GEORGE R. . SMITH, LAWRENCE D. SNIDER, GEORGE E. . SPALDO, JOHN L. . STEWART, JAMES . ST. JOHN, MARSHALLJ STRONG, WILLIAM W. SULLIVAN, WILLIAM E. . SYMS, HAROLD W. . TAVORMINA, JOSEPH L. . TAYLOR, WILLIAM T. TORMEY, JOHN . TRUNCELLITO, LOUIS . Tucci, ATTILIO B. . TUZIO, JAMES F. . VIGGIANO, PROSPERO . VISCONTI, FRANCIS A. WALDIE, JAMES F. . WALDIE, THOMAS E. WALL, RAYMOND M. WALSH, CHARLES . WALSH, JAMES A. . WALSH, RICHARD C. . WHITE, JAMES . WILSON, EDMUND D. WISNIEWSKI, HENRY . WOLF, JOSEPH C. . YORE, GERARD A. ZILG, LEO . """OFFOllDHAMi 426 West 144th Street, New York City . 1140 Beach Avenue, New York City . 848 Lincoln Place, Brooklyn, N. Y. , 2979 Briggs Avenue, Bronx, N. Y. . , 174 East 93rd Street, New York City . 69 Columbus Avenue, Tuckahoe, N.Y. . . 34 Alder Street, Yonkers, N. Y. 1991 Bathgate Avenue, New York City . 215 Harral Avenue, Bridgeport, Conn. . 2678 Valentine Avenue, Bronx, N. Y. . . . . East Hampton, Conn. 4241 Byron'Avenue, Bronx, . . . 314 East 196th Street, Bronx, ZZZZ ZZ awake 5-4-4 . . 1890 Eastshester Rd., Bronx, . . . . 39 Laihers Park, New Rochelle, . 6925 6th Avenue, Bay Ridge, Brooklyn, . . . 147-36 45th Avenue, Flushing, L. I., . . . 338 East 51st Street, New York City . . 2045 Southern Boulevard, New York City . 59 Monitor Street, Jersey City, N. J. . 401 Whipple Street, Fall River, Mass. 9320 Ridge Boulevard, Brooklyn, N. Y. . 10 Middle Street Court, Waltham, Mass. I . 2265 Grand Avenue, Bronx, New York City I . 2715 Grand Concourse, New York City . . 1098 Franklin Avenue, Bronx, N. Y. I . 1657 White Plains Avenue, New York City . . 23 Frances Street, Mechanicville, N. Y. I 2517 East 19th Street, Brooklyn, N. Y. , . 4331 Park Avenue, New York City I . . 48 Grand Street, New York City 427 West 147th Street, New York City f . . 310 Vine Street, Hartford, Conn. 8431 107th Street, Richmond Hill, L. I. I . 346 East 18th Street, New York City . 315 East 88th Street, New York City I, . ' . 312John Street,Elizabeth, 1 . 486 East 141st Street, New York City 1 . 1096 Franklin Avenue, Bronx, N. Y. I . 630 Bergen Blvd., Ridgefield, N. J. . 742 South Oak Drive, Bronx, N. Y. I . 6203 13th Avenue, Brooklyn, N. Y. 21 Qliver street, New York City I . . . . Milton, N2 Y. I . 38 East 75th Street, New York City . 38 East 75th Street, New York City 1 . 126 Dwight Street, Jersey City, N. J. . 455 West 155th Street, New York City f . 206 West 95th Street, New York City . 2524 Creston Avenue, New York City 1 . 30 Convent Avenue, New York City . 173 McDonough Street, Brooklyn, N. Y. l . 1068 Haddon Avenue, Camden, N. J. I . 1233 Leland Avenue, Bronx, N. . 1772 Brooklyn Avenue, Brooklyn, N. Y. I . 38 Hancock Street, Boston, Mass. I I 131 lil lil 1 1,1 1 143 I 1 ' f w 4 lp 5 , 1 W -. w ' ' 5 , i , , DVEPXTISEMENTS TIFFANY gl C06 JEWELERS SILVERSMITHS STATIONERS QUALITY-THROUGH GENERATTQNS MAIL INQUIRIES RECEIVE PROMPT ATTENTION FIFTH AVENUE MTU STREET NEWYORK C 0 S T U M E S THEATRICAL AND MASQUERADE , For .Yale For Hire We Specialize m Ff' Serving Schools, Col- ', leges and all , fflfgfa v Amateur Theatricals CHARLES CHRISDIE 84 Co. T 41 West 47th Street Between 5th 8: 6th Aves. fail' '-Z' ilu? all ,'p'f'?kx, it .Q s Mil AYIEUIEW fs ' ,S 1 X 5 C' XX 1, NEW YORK Telephone Bryant 2449-0218 Cox SONS 8: VINING CAPS GOWNS HOODS Fon SALE on RENTAL 1-'. .5 I Gf X7 Qxlr ' W 'VA f M ,al A f W W M fg : For All Degreex 131-133 EAST 23111: STREET NEW YORK CITY ISTIBLISHID 1818 1 'WQAETQJ' 3,15 . , :gf to ,sw 75 Q-X, MD e 7 , 1-VN , 'J L' -Afi.lf.T' igxxygqlmisu.L'fu,f'wr21l'-,AZe'7r Rum Jw C129 L on-l H N Q53 5 E-Eel ' '72 's,?Y'. ff .' X t h V 1 utlrmnw Enrntslpng Qantas, 1' X 3.2 M, 1 ff - ff I Sl S iw? ff .Qw lfll ummsou Avenue con.ronvv-rounru smear .uf Q J ff new vom: ' 1 , Clothes for Vacauon 1 e g ,, ' 1 X 414 N' ' Eflhk X 'V and lit, Y -we I , R, Summer Sport - f" f , ff' f BRANCH!! 'f-f.,,z "ly A sos'roNN::wn:v?:u.::voeN:n?N:::::n Tu 1- 9"""""""""' NEWPORT PALM BEACH ONLY AUTHORIZED BUICK DEALERS IN BRONX COUNTY BRONX BUICK CO., INC. Salefroomy 2400 CONCOURSE Near 187th St. RAymond 9-4000 231 E. 161st STREET 2 Blocks East of Concourse Jerome 7-7740 4191 WHITE PLAINS AVE. Corner 233rd' St. FAirbanks 4-5600 SOUTHERN BOULEVARD at Fordham Road A SEdgwick 3-3650 881 E. TREMONT AVE. Corner Southern Boulevard Fordham 7-6300 1521 JEROME AVE. Near 172nd St. JEromc 7-3500 2610 E. TREMONT AVE. Near Westchester Square UNdcrhill 3-8400 0 230th ST. and BROADWAY Klngsbridgc 6-9050 U d Car: on Display at Fordham Road and Sautbrrn Baulevnrd, and at 231 Ent 161.rt St t .......ThzJb00k is cased in an S. K. Smith cover-a cover that is NM guaranteed to be satisfactory and is created and SMITHCRAFTED by an organization of crafts- , men specializing in the creation and production b of good covers. Whatever your cover requirements J may bc, this organization can satisfy them. Send far information and prion to THE S. K. SMITH COMPANY "GF "' 2.13 INSTITUTE PLACE CHICAGO, ILL. St. Catherines Academy Elementary High School 539 VV. I SZND STREET Complimentf qt BRGOKLYN - LONG ISLAND CLUB 422 EY, BAN KS MBI DD Jewelers Silversmiths station Q E 9 Extablixhed 1832 rs . Philadelphia h SCHOUL RINGS, EMBLEMS, CHARMS AND TROPHIES Of The Better Kimi wa Special Photographs mailed, with complete information-illustrating JEWELS, WATCHES, CLOCKS, SILVER, CHINA, GLASS, LEATHER AND NOVELTIES from which may be selected with complete satisfaction distinctive WEDDING, BIIITHDAY, GRADUATION AND OTHER GIFTS iwi The Ringx for the 1931 and 1932 Cla.r.re.r of Fordham Univermgf were made by thi.r Extahlimhment 423 H and gnnrterf for BIOLOGICAL nnd CHEMICAL LABORATORY APPARATUS, and for CHEMICAL REAGENTS, DRUGS and STAINS Ljirgeirirnnd Mort Variid .Ytockgin America E SPECIALIZE on microscopes and microscope accessories, incuba- tors, sterilizers, centrifugcs, balances, distilling apparatus, apparatus for testing gas, milk, oil, water and other substances. 11 Have fully equipped Chemical Laboratories, Glass Blowing and Machine Shops. lIOur Druggists' Prescription Department is the largest in New York. 11 Write, stating your requirements, or visit our showrooms EIMER 84 AMEND Ertablixlud 1851 Incorporated 1897 THIRD AVENUE, 18TH TO 19TH STREETS NEW YORK, N. Y. KELLY' Ertablirhed 1876 PRESCRIPTION PHARMACY 371 E. FORDHAM ROAD NEW YORK he Ursuline cizdeniy The Ursuline Academy is a College Preparatory School em- bracing Kindergarten, Primary, Grammar and High School Departments. Boys under nine years admitted. From its begin- ning the School has stood among the people of New York for excellent scholarship and HE advantages of labor saving devices and modern machinery operating in a small New England town, removed from the high rents and expenses of the large city are reflected in what we believe is: IMPRESSIVE PRINTING desirable associations. It is AT conducted by the Ursuline Nuns M O D E R A T E C O S T whose success as teachers is Well known. . - For particulars address URSULIEQXLADEMY THE PIEFFERNAN PRESS SS C USETTS Grand Concourse at East 165th Street SPENCER, MA A H Pham, Bingham 9892 NEW YORK CITY Specialistf in School and ICollcge Printing BUR S BROS DEI IVERIES THROUGHOUT NEW YORK NEW JERSEY NEW ENGLAND MANHATTAN AND BRONX TERRITORY Phone Corrlmmfr 8500 BURNS COAL BURNS " W0VlaZ'J Lmfgefi Difiributorf qf Fuel" 425 I IFIUIERNIE ss 153 nl ' 1 '," in 3 lem! ZZ? me y ' YF' -z 'L I' ' A 3 tv BERMUDA 'O N 0VA SCIITIA and NEW f,'m'3Z,fZfZ'ff,',f,1"'TES NEW FIIUN DLAND 5 pa S 866 fi Du S 872 12 Day Cruises 3130 up y y Longer Trips at Prnporlionalely Low Rates Snilings every Wc1lncs1lnynndSntur1lny NOFllICfll Cl'l1iSOS to piCtlll'CSqllC l1llldS. i"1MC'1Di'ff'i'm- days at sea, two days at Halifax, Nova Scotia Two distinct sea-going thrills . . . on the "Veen- and two days at St. Jolm's Newfoundland, clam" you go Dutch,on ll10"BOTHllldH,,Bl'lf.iSll. using your steamer as hotel in both ports. A new 28,000-ton Furness Liner will be in Weekly snilings via S. S. "FL St. George" or service this Fall. S. S. "Nerissa". No passports required. 0VW1MC!Cl opine C! Gross opine 34' Whitehall St. fwhere Broadway heginsl-565 Fifth Ave., N. Y. or any Authorized Agent. erfereir ICE CREAM I I .... I 9 3 I The Premier Ice Cream of America for Eighty Yeeery 426 Complimenty vf New York Gipzmif We Cater to Fordham Stadentx FORDI-IAM STATIONERY CO. STATIONERS 84 PRINTERS Printers for Fordham State Cluhx Opposite 2519 Webster Avenue Roger's VISIT Us FOR SUPPLIES cor. Fordham Rd. I LIDO-RIV IERA sw Ee'1flf'rr3r1E2fvrB5ffrrrerf 313 EAST KINGSBRIDGE ROAD Adjoining Windsor Theatre Special Luncheon 55c After Theatre Menu RAYMOND 4131 Crawford Clothef Stores' Everywhere Manzqfaetzerer to Wearer 35,2325 N eare.rt Branchef 378 Eaxt Fordham Road, near Wehxter Ave. 340 Eaxt Fordham Road, near Marion Ave. .10 Eaet Fordham Road, near ferome Ave. MAHONEY, BOWEN 8: Co. Aocotmtanto - Auditors 11 PARK PLACE NEW YORK CITY BARCLAY 1664 35 JOHN F. MAHONEY Certified Public Accountant EDMUND F. BOWEN Cettiiicd Public Accountant WILLIAM E. I-IYNAN Connecticut District Office CONNECTICUT DISTRICT OFFICE Frost Building . . . Norwalk Kdildkihbhhikvklkdkllvwlkwwkvwdkkaiknwhimwmikiikdbildmlkvki Sobmy -Wbifcomb Company - OOOOOOOOOOOOQO 0 0 0 BUILDERS 0 0 9 00099000960006 CS? IOS WEST 40TH STREET NEW YORK CITY . KVNGHQMWWMWKWGWWTKVSKWWSWMWQMSIKVNWIZVNWNKUNWNKQWNKVNNNKVNWNWMW 429 i',?Zf5's'QlWf5Y2l1Nf5FEQ1Kf5iElf3''Cf5GY2l15"2ff5Y2l13"ZffEl15'Cf5Y2lZf5iQ2l3" ' .' ' R I . K ! egg! O 2 P - -T- 'EW Fe, 3. eff x 'Bmpr TH' V5 ,A ' Q s Lu n u Qg'? ' x QUAM V109 V 0 3 , presenfing GENTLEMEN,S CLOTHES .' :Q-5 milored by Hickey-I4'n'ez1zan 7 E 3 , , , 0 9 HAT s ef AC c E s s 0 R I 12 s W' dzsizngzzzslzed character : ' . . 3 V3 for umfverszfy men and sporfsmen , : 3 9 :' ' x V, ER.lR1P1ERs. EJ. .' ? OMMIIZVJ to Gentlemen ' Extublifhed 1886 A N MADISON AVENUE A'l' FORTY-SIXTH STREET- NEW YORK N 1,5 5 5:3'iffia-SlWff5'5Sl3fT55SlY1'ifT3Sl3ff535SlZ!"if355ll9'i:?5Sl3Y3SlH:?5Sl13"Ie45 MCDONNELL ae Co. Member of Azz Leeezeeeg Eeeefeeeegee 120 BROADWAY, NEW YORK CITY Lfvn INVESTMENT SECURITIES 4-gs Teleplaane, Rector 2-7800 430 WE rfbier fieeliof, Iac. SPECIALIZING IN COLLEGE AND SCHOOL PHOTOGRAPHY ONLY Equipped for making PHOTOGRAPHS OF EVERY DESCRIPTION for illustrating COLLEGE ANNUALS V Highly Artimtic Workmamhip, am! the eapaeizy for Prompt and Unequalled Service ST 42ND STREET NEW Official Plootograpberm for 1931 Maroon YORK 431 P , , M BUREAU-U 'IENGIERAVIINGLEQ iq 5- if -vi -f1. SPAR1fLlNG lND1V1'DUALfTY-You it in Bureau- ' ' " , 551 gf' A built Alllzuuls ...... Beauty of Dfdiglli' Qualify of 'gl tl Engravhrg-Diatincfion of Tfzeme .... Dan? merely vj' T '4-. 4,,,. I ' "Fla, dream of nucfr an Annunf. Let BUREAU- '5 ,"' ' - '- :,, CRIAFT M301 you make it a Rc-ufity. y V, il" -Tj, Z Q t xvefnviteyourcorrenponrfence. Let ' 1 ,fry ll 'QB -"'f5': ' ff-H ' us teffyou wfmt BUREAIJ- A crefxrrf.. im' O l mneabolls 'DIINN 432 TI-IE ACI-IIEVEMENT GF AN IDEAL +++ YEARBOOK is more than a series of printed pages bound into a cover. It is the result of hours of anxious thought and patient, persistent effort. The staff of the MAROON have accepted a real responsibility, and under the leadership of the Editor, Mr. William S. Drescher, and the Business Manager, Mr. Timothy A. O'Leary, Jr., they have produced a book of which they may well be proud. We feel sure that you who turn these pages and re-live the events of the year just concluded, will join us in congratulating them. 2 In our humble capacity as pub- lishers, it has been a privilege to be associated with the pro- duction of this book. Perhaps we have in a small way caught some of the enthusiasm displayed by the staff itself, for in our hands the production of a yearbook becomes a very per- sonal matter. 9 We are justly proud of the con- Hdence gdaced in our abihty to produce a book in keeping with the ideals of the staff and school which sponsor it. We earnestly hope that this feeling of confidence will persist, and that ir will be our privilege to place the facilities of our or- ganization at the service of the yearbook staff of Fordham University through successive years. y BAKER-JONES-I-IAUSAUER, INC. 45-51 CARROLL sT.,BUFFALo, N.Y. 433 FOUNDED IN 1841 FORDHAM UNIVERSITY Condalled hy thejesuits FORDHAM ROAD AND THIRD AVENUE ADJOINING BRONX PARK NEW YORK CITY St. John's College ---- Fordham Road School of Law - Woolworth Bldg. also Fordham Road College of Pharmacy - - - Fordham Road School of Sociology and Social Service Woolworth Bldg. Graduate School ---- Woolworth Bldg. Teachers' College - - Woolworrh Bldg. School of Business Administration - Woolworth Bldg. Summer School Fordham Road and Clif Haven, N. Y. Preparatory School ---- Fordham Road ADDITIONAL FACILITIES FOR RESIDENT STUDENTS Write for Bulletin-Specify Department 434 COMPLIMENTS OF EMILE G. PERROT cxslvoexrluoeuknasbaexsknexsknsasknedenasknasienextquexsien COMPLIMENTS wapoorapwcmzpvwapwowgpwwqzwwapvwapvwyvwqswawagvwapv 435 FINIS


Suggestions in the Fordham University - Aries / Maroon Yearbook (New York, NY) collection:

Fordham University - Aries / Maroon Yearbook (New York, NY) online yearbook collection, 1916 Edition, Page 1

1916

Fordham University - Aries / Maroon Yearbook (New York, NY) online yearbook collection, 1925 Edition, Page 1

1925

Fordham University - Aries / Maroon Yearbook (New York, NY) online yearbook collection, 1937 Edition, Page 1

1937

Fordham University - Aries / Maroon Yearbook (New York, NY) online yearbook collection, 1939 Edition, Page 1

1939

Fordham University - Aries / Maroon Yearbook (New York, NY) online yearbook collection, 1940 Edition, Page 1

1940

Fordham University - Aries / Maroon Yearbook (New York, NY) online yearbook collection, 1947 Edition, Page 1

1947

1985 Edition, online yearbooks, online annuals 1970 Edition, online yearbooks, online annuals 1972 Edition, online yearbooks, online annuals 1965 Edition, online yearbooks, online annuals 1983 Edition, online yearbooks, online annuals 1983 Edition, online yearbooks, online annuals
FIND FRIENDS AND CLASMATES GENEALOGY ARCHIVE REUNION PLANNING
Are you trying to find old school friends, old classmates, fellow servicemen or shipmates? Do you want to see past girlfriends or boyfriends? Relive homecoming, prom, graduation, and other moments on campus captured in yearbook pictures. Revisit your fraternity or sorority and see familiar places. See members of old school clubs and relive old times. Start your search today! Looking for old family members and relatives? Do you want to find pictures of parents or grandparents when they were in school? Want to find out what hairstyle was popular in the 1920s? E-Yearbook.com has a wealth of genealogy information spanning over a century for many schools with full text search. Use our online Genealogy Resource to uncover history quickly! Are you planning a reunion and need assistance? E-Yearbook.com can help you with scanning and providing access to yearbook images for promotional materials and activities. We can provide you with an electronic version of your yearbook that can assist you with reunion planning. E-Yearbook.com will also publish the yearbook images online for people to share and enjoy.