Eagle Mountain High School - Talon Yearbook (Eagle Mountain, CA)

 - Class of 1981

Page 1 of 152

 

Eagle Mountain High School - Talon Yearbook (Eagle Mountain, CA) online collection, 1981 Edition, Cover
Cover



Page 6, 1981 Edition, Eagle Mountain High School - Talon Yearbook (Eagle Mountain, CA) online collectionPage 7, 1981 Edition, Eagle Mountain High School - Talon Yearbook (Eagle Mountain, CA) online collection
Pages 6 - 7

Page 10, 1981 Edition, Eagle Mountain High School - Talon Yearbook (Eagle Mountain, CA) online collectionPage 11, 1981 Edition, Eagle Mountain High School - Talon Yearbook (Eagle Mountain, CA) online collection
Pages 10 - 11

Page 14, 1981 Edition, Eagle Mountain High School - Talon Yearbook (Eagle Mountain, CA) online collectionPage 15, 1981 Edition, Eagle Mountain High School - Talon Yearbook (Eagle Mountain, CA) online collection
Pages 14 - 15

Page 8, 1981 Edition, Eagle Mountain High School - Talon Yearbook (Eagle Mountain, CA) online collectionPage 9, 1981 Edition, Eagle Mountain High School - Talon Yearbook (Eagle Mountain, CA) online collection
Pages 8 - 9
Page 12, 1981 Edition, Eagle Mountain High School - Talon Yearbook (Eagle Mountain, CA) online collectionPage 13, 1981 Edition, Eagle Mountain High School - Talon Yearbook (Eagle Mountain, CA) online collection
Pages 12 - 13
Page 16, 1981 Edition, Eagle Mountain High School - Talon Yearbook (Eagle Mountain, CA) online collectionPage 17, 1981 Edition, Eagle Mountain High School - Talon Yearbook (Eagle Mountain, CA) online collection
Pages 16 - 17

Text from Pages 1 - 152 of the 1981 volume:

0201.3 CI K LLL wud xoggugg CXO Jw tha 6CUCWL get Q CXKPLK nd Sf down Qpqser 2,015 m K text, cm, N Kg LEJC ME, Ox a am QEQW QXMCL hu EJ C 1 x K4 ws tai xx to thiwf Q GQ K1 Q Clonylg bf- wk on mm Qwxggfymgcl MQW QQ Ge. LM NWN YN Q cw KOOL WCM? no LO C152 L La Qxwl X505 ck Qicl 'YS bmi tr WUJL on lo aura new 0 5 A CX L MWQQXKNOKO mx lm msg WOM Qgxuimqtgii um XML L Maxx QQEQ. QDCMMX QQ ww. UNK 'MW qc LOU VQXQUE Gigi Pbqi 5' Km Burk wi iufblgo Eixoinsqo cdr? Kel cmib I C og CRW-ACK bQ2xClfif3ELZ5iid. gawk M3 pgLTL0l U-xmecl Qu JKCQX eg X0 P5 WCM sock od: QSAO3 lm WH T if we Ck dbx SP Benson tc, me 0 on help me 0 60 MCM KK WOM 9 wk Noecxm Aff. QNX how YMQM 4, Wahl aw 'L GST QM M L 595911 -brfws thi? Q H' VOCLSM' F 2. Q VTMZE' OM Life, Mm ws, wane 042. W O 1 gp GQ ..1. Qbufclnf lncmb ,Ot -L mga, LDXAO3 T SGACL Qunnxnax Cora MWC! Cm OUfQ3EfUnc,OAlAnJf Krxckog, down 13'- ftol IC A ODOSH-SNSYQQCJEQQH 0? UNJK iw QQUELWHNWCS 7 MSM lou M KL Ola Kmfis of W1PPLR'XSS5'bUN+ me bipu, CJD, 'L we We LDQEJ -jj QDEDJK-E, S806 Scikxwcl JC' O' Q A jg gpuskx vxou ' makyxkvxiidgh 2,0022 O Oy Luce ffxsffg bfbuy-wi, Sui G6 15 W Omg CX Ejfeif Qlfp.-'f ,ofd Qin ki-if? UQ, llOuQ, Loot 6'- 'l'a WC1 Vowlibi JCC' Cig'1fxDEE5c1e5 61604 JCXW5 U3C 1 A90-t Q! X I3 .Kg qou 0261 JCQU5JCxrwcl nn cub N C1 6 NJQOQ mmm? WCG, Q9 09 QF N X QM W GJ -X - C . ,Lb 1 ., ' 'X-csfrl I A l - I ' . . ' - i 0.1 ' UQ xx A x - . - O YD QIXCX :Z , 'f K QU. L3 . XYXCJQX. S A , O , ' WOW GLX... i Q . 1 RIN I n . Q x ' QVOK 1 ' l CX' '- - A ji Cbx I L ' ou Q j . . X K al Q , 0 U3 - A 2 V, C1 Q ' N ' Q N W -Vx X ' ' ' 1 L1 x . K ' L' C ' I 5 l . ' ull J-Q Y ' ' .' W - - . -5 ' ,, G Q V X Lx. A ' - I - I VX ' Y S X VN X Nl o ' - , ' . ' .' ww Q XSQQ-6 A. vi ' li A . X V A N 0 A . I Q Lf Lil - q fx J txlxix . Q U .,- 1 . w X 3 RJ U I . . , Ii - ' 6 X . h . x I .. N M HA , LX . f , . C4 Q , X Qwww h3Q.S29,k,59-S25 QQ. '..Q.mP 3.weQXiQ5x Ogwclilxg. Dua E990 xcncqki vig? k3-QJGQ,l ,uQ3- 1-AOUL QLYAQ QC C45LDQQ35', QQXQQ. QkQ5Cj,CZCX EWYNQ Cixi S9.Cxv3fg7 SQSAQG5 l MNQXJL 1 UMR fegggbbblg WQET5 HULL-ik Tim , kc Wx JM Q5 C3 3 GPM, 59 f 566 bjcscgx 66365 U QQ CO, fa 'J' ,mm .wg Sf JA, Q. Wfjgfwmf M XJQJQ M W ZLWQMM tvpN'N A f MM ,mmf J M in JJ ,MQ fb, 'X '?,w-f LM ww O. . 'L M. govvfw ' V, ,4 . f fi va K'5f31f 1 1lX if ff ,gf iNff yf5Xkf01wQfC0fxfk'6XfiW W MNQEMJM' Q W dw . X5 S25 CL, -f 'I ,BULK ,,L,LeLg,cni QLLL WZ 0.l'V-fvc-M5714 J :MDL .fCLCCfQCf li-bcfwbk UQ ww ,W MLM, 7w,6L MLA aww V' f l Md W ,Liflbli Zllkbxcfo' J N , JAAQQ 6,0111 dw Uyxamji, - EMM 8,9 mwmmmffi W' B M7 W QQQLWWAIMQ Vw C'1r712.'9' f n d ' V Oesewv M ob' 1+. E057 eww WM f5fbfoZ?57LW2L lbw gjilw mf . ' -R 'Ziff if-.www 1'lfHfLJd?UJ0 qw- '2gMWW'57ffi0 1 k9N314L 'C0 AQQ,H34-L fm M 2 ESMFQQWNP gg QW WMM? fwfffwwdw ,MMM Wm WWW wwf M7A? J mwig ij! JULWHZWTW Wwgmm Mx nyfkkrf fwmm.. U,.Lq..,, ,.,,,,.W .,,,D ,,-. b, A.,,,. U,,f,,,, i ,.,f .. ,. igezgff hw, ww ma 2 ' A553911 M eww Wsgglggvzfgrsg-'fearggfsiisfwgf,gqiqiiwwwiixfgmw'im-M,M-fmwf2zg,f sm,- 15,rwggglgqwwg 2st.srt.1Uft 'f5iLi5'eE 55i'f557'lfW L. .M fiwmi L K SA-A 7- 7-A 7- -A M x., 's27?bi7?ki3K131335isfZIA3If14525fE?E?752Z!SHS5fg?'igi5igfW, V .W an-fwflm-.W mmaseikfm U .W -Wsmmfksmgmgwz'ww: H A ,,.M.,..,,,,, . P 1 X hmmm Q Q B figs W M,.w,sw' fa- ,225 'U'5'W 35 U, . ,W ,,,. Q, ..L,.. 3 ,,.., wig.:mg-.amz ., . ,- A Lq,,LLv, A ,W-V -M. fegggwsigg,-fQ?mfizyS5ssr4s23fsiffm.-wifiz,1Qm::xsg:wwgwm Q,.1:m,.q1,.L.f,1Qz,.w-1fJs'w-fix-WM-.6-if S X ' S' gg'-M 'W- ,ww ,:ff.1w8,.:z,f.ff,:f, .La,.s,M,.N,M-.ff f .,,..,..,.. M1121 1111-My LN wigwgl ,,,h,,. A ,.,, Q. LD,,,k ,,kM, L..,,,.,X, W,,, ,K .V,.., ,wimpy v,,kk x,Jw.3ix.lK.gl,q,,,w.L...,,.,,..,,..,,., ff -L1 Ifwx, fm '15, M 1,5 , 2 'fx-www, Qggszugsfg iz-55525532 -1l,, ME ML ffzfwzsiez 5- ,L.. ,WS A Qiikz-.fag ww. 5?'?:aE?Eis ff 7, mdk nu .QM www Am, if Q i wma xx, m fx fs, X Q, fx! N Hai? w Q Q es S. swsig, mx S Sm, nm fiism LW, . ,?i.se2?Am ,q,W,,.7,Afwz asgfsm, Mgggi. ex ,wsmi 1' 5iLi5Sf.5637fAf!3 wsswfia mm xml :way wQg55Py1f-vi - -wwmmxflsx ifQswaw1z1fe1gsz:4wfzLsszgsazwvwwfvm H m::fw Szsmzslzg Iigezqmwgk.. ,Tif,-Ql,m,w,4.2 L1L,M5g5.i f21Qigggiglfffigsgbigglgfggfwsgffigifmyf J, X ,S K 8 E 6 M 11 12 59545 :rm :fm -as , zafirxzuz .fsz mi ,ew.1-mm-fgwffqy Q11ff-fmwwwweWL,m1n,wfmwtwfma1:Qz::Q1::wfW fs-,G 27 'PQsQz21szwz:2fsfmgez-1:22, fffwf1Qeg:fivQf2:gUzf1sz-ww, wr-if gfer.fmSfzfs5w-Qfm :F :wry ':2f'swiz5ms2ffi5sf7 EQ? gf Emil mi -ww , ,Masai :sm Q Q ff. 41 ,X '3'zs3m95rs, 3 H iuisfgmgffgfkfe .wmgif1,11m1m,m:f1e:w K if x x xxx sa, Sv xx 3 SVYMK -- - --M 7- Lyky' W awwymwwfmxfsn-A1 MSF-f52f-s21:i?:'22'sF: 3'-mquiyssyffgwnmsm ww ,mi . ,Mg .2, ffm wx Lmfkmqkxiwguks ,Lak mx,wwwmmwxmb ,XM v,X,.,Wm. m fX,.:x,k,..iv ,,.. fa.. W,,.. . .. B325fgif,Sf,,5ff1e2ff221ilifziigxzvfkwik ami :eWSLZ2eE5i35VfSiY Usual QSM 5 4 g,A.2,..k 41, J, w, , .pf W ., .W ., -dy Am-ffsyfmwxx-sm,MM, Ly, w,L2,W,,W,W,eg Lg-MQ,Q,-.3,,.Qz,.m,.m,,fKMQ,.w:-UV'-w, f,,,,W fvv'--wsu-fm-ami my ,MW H .Jm1N,.m,fm:fm-.m,M-wwsgizlif -V mx, MEX ,M H, KW aagkshxjmx ma,sa,XsEsx , ,Q N ,H ,H ,K as ,z my 55, wg,-iv,-. um, Q2gtjai?5is? gss L5f2Q5j3fig,i ffimkfxsifi lwriisi.,z4Q14,rQui.L1s553?':ks5'?Q?T5ix1i5,Aii,,Jai:si L?!f55F2gRg,gw51ggl Liwigssss1se?54s?5igf5Kvisisffwfivvsissiieimimfs2szfrQ14sin5g1g2?z, iisgsxiixfgimffisfissvfssvfzszf 355 ww W- Z ff:--wmv fem nf dz Aff A . LM :1.+f-:ww 7-ffffzffm:fQ2?vfsH2frHsfm:Qzzfx1 Hmfiagsf 59323 ii'L?'?'g,q3W695a5zSzd rf -:'m-15337516-' waz H, fmzfwxgq, .,1a,Q5W,,, .,,, myM.f2z,fff1X:27gf1zmg-x ' ,. .ww , , .ve ',-w--as-ggi'-we w:1Wi3,!555yffag::KgzgQgf.gy-.yi-.WW gg1gg1igz,5gggsXgms,gsL vw L. A LgmMx.v,1ww fISi?s'ax 'sw 'Aw -9- Mig! ,, .W A Lmwwmzxz X, -I wp 2 ,,gfW,x gm .X Q Lp,L,,mx,Aif,,ssm AWE, v,f,,. is 135 L9 11553511 NLsi?5KfqsEQ?fie3 A ,W A L, .L www -N7 LS'''Lgifss4iQ4e25i5F?aa?issQixr?ss?Qs1551152151-12111225 XM ,AWWA ,Nw X 91 Q N fax11s:fz's55f M9921 -Wm-A -- ,V nr: gggw5ff?z2ffimf??:f45sZseZw1Ifmffmz ,k5lW.,W, J-, 'im saw:fee,-iQig422f4ng5aa1fQ2igxssmigieiggnggfvzgfzgvik QZQL ,W ,L . Lq,ALU,,.v,AL Wgx?fwwmmiimszHwy -si 11135111511 rf gf,--5. ixfws fefs an HHHfK1eWK5Km,mQfxmli5i 16 as., ,Af wfsweff Z is 5 N 91 N f :ww 9 XG! Q xx N H my K5 MK my U .32 J fxgnasxgsfm mx aegis! www 5 H X as 9? ZMM X ,N M. 'H ka S3 we S my , Q wb' wx Em, K X ag awww! amd My wma Snug S 4 n wmv m U wwf Hmmmm QR, wwf mm ,Q mawi L X U in Q mx vm awww Q is we qw Wim, maxim N91 xx mx m K K S 5 Ms. m mv K X ,rw a S .1 Q f 5 L X X umm m X X N img 2 mx M fx Ka, X M2 W in M K1 pix 563 'Umm gn, s 8 2 Xu 3, , ,mx wf Qmmgp 1 ,W Q95 5 ww 1 X D' ffxmfm gpg! www Ss Q Q xgmksign, 2531? ,V ax, Sw! E E wg fs Xa nh ,hxx M15 A QNX mix WQXW1 my mi,,, UMW 4 Q 10 Q Q Kas Q ,Km my 1 mx gsm mg, M his D, 1 L K uf Y xx xx 1, is 5 xx fx mm K adm SJ X ,em 9, Hmmm saffmw 'K Ms xfcfsgmw MX Mmm ms ,W Q 32, mx 8 M Ig gf M5821 sv Sxwawfsxxdvx J y S H92 X mi X Swwxus HS of :ef H Q23 Q' S 's ,Qgwx xg gxggxxsx sr 5 S fm ,gum al K XX H Q vm X KEY Q K E W 2 Q H Rm M X Q xx WL N wx H 15 , X M1 S QM my 4 X mg and K sap N X, K M K K Q Mx Q 13. L sf L4 rgki, x ax ff? wwsxaxxxig Q my-Q Y M X X fs xy S1 1 ,Q wx A ,Misa 5' .4 ,gm mmf Q QU SQ QQ Q, SK X 2 1 L f mv, ,Q wx ,ny K ms. ma Xxx: msn gm, K x 6 wwe HSS! ,Q xv 3 wg, ,Q ,Haag 9 N LL eww Q51 WM, mwm 3 Q X Y S ,Q Ewa QM wsmwgggm K an X PM in X 1 Q N Q, ,H mg s me S QM Q sr fa L M XL 55 A xi me 3 KM Md QQ J 2 N ws 21 mx 5 ww in Q sms Q fm Q1 fm Q ax fx K1 mm Xe 2 Q fsfRs?k?kiifg1g'lF fs M X is ssl ew X W U mm Qmw mMM,,,Qg,, ms mmm. EW 9, LMS Xxx slam X X, Hxmmw-S md S fx W H QQ ,www mmm X ,K L w Karp Ms 2 Q w ww 2 ,K M sw 3 K N Q, xy K H HA U mg Q S Q5 Xb X as ,Mm aww wx fa, M M :Q S. D, 2 31 K wwe wa J Hymn Q plug 91 mfg Q L W Digg Qian hs mms mm! sux M 1 fx ,Www 1 vs ,Gauge H ML 1 Ex w SH sl fx swim ww Wg X waxy s Q Q m,,,'8,, Q Q 1 K 1 fx m U W .4 A N fm W arms., N my L gym ww X X982 mmm,w F 14 mfwwam in fm xx K K nw S gn if W 2 K fax md X 1 2 H 12 A ,iw mmm f if M fm A W S md Q2 mf me ,,w1ss1's 91 .4 J Q is we H X ,N A fx 2 , 5,8 ,S fx S. 552 as 5 Q 58586 P3 WQ,91Q1S 5 m uv K wigs, W msxmfagaalwmmfq MU as Q ,Q ws fa Sf H 18 fxpmlsmma M X :wa K fm: 3 'S xm ww v, aww U 2 X, ie bw 2 3, ss? 3 SQQL51 2 E mm 22 ml hams www mm., wmmfema J-K BEX2 mb 3 f 03282239 '2 W W M S mmf fx ww mm wwfwlfwsxmmm Q QM1 222 qs LW qm Rfkmmgf NF mu vm 'G mf 9 is 3 Q1 2' S 1 L an vm M an 5 XM Mmm ,XL H HREQQQP iw K mi 5 mwvwrm EMMFBWQ is X mmm MQ S,,J,,, fx 7, Kei ,Q 2 in my X add 2 2 Q few wwe mm ,mx H V, swf s wmkgg ,K fuamsbqvy SK W K , 5 ww ,Nw H 9 M a E? 22 Q dm,-Q 2 5 mx gf Q 2 P SMF? an e my 2 W K: E E xx M1 ,J 2 3 2 Qian me N wma M ,Q K1 2 Q! fm H in 5 8412551 K Xmiige 2 A A mi fn m Lf N Jam? 5 M M gm Hmm X1 9925! 2 ' 2 MS fd Ru 22 m 5 ww Q xr D1 P1 Q 12 A 2 5Q.9R5P5 5 fx m H S Q N553 mffflsm fs 5 .3 ,Q ,Q fm 2 KVM in if 22 Qwvm an 2 Lx Q ggm mf, Q Msg mms S E Mjvgmfgwi W 13,1 N www Q me F KH Q mmm 5 2 s QM 9' awww mdxxixm 2 'X W' 22 sf S, ,MMM 'Q Q 9 ix 55 2 2 SQ N M, ,X ix Q Ax S1523 NF 2 S 2 if ,E is M we migmgg QQ WM M Sak N W W m Q g ,M , 2 2 2 22 xkxmmmn sw sm ws: W2 bbw S xxxxbxm dwfxsmg 4 Q m my 2 MSW gauge ,mx we sawsmmmd MQW Mm 1 Q. J. ,M mmf md 2 S us P 2 Mdy MS 2 X M, Q :N Xe 5 Mwwf Q glxfizfsagxef any Sf N Q, M ww mf Q M , D, ,W WN M, H ,2, of 2 22 ,wa 2' JZ QQ 4 Q X M 3, M M s s S1 Ss YQ! K1 xg ss is ,lsqmgmm Ymwfm Quays aw ,Nmmkijxsg Q'Emi1wI:wKYAR5m:QQEm'2m2QiiJ' 1335 QI ma as uv m K ff is isigwigmawmsgx N2 fsmmm 2 X Q, J 'ii 'Q S. is Q ss Q s sl Q Q, 8 2 sl W' Q ,Qs mgfm .54-,P Ng Q .ws ufgfgx mm 4 K' J xx s S 'Q 3, 9, was sz ssgssfgxssgi 45 QS 95iXf,g3fm'Xyg'Z95'sfa1 X 2 H? Mfgkgw Qkwsxawmffwnxw N .1 H, MM w,W,mMf.,,mfw X aww 2 Q xx fe er-I wx 6135! i-if WQX9' 2 f'f'f3f'Kgxmxwm'HFm mixers 2 Q mwmkwf an Wx a Q S1 as 'xgsgfgisis fi1fYiYSXSF.SL9WWHwf+2 H Rag M1 'MYM2 H W4 iw gmQQQpmQsfp1w,m Q 2 fa smssssmweifwi fi nr 3 ,N Q sm jmimscwx ji Q 'WEL 55521 92259 Kim ki Q58 F2 .3 J kwgzx wa Qqww, xx 22 2 S 5 31 J 3 fm Mm 5, 2 ,S fm vm Q is s fm N 2 w ,M N Ls S 2 Q' mx E m gxsgsfsf qw mm Bmw 2 mm Ki W2 K aw 2 fm 2 2 Q, 22 ZX K X U W .1 H 2 2 22 U 2 2 M mn 1 2 wa Q2 lm WM Ni 3 wx fn 2 22 M ,wmfsm Lis? 15 wwf X fm M x my ,M,,Kima M gf sax W xx Q ,gm 16 K Q K X 95 ,aw Q, SK MRL QS Q 3 is mm QQ WL ,I 2 'V QS! My-Y fm mm X 'TKSWQQ H SXKS? 'eevi W H M Z3 1 Hp xxx xg se 151549 Hfiqfiign KES? ISHS vX,g,mmmmx dm, ,Um avg QQ fx is Ewa H M xxx mi SK15 Q, K 91 3 4 L X X fx N W 12' H Q Jx M R4 2 Q N Q XX wsws H 41 K K fx sxxix Q. Q X ag Wt 5- .W S LL zgyggs, Qswaeiwlgfa fbi XZ: wg we W. X .L., 11 .. W,..v h..., x , ,, MM iwLxL1s2wz-wg :sift Qffhs-1 ,N.s,..,, ,, , , , 5, ,., mf Qiiff . .,.., 3W.,,,,.LM 3- Wm-Aw, W.,Q:fm3wis??sa2fwssgisfisezifezf . ,,L.K,.x, V, .,g,,,,Z,WQl5,,55s ,,.. 1, i, W aiiik mm am .zw H1 ai? M W lg L,,,, I -igf M ixy w W f55H5fSf'-lffgsfizgan A ,Lf .. K, :fx - 3'EE:J?ie2zEL?-' bww . ,,LZisiLE?J,l w.fSg5s3555, 1 saw ,1 Mm -- ss fwssgn sas? Sw Us :six 53: - Nwzf Q, L Q Y aw gm if mm www M-1 JA mmqb ,wan sm Y ffmmxff gm , X whfwfsw my s e s X m ,Q X X is xx as x N N, 3 rv its 'E ex S1 2 X K mm K sq K Q H wx 1, my iq X ,mm 2 X Eu Q mm N J m M Qs 5 Q 3 K J 'M fx ,Q my Q uw 16 my 2 K M el f 2 mx may 6. is 1 2 Q 2 fm Q. ,K ,Q mm K W 4.3 X fm X Q -K .1 ax MK mx gmww fm F ,Q , Q N Y K K W -f gm ' M KL W, www 2 2' X my N Raw A me M 5,91 N-W1 T Q' ,, 2 fm N ax .0 K1 2 as my X gms my N ,, My mam, 22 nee my we 'Q Q Q 2, S Jmwfw ig 12 ss 9 5 H 92 www ax K1 E fn S m awww , Q, mx 2' Q 3,1 QW X .7 J a Mx wr Q W was 2 K as! 1 M, Bmw swam mx 2 m 5 x m fu L my vm ,ws 2 Spf, :nw ,Mm X me 2 3 am W L5 vw 2 w fm fd Q my 1, wx 22 fx Q H my 5 mum is 1 mn X Q 2 fm 2 2 2 Q X fm 22 22 22 Hex S 22 xxx, my M 2 X gums msg www S D Q 2 m 2 2 3 we mx glam Q3 ww me wx H X W S mme 22 mmssgsgj Wm w fm ms ,Www W m X hx- fm: ffl s .amy mmf 7952252 iss? 111 fm -:ff Aw- fw- ne- fs N 3, 35935-1 V 5355 ?iMw2Z?'f1bffl A W , fQ,pz,g1-Wnfmff ,. mms: my ,wgx,1w,ffwX. mymmfffz:1w,:w2g1:S,,1 sz Sw -- Q i., M.mm,:2f2:2zz4s .fgstimzfgfwz'ivsifzzgs swim ba' -3: -iw :ww :- ff 1gg: s??ggz ff Z, :f5,,:21gP1g5:1 new fmt?fvggzglzsvysv s?5?Sv fifi,i f ,WW,lU,x5l,.f,mw.f,xL:, ag:-f 1.131- 'assw.fb,sz4 W N as X1 by mgs35fz s49z54SzLss N 2 . A gmMy-.1fz,fS11.fwff-: 1:-.Esmx1m4fe,m,gW 2,,. 2,,, 3 WM. :es :ew : W swf 22654 X1 gsfigffiisisff?L2??Zi?iS21ias??T Sf?ik3?ZEi?5?aif'5iE?7ki?'T9?f5fkE?'f Z, 1135- :Qu :nz 113: wx :gf .. ,,,. k, .,-2 V - N- 6 J., . :Use ff'22fysi'i2'fwW in H, fe m , , .N X, 3gff?X5gi.fs,1,:fw :www if H U- 4.7, .rm .x ,, 15, 4551 wi Him? 51, mf: ffm m may 2 MZSN35:55qz,1xz8W1m :fwzyfi Qmi:msYf1,fmQ-Mmm 1 22-22..2- 2--2-2.2--.2-..22,.222-22- .22- MQ 222 ,f ,E si: mm ww 1we-?'Lgt1iX2isti1s2,ies,s1esi:w Fay: :1 M: max 'zazv:2z, 121, ff 11 'vm meigmnswissviss ' M K-lm-1 .1 Q, ,, , zsysw' issfzlsm-.m,um:mxsms-2 ww-awwww-ew: My ,2,2 2-,22,, 4, , ,, .,,, .X,m,, .wh.memmfmfw f. 1.,, lgiwiwfmmmzxgwwfmx eigissfzsf:5sQ52zgg52Li?'Hf5K1ffai 2 L' myfwitifssfisilfsa- mQgfgwK5m,?3,mm11m.m,m-W Ag- M -1'wpm:1,1-.mmm-.f :1m1mw, :f ,aw ,ig Q 1,f55,.w fy fg1L,fM,z if ww- ,.., mm jxwxz LW., 2,,,,., N, ,mi :W ex mx si? 145 ws, MM ,,fms::mxw1 . iffiae?f4e2:sss'sfQz'sss1s2z 2 L, em KWJQ ie, .issesg ,K 15: mu xxx: 92555555 45 1 1, M S fm-V My Sm was qiai ?5s?? Ki fiafzsfssf :fm 5 .mx .yi ww K fy fy .mv ,Q,.:g,..s,s3 eff3susmsssfzw,5wz5ss,- 211847152521ssswzfsszuwz wa in fx, A A , 315527 SPE? 5?iiS7!iiiffii 'lstffiit fs wwsssfmsfgssfgma M .f1mmwfQS,s 1w, f,1,fsg,f1m .XM W Ig, iw. 2,.. 2,, 5'f5i2k,amEs35L35 uw :fm SK ffm -Q, mm 2 2 wg my 555535 w 2 is ,, fwm-im,qxiwgiggs if fHKgai1g:sz,fgww,lm ., .,fm,m1,mw1 z ww wp, 421 M5355 , .,,,,. yM,..q, 3, M, M,,L.,,,,,,Q,. F. WM. Z-fw,.1g: 11M,M,. Lf, .,2. Z- Lf ,xr 1,1 11,1 feg..m.u. feamw'mmm' zff2mrv, .fX, W ig: 'fe 5 .Sax .imemf 7,5 -Q W www 1 1-M, Mifwg :1sg.L,5.Lggfsgk,5i Q-:wmv i mz,fgg1Lq,,g ff?-NY UTX1225be?'?sa? a,:?'z 3, . 4.3, .1 .fax ., mr ,wk ,. ,.. ,155 .msz?w1s,- A my fm, 2. A mf W fm -,L fezwz-.fx S S , ,,,, Q A X Xxpffix Q mffwlm- , --,, ,, wwf-gxffvw fr,,.1x?S X 12225 gg. 1m:m,fPw wwlxw z,M,f .mg .fa z fmmfsmxg W- Lg,.,,L,,.Wm ..,,.. ,JS N 2, .2,, .L .Wax uw L2 mlm lgwx. 2 2 s-:gg 2 .XMM 2,,, JV., 2,,., ,M .,.. i ,,.k , N-wx:-m-:wwwr--,vzzf-Q rf .,,.,, Vx. 2,,.2,,. .xx Mg J, .2 m1sQ:11m:f Wg? .fy ,ad fa 2 aw! W L my , N 22 eww W my Q 2 fs, ,N Qs.55,ffzfffqHqx,1Q3-'13 Qw1fgm.x,,f ,mgk LX, 2 M N ,, K 1 sv R1 wx Jun ww ,fe vs X 2 Q Y ,sg 3 MBV X 9 2 an K 3 M wg 1 8 WX L any X 2 .Img 22 Mm hams max wx MMI u Q 115116 1 mf 2 ,Nw Q , ,I game A Q 'E pw x fa mal Ls N Q1 Q 5 imma 5 H QS X 2 wx 5 2 s ,ww mx 2 2 Q af ma! H 2 ,ew 'gp MQ M2 as fm .aw Y Q Q f x mx Q, X 15 mmmk fe mfwmm 28. ax iffy s fx QL, 3 22 K Xjsiwglifm ., L 22 2 2 mm, was Mfg is 22 J 22 sg is xxx 2 Q me wx 2 ,wwe 2 se 2 ,S in Q 1 we if 3. ms N x 129 3 Q L 2 1 E as Q mmm K my 2 22 aww R, 3 S is S1 22 1733 il R 3 Q1 2 QV we vf,,mJ5s 'fJ2X 2 sw 35' Hum my Qmdm w Q Z Us 2 msvs ,g 2 SI Q 2 2 xg. Q Q 2 V155 ,S 'smug Lx Q 1935 Us 12 10 2 5 KJ Km 2 fx ilf-E81 K1 Yi vs 22 22 mf fm 2 ws nu we W mx fi N 2 as 33 qw an mf 2 2 in 22 S 2 meh Q, an s ev fx53,'1 1 rw:-an sz . ,,,12,X.,,L,,,f 1,Wf,, fm, z:fmmm1.m,1- :zz mum' QW, - my wg: 11.1339 5,3 Iiffslfl Wk? is ' ' 'ffmswmi xr zxxmiv 5-,Sy sfiiX:?,,,.,, HH, .fi 14 szksmfefsiisfzrsfif N 5 M 91 umm JK mm 2 xx X fig shin - , f ,Z-fW,41fm:1w my .W,,L,,, Lf:12:11mW,,,G Sz.fw111w fiflm ,V .Q uwzysf M wise 'mszef Afwgisiisiisss ff We on 5 Q xx -,V ly fs --VV Aw, an m.,aX.Szxp .swam-1 z,m,S:mw-W 7' XX 3, ., ., W fmfszzsi 155222235 . MSS? lls7lq5f'xf-,cf -Je: :U .,.,,.,,,,s 552535 775551 S, ., fm W, gina? liiffiiikii' 4sz,1zm-' Z' :mf Q1 113 f'f'.f,, ,,.. 15,fzLgw1,'fSi22Zifi My ..,,.. J, -J ,wmv ,. W., H A ff ?L3SEai?'?ZeirFi?5 K iii: ?a5?,.s!2QfPgwvw uv .M ,wiiipig zgesiseswfimsisk LM M mm W' fy fmfwmm 'Liv S 6m?ff1f2w5115m22.155s I-121315-11, Qfswfiifffiftfzk f.m,.M. W- f :mmffwfmsfgg. ' lwtwls 3 M.. .,,. M, ,,, fb, A .JA LM, .,,. M,..,,w Am, ,H,,.,miAfmq fy fm, mf my wg iw- Ls W A Y 1 2- 3 K K Qwx me X1 2 xx mm X B ii S xx wx ww mini 8 X5 QQ: Q-fx XQY -K B1 A fs K mmm Qu Q 6 J QSM S1 hm Ill xx in ew L fm U 2 W , U S s 2 Q, Ks SM, umm my w S 9 x 3 9 KS? .Nw ms ww mf, Q5 Q Q mx ummm Ca 1 X in QQ 3 K N ,K X H? fl K f xx v,xf,g,, S2 fx 1' fm x fy U 5 Q X 18 mal, K xml as X, ,M M 1336 Q W am shut? in ew 19 EQ 16 1 lfwxwx X w W xx X 351121 Q ,,w.fgg Q N ESB 4 X in we um ig 2 X If E EL a 4 Sw xx ex W M mx Q 91 ,ff xx mv Q WM, 1 arm mol my sn f,,,N am ,, S mmm fswf M rgwwsffrm it 2 S fd w Q K1 mx N mfwfw K if S gn, Ps, ,X 2 X Q al If K gx if 3 :Jw N 'f Eilvlflll ai K fain J-wmww mn, mi ,qw Q K yawn 1331 W M2 1 me I! S L S sd f Ed , 1 Y in ,Q 5 1 1 X rim MQ Q as K N wwe X ri ST in Q J! yxs Mi S 3 X mix tm ,K 3 w ax X2 5 .QQ S1 K 255 ug Wm gk Z .mm 3, K 5 www sf K X 2 0, Q KU mu few? si SX fs 2 Q ww Q ,N pw H mmm ,ww as qw 3,5 mm X s mm M .4 hymn gxmwxm M ga X Q xxwm H Q K vm mmmqm, Arm ww 'H X K 2 NFB Xwkeim mm :SQ 2 S Q 2 ms an my yi adj vm 1. Q K QL, fa M fbf' W9 2 2 mx, fm :K fp 22 S An, farm QA 1 ,Q Maw S1 ,Q ax pw LJ Q A 9 x 3, My Q Q as as Q ff, ww mg fm fl X 2 2 S w S 2 2 M, GK Q Q My K Q S igiiwf mi N4 mam QM Km S 22 Swim Q N Q ssgzisxuw mme 4 2 22 My wwxmm gm M 'W wwswak 2 my Q mwxmvmdwaam ff N mek w ,Q Xwzfs Y. sgamfwxmw ,K 5, 3 Q :mam 158 s g mmmq, , Qxgeg X Q Q 2 H Kfgxgwm Q Mwwxwm qi 3 2 22 Q K 5 is 2 22 'Wx QW N 2 Q X X 22 L y it mam W 3 ,G f Mm , mx 2 msmmsamqx EM, ws 3, fs 1. 1 M m 3 mm Lf 5. wx H QW, 2 Mix! Swag we Sm xx 2 ,., ww YM A W M2 X, A 2 iw lx 51 Q xii, La 5 1.1, R, ,,, L Q rc ma VK ex 2 M H W my M 1 K W af Q W 2 H X 3, in M me Wiamrs M113 mmgwwf Q Riu S' X sQa31G,,y2, 5 X33 ffl W A 1 2 we Tm msn S ZW 2 2' ifffm as IW wwf, mmm sz J 3 2, 1mm K Maxam anwwym mx! ,,,0 fy sw 5 www QQ, Q ESWQNN1 A, Ni WM ,,g,,,, ,mlmvmmxm S ie K, 8 by sly ww aww M1 ,mg ,qgqhmmfa mm m ,XJ fp X X LX 5Q91,5,Hw9?m ,mm we 'W fs W S Kfgmfgmmk a fxmwfef Mama vmwfafww SMS XWVSQQJNS ,N vm, 5 m V,,M,wmffvi, 5 fm! HH ,Q Nm wwwayx,g awww f ww? 2 mmm :awww sm NR 21255, fp si H1 ,, Mm mm X 21 P, Nw Mm, wg? mgfzgm fm Q, M Qxffmmmk N aw fvmwwwmfimwmawx Kg in 2, y wg 5 K 2' Q mm S HfimssnssssxssmfiVfifsxfswfvwrgxigx Q wSflWgmasX!WkH5f'V'5'wi s fevvtmw my QSKF5 gggwsssmvfszssw few Q1 mf !SfMQg,,gmWM 4 Xysl aww QL 2' 2 ssswv M N as mi 1. X fe 2 L 2 fx KN mg ww Q , W X rg .ew 2 2 eww ,Q 2 N -K W ,S W my mum Q H ew mx YYS am 2 6 J is xx ,, L, , 3 's Nw V 9!,..,,..,,.m., , K3 Us . WL V,.2,.Q7,1 U 7 , .5 5? ,..q,Lm W ,V H ,..x,..s,,.s,,.Wna, ,V ,., .f ,f W V - -4,-:yp-V,+5'5S:- ijwgi253ZY2igggigigiggsmiisstiigsfiggsiigflfgsesifgggfzlfggggggggigggzgqgggxgggg355Q5-gsgeggseerfgggsgssgsaiifggfigaiw M-5 --fggisl-Yak, X KW, YA gwggfxgfjfzgiggmf, 5, :il , egg! '3gQW1gg'f'ikjigfx-V',,. 12si'7L27' yjjs2'W 2115?--le33ili?2'?2iLs,Lgs.14251522i2s2zggggg5ggfegg5?32i?Eigsz,ggg1fgp1,aggjf155f52525 if?i'1swzggQaffg,.wi1,Q,.iMw5gq1gZ5ge,,eww ,iam-15-M1anggzfwg-geewr,,.Wgwfzw,.fQsfgsf1Mf:wg5.Lg-W4gf me my mg W .Ui --Q gig . ag mges 1f5fx,,ff1,1: 'fy M ag, an iw Qin ,gs wg, 122 ffzmswz wffwfffw 21621225115iwflgfeiesgwsiiwlmffvf.1 'LS-7 sw'EQ-fXffsiw1sfq?wfffY-ww fix H11fwfwfifew-Q22s?igfM2Q:mm?51 .W ,.,,fW,f N ,kU,,,w,.,,.,m,m.s,,m,.,,vm-I -I,-I2-Lg,WX!-LW,.m2,..2,..P,.L,..v, .... ,,5..,U,,,q,,,,f ,S ,k,g,Ji:fv,.,,kg,Mx,,:gm, ,M W ,Pu Lau Q, ,U gm .M vW,d,,.. H.,s,,,, ig, ,M M ,s,,,x.,S ig, ,fx K, wx, ,,,,3,W,,:g,,k,kW ,i:g,kkg,,kmZ,,,,,,w,,,LK...,gx.,,s..,X..,..sx,.,,.Q,,,,.,L,,,m,,,,W,gm-J-smzfaxfmmzm-fM.,f.g,-Q,-, - fx,-f -f -f 2-2 Lf.1-MQM1ff-:,,w,ww.,,f.,z4W,vy,mf -,Qi mf-3-4-?fgsgJgyggffk,zvgwu-.5y1ggg-.ggmifva-itH,-,ff,Zw,MQ,4f,,ffHfpfg, ig .?.d.g, ,mi ,if mx: ,qw Wk 45, K, ,5,g,gg,,,k ,f ,P :.,f-:JEL ,Q 55, H W -fs wgvgpg kggmff-V1swmz::rs-:fwmgfwe,f2:Q1m::w1w:M-:diff-wf.afs?v1es1fx114ss'faMaw-,f:f'f-M41-N1fif-fwvlwvvlvv'fwflssiwway-Ifww-H31-23K QMis,13rZQffl5,fK2Kz55s.mgffggigggqgxm,Q xmfwvm-fmilfyfsmmesm,ls,ig,w5gg,ggSwz,fsk 1M3W,w,, QAM gi.-,gg A at fm im ,Q fUmfaM, --1,x,eW ff, mug, Qs ,ix ,fy pg W -fig: gfsmw wmffwrsfsgggsf-if-123-sfmwvwrgms-QgzfzwffwfawiLemmfwfywifFwvfwfwsffesffffaffgffz'Wfww1s1zssPQQssm.,:mmsnfw-fss:l2sfw is?fgW13f5gq1:kg,1 gggigg,9423-fy,333ifgfzgggkgggf1'Y51Q9izwfsf?4gg5ggf?iQsEa2vixz 1f12sfsWQ11f.f Liiffbtifsgf'i7.i's:1?ws2M1-.51sxgfgsgf.,,,...LagfggfW- 25,5-mg M lgmgvg ,, Ja ikgwfggza, ,,,2g15w5-.W1ggWi,..,,,,g:gggk ,NEHW-i,..,,JWim,wfxfkw-,?zfsezzsQs QMWIfWf'2f'55ifAi'i lfszifaix-5'-if:455521?:?1f???ff1?S?ffG?HififfavfiSfwiff 6MfsirMrf'l???2???WSfff'-lrikfiifilfQ55 5 W Y'XWWKf7'1fS7:fff1fif75if53wf? 'fgiif ,,,,i5gg,ggk,ggk,yf -gg, gp-:,1,':,M-.s,:f m 1:wwf:fiwg:-,Wgwgs-fn,isammsskfmsm-1 MM5555-g:A-ggggggg,gQg:gf,f,.g:,fi:55,-Egg,mi:,fyf'-:fm,f1q-,Qi-gf: Q, -:sn,1m,. 11 2.1-2,r-,w ,-rf V-1-f-wg-wiewie: 1 iws:effMQ,:f2f.15:-fig:qw wif'-fSs1ss,': swzfwsf-f W-:m2:,fQw:zx: z2-:wffzswfSz.f5S,fPwfs:-'fff'f:ff4:1f:::2Y5iS'ffdff' SlffifiWY?:1ff'5w15fifw'-1?SAf!1'J'S:'W ' if'1 'V 1VVf1fff?15Z4JLP5?'!3if31 -1 1 -' F' N 11'f ':Wf N:-W Mgwwggg,vgmyfggsgaznf smewra,s1Q4-lfmfwwggsvwgmgggggf:ffffwmg ff,1wfy1s5113z55i,31w, zwfgfilggfQ::vmfwg3W,-5 W-I-5: fff,w11ax,ff,,4W mtwa?-lfgeagfilssz5s3gz,Slgz,frmfwpy,we5513,L,f5sz4,5,,1qw:Us-ww-fwsffsf'z-:rss:ifkmfnfw-:Pwvwvffsigf--famsswffwyfawf'wwlfsfgfiifgz-ISZQMQYIIWSYQgi2fkffiavffssfbifiii?filwxfgwsffziIWWWW'gvig1iWmf-'ef-Wfkigi-SW .Miz -A My.ww12zmWmXz,,,Q,g,L,,J,lfff,.15,.M MQWM-,J5,,,g.kf:,w1'm1S-'fzsefzsfzfifagmwir 7-fswzfegl fz,m,m,,.5, fi-mm,.ww,ISM fm,fw.,fz1wwfwzssmm w:m1:.w:f.:fXf'7-f-1wszzzsa4sm:::Mf4-wfv1ffv-1fw-'ws-Lzefvzw f2f'smg.LM,wwfW:w:w:.:fffIfaswzsswflfwizssfkiwwmf:sw-fllrfw-1 fzems:2f:i,i5Qi'35?3326I52252xizwgzw155522fs3ZF5234e?QfQiQFgA:?gj'izssfisszswsisggk3132.zzsgqgsiigiffgigeggg'iwifmifiakyx f Y W- mlszgsf'wr.ffwmsffwf:sgffsg-.f2m,2w1Qw?zmZgss:svfwz4sw2fgiflygsixfwnfiffftgwshfLe?244fiessewimsff8:?4vF5351WW-Qzw w s IW mfff..f22ms1X1.fm:::wifww 5 K inf fffI5QgggQ551QZS25fQ142S152Q53ffQ1X25222ii1fQgi325Q53QQ53iaE:Q3fisirlKA5ggQWL:5Q1S5S25Qfd33Q335SiT25S23QQlU5lUiiii54ii35f?EzsAiZ.Ll.sifIzJi2af:ms.2y,.a, eagerffxffm Mfffwglea,faexmsizassezgslrf.2, 'vzggfwzmfygh21:4-gNw:f .V A A A... W L , K, . . . , ,, , , A -, rawwifeffiviiffsfmfl:fiwflffff' Lgvfsezlswvfwvlse,-mzwi1511225:1M1ffezAfe1wzwsafiwfz-rf'-wr:-fwzz'f1'w mf f SH' .Si-Q51gffxiizfi-famgzsvfivzwgigsz14gzPfxfgzLs52ggAgggg5,1Wggefgggggjysgvg:siglzggglgsifasriiesifksf-5H-,:Q2ggvggzz1gs22ugQ,?4f3f Esfjisfsef mf,ifEmiigfF2if21i4+i2EP25-rvgfgfsssissxfamflaex'X25:54 fQf5?siY22.WifiT11'4fW9'Qf?T'Li?2ai52sS5giMff:Lifiggffiikigiiiffiimf2521412521 ??fbi3k4Wf'-2'fgif324325f31?f355F1W5555fQWF52355w7f5K7i5f535?Xw''55 5'?555?3?5255yQiJQ552gLHZSS'1QiWWii?Y 537 YW f 'k :wf.ff1-ww 1F21Sf'?L3ilFi?i :fs zLf,w-fmmiWm-ima?,ag2 1,if1fzfiz4eff 'f1Q,,Aga, m,,,w1:w ' - ' '- '- - ' MM W WM ' ' fezgsn-ffffkfwlsfLs:-1:4221'43fffgfwffvwefffw-fig?fflffviifwmmf1lm-2+-IM W hfffwwagwfmsazsgwi-QM sewffwwfiszifgflmmfszggyg-A-fwLfxlgggzxfgwfgxmf-fm-1SwayMwmf?fkzf,myLgsg--www ww, wig gif 21whimlgxwgqggmQ,52gffigs?g,?f54zgM,L3,s,f33-iw-Af5Z1fX11m111mZma:fw::ffmfmfwwiyfiEmi'-yy:gms'41w2fmff2f 513+f-swfafizfwfiki1't?Y2xf?isi5?2f?2Lif'2fffifff.wwf fiflfffifqvLfwvigifffxL?skW?fiifSisfYGffflwifsmwszsfu ffwf fiiisi? ggfwwzaizmsw-my155g1:Mgefw-1.ff.,-f :issf4we25mf?2Ws5fg3gg?25gg2gf82gfifw1sf?isf9fei-FeimfS1Ls?13:2igswz:Sz4:5:2255 giffdi Hwfffdgi w1mv.Lfg,Lgi-Lggwgggg.11-4ss1ffmzw:s1::Qw5,L,,,g.,,Q,wQ:W,gg1wwmmm-fm'vas,fQi1f4magss2f3g.1',fg wwf-wfsv ww my 31,5gg,3,?zl5QWf1L:Qf14:w:fg.lgwgzwzggsgglswvfswsylifif4s2,1mmsm'-www-Laffzsfsyswfvsvfimsme-isslieszfiez Af.Hf,,z-8,51 ffgsfvm ,sewvww-25x-fv,:11ezSf2z1:mgw.wxM.ww. -,aww ,V:Lm-m-.:m-:ss-fm21w:,:f:ww-.mm,.bs1,fffs-if wi-M iffshff ww HIM:va-WFQV-fif2N:+if-4252'W 1 H 'ws f +WYff2Y11WfW11' if mf: Q'ii'if9fSs??'v 7 99 ffl 121'-212-fiiififfxxl-IWHYW fx?-'Si fiwwrfgzimfxg-,f f1gefv',,:ggsm'-my few ,,faM-lwf-Wag - 1 -1 W-M.eH. fel-,Fw ,M yfiggf 5 L, fqg-w,,-ff,-Qfztfgwlmmssem wg ggggwgfgavswszff-lima-'Wes' My ffA:2z,gfw-fwwww mf ww QSM 1 wwfIsmggifiz-:iff-Mmisigg fzz5'iys5gf!55gSM.Q5-5e4,,zgf2f-'?E'-?51-551 figsWfzzizQx5gfe3g:ygq51,2?Z gffwgg ggggw QQ Mgfffwg. ,7fsisgggsf:g.w: 'sw f -wsmggwfg gsgugfggsgsffzgszsgfzzgsl gggzrgqiw ww wg gm--zgswfzwmzzsegefsnxsfzgsfes.f wi an fxfzgsfzfgz-M 'ifzesmigsfffwrswQH7is71ie1?12f?1asfiQfFiafPiQfSfQQ?i?iEiQQ:'21 1271 mmf-,fff,5f3zrmg,5a,,EW,wgwfmgswasmmm.1Aim,6,flsfw,-11m,,s,sf2mm-:mm wifi ,QM 1 W-q5,NM9l,iN,W,mm1smM:flgfea,f,yfmm1-Q5fQwQS,w,mf,XwH1Q2Q,,hmkifqisfsff -ifffxyfgw my ff-:ww Z,-.wa Qs,faQsfszxsffgw,-svggszmymiriam-Mm wggffw:w-gwwsf1.f2f.-mm if ,mf ss-gWQ?1g,wfng:f1 mfg.Qe11Xf.:zxswffm'qqmwgfwexz :mf .vt-QV5fa511gflfgsfzssizsfwgyffL21:ian1Xfv:sv'ss:wz:isvwg ffaff' zsifexiit14 -wwgtgigwf ,,gg5wg:l:'9wg59asfse1f'?:g 1s2ffwfeW2vffeS1Qsfg21g39s1ges3gfs3g2zLa g,11Efv2?:3?1i5i 4:1fsg4.g'11ggsg, immmguffm:wfggesggixggxzggi,,gwfff:f1L Q-.1 vidg?HfrSw3i?ig'LSfggSf55sssgsSsgfsi4ss:4 2f's3w155L3-wgiiigwg-,gg-Vgsfgwfiz :2S:fHf1 111555 ssfzXg..f1, z4,1MfQv,, mmm , mm,5gif5gQggM,gy.1-Wm' K fm 15-fM4wf5f2g Nw? 553,153 ,wil,W1,Ww,gq1.,5MWg,,1,yQgwgggvgggfggwXfnwilm m1,f1,w,,xg.ifwg,wgg4Qmggfeigagigffgffsgigzg.Qswfsiifffmssm Mlm-,M zgfwgffggfzkgggxgsfggwggsLf 1-fy1mg,,M-vfxmw,,mf7-mf--mwfafsl,:sfsfwafy -:mf um- fiwfvz,-w:4w:afi1:mmm 12sf:wm:ff:1--W-'vii Lfwrsmswf.M.Jfig-www'-7 fw-fg:-2+'fwfw1f:,211wi WW-.ml WQWV, -Qw,wfQ-Am wffwi,gsf4s, 3-aw Wil M'31f5w,ffw12m2Wm:wif'-mf -- fx,fwfxzwffgflf-flayffsg'iw-wwfi-21: ,Vg5H,,F,.l .A VWMMi,mi,:jW.L,,geW,Lg,M 1w,,Q,.m.glwmwi swim 1 wx ,l5,vWQfgl.Qf,1ws-1 1mms,fmfmeigfezlmv-Qs:-is-.Muif,Q-M151-,zwceizk-W.,ff:sz -fl fiw ffwzz ws,.fwmffJw-Hgfwzlfsivfsslsikifwwwf1r51ff:zgg'JggSqfHq-'mx:.5a-15:35A.,-.1ggfm1igf?fg5g,g?55 fgggws qwgk: Qgqggi-153,aimifwqgggygggiggigggig?g,ggigQgvg,e,5,QM-s.,eaQzQ.g 5 -if-wwf:wEg!4- wssgzvlsauesif4e2f:4s?.4mx1semi?Y'g51X91Xf5yS:f Rskis-asf.zzfgfilsim 2 sw- sQzgzi4sxgiXs5mv1fg.vmygqwvlfseffiggggugggaszf2e'1se1:Qz.ws f-91 gqsfwv fevgevlsfzi 6116555 13:22 55254532ssesgfssmgiemgsfsm.fq,.fmg1gwgggin,3,,5sgS5mf555g5B5,x1kmg,MfMLi my igxgg,,,?,g5Q535w5i5 wzfyfgggggww,9 E:,:mw,:szf fmusxixzss dvi f2i's2HIfJ'f I f V1 ,wif-f'FV! 9:65-Iii'-'ifzw-f fiiffi'-fWTffY 5'iaIY'f +21 ieiuxswz sew 'HIS M M- -Hams 1455-gvj, 3-KM:-gag f gA:::zxzs:zQs :s1P1',ffiW1sf5 HJ' zf ?-New fsxgssxzlxz xi 'AI ' 1M-fi'fPVfWfTXWfPi1-f V15 lf' ii' www zsmbsizsyfssyfms-Jifd 'r1i'f'8' My W W ,NfsmSMMK,www,-srimffim-W ww My,.,s,f1,.ff-11-,-WmayMf,,wUm.w,,fs7 fwfwnw-,ymwx-wifwwmy -wgszwzwf zpfwggfzggfefg,1iL,:ffx11m1mm1:Q55Wg,1Q.f51,451f21z:fzsrgwgf,:f:gg:15g?Em:m,12-.W Q..,g2fD52z5g5Sfg,gggfp?ifg, :Amgen gfggyggi ,ggggggSg5.2:1,:g,:,Qhz,:mqgwgqggggggigggggV-Sy-wfbgiziisxfgysmwawfwwwfs-WE -ifgwfg5xvf:,sg:,f'.,ifsslsifmsiqf Mmgiiw W.Xfr'9iif?iWWZii?i8i2A5224651 EX?5353Tesimgisf.51iQigg?iggHET19ili?W55?Qf?5i5f5ZQfiiigffflfffflfwwaif 13525132 defies 511511'Sigiii?2SwQ544E??fi?5?'Ee25imfSmf1255252555121'kiligiwggiifgiwfgfsii?f!il5T25g23f1??24fff'45fQW5i5915'fG??i?3MW-W1'Q-ZifEf2sfw5Qk5?5i5f QV 1Wzgf:W,g,-ig, -V M gzygiw ,fmsz,:ym:w1y,w:u,ffwz,fmf gf gf. Q-fa-.ffff1fw--H--,ww my xv, sz fm WI-1Infgfli.mmN:fmwww'--1,f2Ms.z:1szvf.f.,ar214iw-.fwiif1'w-M ff Z - Z wmv: ww - ff-W Pk- Z fiiwffw-f m:1ms:sf512: M? 2egg.5ZQQ2325g1Q5542if14QAggsg5gQ2az52114feasfZ15sg1isQ2sQ15g5Q2ggHgiXqg9sgg1v2gsffgiwfQs22 ggexzsfffg wigi5pig5figsgsgggQXgsiwsif2ffgsfg5fss.Qfi?f:ffxm?LQm,Q2sigwi'2g2qgwf1XgZwf4jig-ffaglasiigsffms.zawgff.ffifZsQgZ95i'E13g5gg ig Lgiifgiiii? Zwsgeissiifzsfivif'i?ise?iS3?i5g,,g,gbggWWzg2,figg5ffg ggg55g5g5ZgggZ1gQ1?j'igigssxfffwi1325411-ss?15.1g4ffs3'32sif.iggalgksyggig 5311215 gfmfmssswszffasgigifizi gg,g1gS5Q32555,Q53gesgE53QgQ3gsZ?5?5gggg2g55x5Q3v1gz,gg533541, 535,,iggigmmgmgzwmggi E5 isVlggiggrigggiiwgg 1,1..,::13w: ::Wsm3g:y-Jr-f: 2-111-ifr:z1m,wuQz4v,1QfnfzA:.,1:,1A..,-iwzlQffgiig-ffgiwm -gf. v.m..,M I. - -- if ..,,.f1z www:affs1ssss1s.s2ff:21fsgmayffswfffi-wi:fr-ww'-J'1-vkllsvflsvvlssvkfiyw'ffff' ff f fff-W fi ww: war ff ff1Qs-f2if:sk:: - Y 2-Ffifii mwisgiif-,L:ML www A--- f -W 'Q-Vmwghfw-:,,-.WL HJ ff5M,l5:fisz11fQw..M:.,I I, fs-,W ,A VM,Ab,..2..,,.,W.,,,.W..W.H,fkE,w,M,ls,v,:,,,,,,,,,,L,,,,fg,Lg, MM, ,. ,. ,3.,..,,,,,W,,,kQH, Nm ,Mm,Hgm,,l5,gf,ffw,Q,im,Q115iw.mg,,gZWf 5 5,,-,,,i,.L,.LWlg,i,l,mL :Mig wwe ,1Qfq5,Q,,,1'iw-sWf.f,fmfz,w,,yg,gl,,Q iamifmmiew2'wer:-Ps::www fmmw zszifsfmsf2WgS4f52gSS2?2 1firfiflffiffiifsi gdefw Wi''skisffiiIwi?Iii?-SMR?ff2'f5S3:,1is?5s'xs :aff my 'lf fgwgw 51,5531 sigggssgsei fsmwfqx wsszgzgfiqffnqw1gwg.ggggqggg Vggggfifgfsgggsggigsssgieilfezis :f w 11 2 .s:wmmg?ggPi7'ffg,25fgy2fff.,vfs5ggseg ssfssgss14a14'1z:' 5 ,,,WM,,w,fWs,sw,ff2,,ff2,1mmX1 1ggN,Mmvf-52'-HM A ,nmgfgp-QQQSW3W,-3f,,.,LaxA,,1,.,,My .Qi W V-,SW L1 W g,f-2,-,wg M.fmfwv:X:2:X:mg.f:,ww 7-2 WSW- A - WMmwfgfLf:w:: :L 1-fm1fxffgfbfwfqflzafgzxefawfgfffg.fff, A-awww ggi'gg1,ggifggizffinesiiglgisisesiimfgggig-Z,gQQ,Lgi?i5ii555giQ55,121ssgji're5233252515222ggzigqggfgggvfggsgy5 J's5zQf1g jg 15 5ZA:5QvsgQv15g5Q2W2Q2?5Q:fZg5gf1g22gHzgggggggi235712252222:s22f4xi'2s5xE2igg??m39522422152,iemseszsiez:ggi.15g?gfyg3i,g1.gffgxg 55,335 .qf,m!,. Wsiiifgflfv15211i2:feivfQf-fa?57S?sE?is-fggiw 1155.12g'!5g?l?S9F1g-misty?9: 25f1s5fss-ffesfziiegsrggifggiwgmgmgg Wagga? 53218225 :ggi-gfz,g:Qgggwssmia:usefeixfsizwfqflQefggffgfsgggvlsdv2242214222:esiiiaxfia-.ffigiiigiz,-A591452ESQlfzvfwsgsgi,ggezyffngggvgs is 515 ffmai Lsifw 'ESE W1iiEi:iiii?5f?b5Ef?K5z455i?f' HN- If if WL ?f'i1s?dsii5Ti5i?!?S7Vi i2f?i'1551iS'2gi?i 94xi?xsxii5iVl?i,:.jQ15 ,f 1 km 3552.535 gr: Y: -gbkhlggjgijfgggfg igiPEg5?Q4?,f-5,52 lniV'iiV:Lr1i?1m'f 9105- 1315 g5fQf?5gE?2,55Yigi?QQi-SQLZSEISQEAPEE5522'S' f 'sfls .Lay lbw im, 4551 uf 1 1 Q if 1- i:as?fQsssfe?iff2?fii?5 -ffwmfw-12+:51151'-fsK11s4fq4ei3m3s3sfss1flew.rf.ffm fgzfmfif-1Mis?m:w2'iQ2Ls11 'fi -Miffif :fm mgzg g,fw,g:-1--ww :mf-'ww iw: +V-fssise11'se2ssQ5f1a1-.fsifish-1bs:11.5H--'Wiz ff':wwf:w1f:vv1esv1vsvs.1-1.,'wiQwss'45ie23ie??9i:1?2f?iA3H Q,-fw.1f::11-sumfmwlfg,fgs1g,g5q5:2g5g-2w21f1m1 wlfwf-PSXf5iX?ks-154-wifm::f:s:wg2:.fag--Sirfiigmszifgfss? zfsszsxzf sw ww1:5-1321211weLssixff95'?4s2ff22'.51f,2'?Q?ifg2zgPS:-121MSRAM?IWW-'ksllfgigfssgisffixfifii-SJ-V121'22'Jr112vfGr:fbs'1 -Skfrvffwww L-SME!igsw.5gpiigiiiieigfs?4eigsai2zsi2ise2vZS??g,ag.,ifimief-fxmxfmeizbssgisifgswgjlfiiif?fSiTfrf?3-Kgc:wsi:s2-Lag.,fgqffv 33335 ?Sggf2gU1fif?f4fXfAMiRii?Sgi322gf222f?23fQgfiffiif1Hf7?fz??3i5i5Gf3iWfifffgfi-fiif:lEi51ifigSii2g4'F1'i25'K2SfaE5fX355bf5ELf21gi55giS24S2 W 3222135 Fig? f:w-gwf-,f-g 7-gsm mm UQ A f H ,fl 11 my f.m,, m,gsfUsziwgy1 n .HW S--1 .,wg.af:ggz1iQ--1 1, I .J ifwwwggzffgg wwf gems fn, 1 s,,,,f:gz,:w-w-z1 mm 1 Mpigw-swf,fzmw.Q:,im-fi,www.,8wm,,f ,kfmqfsui,MiIgmm,hw,..35g.WsL,gi,-,,,v 2,235 mai 1sq:w,X,pgg,.q,M,, 5s,aS,?fa,,vM:-awiwx, QM 11,,M,m,m:ab,-mx,,jigwffm:ww'IWW 5:1-::Q,,.vfw::Xf,fL-fag-wg,-.gd mmf::fvv-wr,:swsf2fwf+fa+fs.Q,-fwfgswr-'ffergQ11518zflwsgsgsgrffswbii-ww:ASKaw:J,':2ggfawQ-Myew wer-:f ' 1 mmf gyfmfq:wwwifqM.,1,f,gw,,-wiiwiuyfqmgWMM?1,g.wLwfmQ:'fsgww,mfggmf: ffm Ylui-M--:Wi55f25vf'f?5if3VWit13511i5i7L?12ii'.iss?1 -U1-?AsskiQ1.1gsX5M?1g'?fMVfilbiikiziX7-fi7!iVfW1fSTf!CiS-57faVfxtfwL1xw'fk3,'s!z fifff WEL ' 5.gg'gS5'f gfrffiz nz .ux1uss'1gf5?-551 -55'-535-:Sz :Fx sxztsxrlxsifsi 1rti1'i9iff-EWS S3?1Mi??11iiEf'5fi5E1i5S'iiifmi'fiiilbitlliglqsgl Wa E5 fer 131 fi 51 -51'-, '-- -J 4' Q,,6W2,N,ffQz3gLzS5g,M5,fX,vfw.,iQX,aM,,,gi,v1,.wg, mm,Wwigg,.fMwifg,g8,Q,IIS,-1,,,,zm,W mi 5, H Q, -gm K-. 5-15,2fy,:21Qgwz-wwlWQMNS-im-www,-ew -memw.Wm59,1Mmigzbgrll,em1i:m,w,,,s f Sw. f ?ff::MtfijgigiggfjgI,.M55zf55gf?37i3qg:y:kyin-5If-1.k55Mg5.JQkg5iV55vi5xg9iggg11ggs9i g.z1:w1 532-fi? QQJ:-glfffpi gggsgkLLg5,p,,zl5.Lb5 pifjbikgg fyfilag 35195 kggflgggi -Sfiff?.sQ2iQsi,1gfgg7ggQ,g'Z fgZQ.Q5fAf ?Ql,Qf?EQ 553TEH!iffxhswfqsqfaglhsiH454-V'Sf?451 Q51-P7153iiwiIZQEJSEXZHLSPEEYSQE:56ET!9z Wiz ik? 1iiiif'2V'f 315gsf3ggsggfeggsagggfijgeeimww,5gs5g55555:QggXgg5gg115ggggQigqggszwfxfggggfiibzfgf5ff5s?fQsjg21gwQgs51ss1f Qgggmgwig firm mgwfggsgggfaififzasgzw,gm55Q,wrQgf15gY53gS5E5pf3EQ2Ef2232421mfwwgfswl's1XfS1QfXZ1K32gQ23gQe22223fQ2g2F2P35sgg2a222QeQ2r?1u3g2msfms2fXsf ww:an425:15-Mzgszfwff :ffiff's1fz,fz.wX::fw-fn: ww W ww:s1.ge:ge--fg-tiffzgfmw- ,,f,wm,m -.sg 521 mm sgwwfisvw-wfwfIfwfz1.v11sf--wf, :ww'ww-ff'wrewrewews-ffamsf,sm5.1wi5.15,75W-fzlw,wA..mffww feznmw 4'mM::m1f:A:1Sg5zs225fg,f5:fqggfif-gqsfgmz?1:?fmQ,sm5fz,fame,Wggzgfggg?25a,.ygfpw,.w miie? 1-ww 1ws::ggi-ffsglszzfeffXsfGQ?f,g:S1gmaF2--Ysew1s2,'4esz4sa5fwf9!ffrf5Q:W1'f?1fyfwqffv-f152X51fS31s5fSiQ51a??f''9WNeww51XSsfs:?11Qf1sf11 1fxgiffggfigfgmgsfzksszzigeszsssvgsi4.22ssQ1,'45sfswX:2:g:mf:fa-ws-:an 'ffezissglgssvgefg2i:,225ggm,g2zg1i:fpm:1sm,.:e,5eefff2Q Lgivfwszfs Liwifg fiifs-:qfwif-fewsesfsffs14ss.ima,sfqiwiwiff-vvfwyfckf 2155if'15fas52:G'?ZgcWg5S2YfSS2dVYWiiivfirvfkivfirfkirwfiiif1i2i4iiNiYfiii'4iifx? WizMH?-LS:1if?w:1211 f E -issggiissggsmsawas1iiksyfezaszswzsglglflffm:asf-1awifgsfffggsbfgifzisbzaqfgt wig Lyifxk Qejzisfif meGfzfbfffwfsimfxfx5Wf.fXfzswf:smi555222:H22f?i14Qii41'f1f'fgfXf fwwi- 1ifUWZS3242fqfiixfbfxfbigfliwfsgL145gW2f?2''S'-sxzzsmf isvgsmgegl-mmsefsfe fl -ffmM,f-Pf1.ffsggigWf:gqgwimm if-wzzlewagsf-Qmg,egggfg,1m5f.ggwsmfa ,gmzt F,a,. mgfwwfggf fgmfmgaf gQf,fffwW .wsg.mg?g5gg.g5sgggfL4gg--gg,-sfswgeklzsikzgsviw 1MQbXwswfgmfwfwgf WW,fmwgy ygg,'fggfygg,gyiggg?g-?5ggg2vsQsz'42,wsswissisasmimmgms?fsixs wmsafssfssv1242121542ggg'fgy?,g52f5gff4gggg,us,:wi,wyfakff -fggggggg gf-,f .ff-baggyimg,gg553ggggmqigggizsgvfsg,fy-sf-ag 555.555-Mvggirg mf-,1i.359v:rzafssf'fanewes1422-.iss-.4'x:f: 221515214:szf4wA1Qi.4msv4i ,QiW-:ww,lgm24swezgsfsw:1fwffmggxsif-fgssv.mx1Q1:Q2QAsf,f1zM:W,,:f1,f5.1W,wgqsgsfgs-fmefg wg? ,mgf swsfzseszffsf6251551gxzvsae5452145255211'2if1S?2Q?5s'52g5ig31sffSvfww Km :M--Lge'Miweswr-fwvffw2fw2LeQ11sewffewessxe 453155 ??zigKf:fmf4L::SQgfgfufsffsiiffQ31 f ' 1 2-QEEQEQEQfHb2W1Sf,f5425ffmf21121si,1myz.s2inigifsi12q-f2yif25221581522 waz? was fgxigfiiffw? fi tvtS91Q2H24fqzgwzwzxsxfikgiifififiZiIHZ5isf7fkf?fFfQf2?iiif4fQ1Xii?sg fm,H-W1-5Y1,,Q-v,W1,,5W.,wQQ1mwff:L,N..z.,,ww, ,,,Ww-1W-,mfW,,,1,,Mg,g,1wf1,m -my mm Mijn:,z::fwfw:f-11-:ww gmfwqLfw-.fw::xs-KID wwiw-wwfww ffm ff-W'-Wfzf-3'-:w'-53: 45ff:fw1aestiss?fszt':r'x.:W' fsx,sxxWs3',,'554i5 f1' si1xs'Lwt1f9zm!-WV? W:---5:-Xxx :-We-Q 7 w...z,.sz,Aw ima: as ' k' -ww,-sci ff-52 Lcxfsuxw.Aw-l,fl3,gf iq-:xfgifzz :rzkwwxs ,. M 7 7 -f -9? -:J -w-w-.:L?Sfuz-wx1scx.fr:xt'rsV1's Vilma-fs PM 9 1 rail 11 A-vw f755?f5E5f2igf2:5WpHQ-11f7w2?seSv11w27swvsfnz:gf-W'ik5fL35fsa5f'f? s:ia2'sfwww -?ii,3Sfg-2,1f'sfff?42x1sezgfggffzgfggw M2555 amy. 551-yqsfsgzssggsessiezxfsgzm?514gmgM45qfmgvi,-421555114s1s??sa5?5ss53s?'ii6Q,igsvig3WgP?iggF!LMK1fwffffssxiafissksi4ess14maffz54?:.'4'ii'2f19Eai 'kxzavfmgmg?ffg3553141g5555133M3142amaviaiifsiffiesffmM21misslsfigiiigiiiiiwi-bi::if'fssfn?f:s2w,22issffs 554 V ms:As:ige5fi5Y2Q5iE322?553532352isiiisivims?fsf?2s5'553513fSSgS5fgSf'-'ii?'ififvibsilfsifxggsffgfqiy 552291iiggwfilfEW!--?1f5?ifWifYi :lessisesiiixi-fmsw gh-fifsff-is-w,gi7-swiss:ffssfllziffiifzgfgi-9 gvfaffifffziigfwfidi-ifiii?212'ffisfissiliw'-iiifseilli WEE? W 2 9,,Q::yw'fggff5we',113215535iezgsezigsgfgws-fy ggjvifgiigi--gg-kgggsg'sssfswei1szeifeQ.fe.s1-fi a'fQff:2M:f5w:gq glfssfy-,f-.21-gmsf-gszg5,Jf.bsf1vvwma nflm,Vf53QeigQ55i2E292i5f51sfigiEsif'wf?fHfQfg:fx.s2ff2?ffifQ psfiffg-w2g2s21g:2'iQifi5f!fies?15iiwigK?,gg-551,55.egfpspsemfffffv:N??if?f2i215fS2gZl,E,,issgeisieseigifiggfzggfifyfizQsziw??':f, my-2?fXs?zQef -m.,M-w:.,:.z Vw:ffswzwrwmsfkgwgfvQ5fe:-:-MQ-wwwig:w::ffA.1Qz::21A1.z,..,-f,1'L.,A-Qsfaglgqgi-gggg:fg,i::A:.,A 5-ffm -,ml ,Sw g5,gLggkgagff5g-,M,:.,:.,,f1fmgg:f,W5ggQg155-fgg-13.Igw 1f.mg:fm-:ff-fwgwfwfg-1g:fw,zgzffifwzvk-ws:mf-'sew gf,,,,,,,KZlxzgg,1,,:W:z,iswmwdq,-.2z,Lf.,zw,.,MW1.,fL,:wQ1111w1:wx-ss ..w,.m.Q-? ww: wmfsf -V V.-W2,-x-wz,f1,fmf,f,rm- L,-fs-W-wr, .s,.smmsu-:magHg-fx-:H-.V Myf2,ffMw,.L,,w,f.f5,:aww--..4, MW, is,M,,,l,,1E,f,,-W, --,mm.img-1112, Miz,.1Q,,:W,i.fX-if,1,,,,Aj,,n,,5,,fg,M, :EWU in ,I wi Www :sl iw sw- fwfix- iw M w'-AwwM-.25--Q-Sw-fgz ww'w:w.:ww -zffswm mm.wzmwwwffmg. ,,--Q,,wfw,:w1smf:m:.fs,.fmbsf:W-35-Mmi-.lsmf :ww-:.wmms 21151-ff iw- iw-Q55--K, MW-1 awww f-5 ufmyffz-fyffw'mfmmm.Swimww was:sfffwzmvfsxwww:sw-lwmwi A -'L ww--f -fl -W why f-,mtgrl-g,,:v,:ge.,::wt' 21 'f:.ssz:1k:,1sz,:x2f:s215!11:s1 5-wgyf -W--V -fm--up 45us?'e,:9'f-rg -f ggk gg , 52x .sx, ,UV 31 :lex :53::45f'gfv:,s1 .x, fy 33 17,5 W: 37 -5 7 2 5 -ezmwufv fx, .sw W -f - 7 - ff 'Q -gf' .gm5':qE Finlrfis tis xi xzi xt: tv z. 1. 931 sf'sss11Us1f -J mx W121f12f12m,U5.1,--M W,.9,w.:.,,:1,X,M ,L -imwg, gQ,mf1,g,gk Q. if Q iw- 5,fafezwfwmifsx,M f Z 1-,::.,v:. 5f.w.w Msezfsem W1 f V: nf vwxv: :sffseifw-12--lfwf-fm ew f vwwfwffiffiwefziefifgsi img:1Xf15111gZ,1x,m:,,i:a :f,s:s,,,--ffium V-U.s,ffs,,.fx,.mwSwim,1,mX111Q1Q.s,1.f211gwskxm-My -W -saufxm sw. If SK' ,wsnw w wf!- .wy,.fq,.fx, fx- , - -A--MW-ws?ffsw,fm.1xv:m.-11,,wiffy-.571-vfff21-f2w2ffmwfxf-MLzwmbw-fx-W A .L . , ..U,.,2,,,b,,,.:,:,,X,X,,,A,. ,5.,,,, ,,.,m,u,, k , W u,,,k,,JM.k .. .W ,mm A ,,k,.,,, ,5k,,,kf5, d, S, M., Q., :,,.,,.w,..mg,kf,Z fx, ,QW ., ., um .W.WX,.L ,,, . ,, if X ,Lhge,Lm,,,3,,,,A.,,,.m,w,.:n.MN,,,l M.,MgQ,9,W-mms,..p,A.w,..s,,.,,En, k,,,kf,,k,, K .T Um, ,..x,..,,. My,L,,,,:,,Mug,,LS,,,,,,X..,,.gx,.:f ,Z ,L.w .,, .,1,.Mm.MLXW,s-.L2W-w,-'MI,-fs,-:mf--v1f,v, Qszf.fmz.w,.f2,,.X, if Z-.fwg-ismmW.,i,,,,Xf,A..Q,,,..X,,4,,,fS,,:...,A..,.M,,.,,.Lv,,,.Lw,15-Mm-W-:W ,dm . W1 ,W-I ,,:.,,,:Q,,3i,,,5, ,,.,M...WAm-,,--y,MgmQw-H11mm..ff: .was-XYX-SKA-XV,-xxAwwme-M ,..,.,,,2. 1,..,,, v,S,,,n,. .,.,Zm,Mw .K is M.. Wm. 1,,. 31133113,11 ,,,,..1,..13 , .g.,,l,:,d,,,Q,,A,M,wff .7,3 ,m,.M.L,..vL,.L,, 77-- ,Y.WMUfwfww,.1,,..f,,'Sm,. ' SWK IHWIDFIHS-I '-WAS iff-Y-J7VfEVf Vi: '-n.:-.sztlssllwsz sw' Jrhwfwi? 29'wf'1Sf we tt1s:si1x1,1xi:f49r UQ: f -f -XL ,Mm Assz :ev 511 :1 : :J 5 43345 ,K gnpfefkfsz .2z,.fz,.m fax, by-V ,f .waxyLexi-sezgsszfxw: may 71 '-Hifffikifi 2::Z-527-:Sf-:5z's3zfs?S s z s 'f me tif '1 SJ 5511 'fQs1g4g9e2gsgg.sgfzs?sffs23?g541:f.Q5f?E?1QS!1g451g1f1g1?imf9Kg197ffgafHg3??:s5r5 igM551g5r1g5s11g5s1g321gigm:1 :: ,5fsQ42g,2s5S wig? 335 1-gpg: 31gm:rW:jf9igfZgig,wgsff'zqg2gg9zggfzsvlssvfmmwwwfisrX3P3g9g5ffg5s5ggq21es?2fQZ?c?E'f5?igi?i3513gJ:iw:4:SzgfSgxfS1if?1fZ?33f5- fiiisbis wwf ff fy: sv: --mswxzi. Usa.wfewzfmf-.wi-firPE' fx: qiwe21f.i1f,fz5' :ff 'M-iv11fif7fWW,Emu-.xxfie wusf 2953 fS1,1sy12g4e:1fssfs3f smswzissz'-sri'seams:-faxSW1591-Sirhivif-452x155 zifffssfuf 1' 15 -f2i4gii4f24: Hi'-iff?I-ifI-fi?lixf-fS?ffM?f7?5Sf1 iff fm wig iegssiissgimagizffgiisiwgslevrfagsw:eif?wfeggfef':wgg,,gems:rwsvwiiisflqmgvfi? :a?'Af-3:-.wa My i4gfzfs2ggsss1f2:fg?E4f:Hg:mfi:55fi,fsz-ffsflffgvimeif1wifigggggfsigsfggwfgzifgzfijjgkgmiggggigfigg:5553551ggQ2LgSS1g42545sgsgisggesfsafieggfeffifsf12.311 NJN, 1 Ling z sv:'zwlbztwsmsh'1nax.L1gy-ff Vi ll: WSW 'LQW-vzsrzxxxxgn'-:z'4 fl 7 L1 EEE? I g.,g,g??3iQfg5il DQ?-171 fu---V: f -v mi ixiz is-if-521 s:fx:-.154-1fc:7z.s2g.g553,333 3,5 155 gligw'-. 7 .waz ' xx51gggigg-i535-j331gbif?g,55i2,,E5,f-.1 Yu: 'f' - lxi .Psi14e1:1s1f1s1'Mi. 'wi fl UA- Yfwl- 7'S.Tfii:ii?5: ,vm-, 1, -f ,n i ,f ., -ff,,-Wx: hx m,,.2,, ,,..s,,.,,.. ,, Mx, . 3. ' .3 ..x,. MV A -ff' :mug 7- 7- 7 H , Lb W V, 3. 33 1, ,L -V -P2 -.A-:sw Z fy wi. N 3 .. .L A LfFi2f1ssw1522152H1sS1gg525jg2ziisgxaevggfiiggxgigwiyigiwgffv'5Q3,igQzf.eg5X1z:Xf1s2w-wifeif?4ig59s,gfQifggfj1sg?1g3Qif Ewa iaith? M5225sfigagzm2Z2f1g5f254f2Z52ig4Q2TfFGf?gsf?kffssfififfi?fiEgv3iizg42255Q21f is-E2ifQg?i2f?1s:,2Qiiiifiigigieffigiifigfy'1?555 S-1: is fwwmfawsfia.fLsKfXs.,e-suf,f,:ggvv:-,M-Mr.fwfswzy :Qff4M,gsw:1.w'ssfvgwf-W M1 g.zw,,vzzg: 2555515 Misa V-fwvgfwfaee.ffe,f'ms1f1w.bsQ:ife::fef:f'2 ww qlfw 'lfwffffwmf : ff:-wfffZ11fmf'w11fwfv sgisiiegjzgsfimigzw':efsvfQff21Mf2fWig-iw-ffm'ff'mmwi+V:-AEwa3gQ2?4Q2Q2QK3sjiP215wi5s?ibs?fjsfferg 322915 ww mzzqf, izsfzzffif22122:wwfHLsmsf'Kisff2sf2f11222MSf?2af?ffff?22?fF54?fii'i?imgwv1LsfY1XSAfiwsQ1xfi1hf?iQsSfxaa2gs-JH11-fl-gig?igiifffiffixiglfiggfwfgwiifg as f V , .. ,, . . ., , ,. 5 1um,1,,X,l 11 .7 If ,U-., -ww .,,-.,A-g,:gW:-Qvrwff,Myzkfk,-. Z.. L.f-,H H1 31 ,MM M ,MQW-ff,:fX,,1F,,W,,k,M: .M ,555-,gfMggkffggzgggg Mfg gmffyq :eqy-WW md rw mu-.fuf.Xiwsx-WV.,-221sxfffviss-img?ww' 7 V .ming fwm-1f::fw,w.fzf.,z1.r2zsF2 Vw' 1:'w-1 1:-v1fSvwP1 Ifvfwf Z ff'-TM Lim IMERVWww,.:5f--,1gk-my wi-vY1'1YffXY'W 15 f -J Jw -Mies-f sw vwS'1w '12 1'-- II --vLiJ4,i'. 1zs4,f1.x.ffrs gm- 132-11mg,,EfM,,, ,MgigfgiQgyf,,gZ,A,5.45,.Wg gif,ggQ,,fg,,-,W -fww mm 2,.:,--f-Sfgxzgy-my:wwf .5 :KNEW Hgh, M lQQ,gs,5,fz5,fV5g25QQfQ?2gf1N5W.fw1ty-.ew-M-w -:Sl :su,fff:,m,:U,Imamgxx 2 , .M 1:51.,Q'Lf3g,?ff:?5g'qgzUfw whims! ss-1Qf'gi,fw:kf:w2mIssiieshffwfw eewiislfifksmww'm?5fx:??w 5w:sQ1:f2v-H212 Iwfewz' W If1322-1 :1Q:1'ifffifgffgffwfw-W-fszrlwxfi Qi52gi5221Qs1ggssgs mwgzmmm 71 -wk -fiaiwgiez-wslswiggfmy-1sQ15xs:f ,Q,,gf1i,g2f5gSz45slgwmv. QE,,5,fsLf?s:-sg M rxgzlszzw-.0g,'snz:1m:d, Q' i N ,ii , www -Ln L1 mm :fl .ffl -Q5n,sm,,2,U,:,L,:am,,f,5,m5-1 .L ,,z mw X -ff imw.. Ku: :imw.:f:+ ww-ww --df my 1fm-1525:xg-rregszzgesfsa'ffe:ei:is'agfMgfQ5h:2M1Svff r1w??'k55 miiissgfgga ,vgmis fs zgsmgifsif. -1. -IQ:Wig5kf5'5WggfSY5gS5ff512 ff 7 ' gf' f-E -Hi,E7SXE?l,V33i'-KQV! Wlllsfiitiliiiisfqf ZiiiflitfiiiS.i:Li3if??7S?Wfi:Q -W -V1w1'5f 't fsfi7lf3?:S3f5 L 3-f'g,g3g3gg-319 I I 'I k k H V A gf'f:1'g55jSggfygg-Wy 9, gg,'1y,'gg,ggj551gf5fggfgg55f5,552S'im?-IXQTTPELIQYEQS1laiiliaiilxiili 5' g f,,f5-,'5-7'-X 3 2523523s5'i:!?i:1iifif5rfsfVfi3'f H1-vi? FW 4' . Km. 1-fmgkggfgiwszfiz Hz :Qfwggezgesaafmz?122132-gexesgszzgziigiewfxyxiyggfif'ffisfifit'Smf2zaz?1es3sszgggwv-E::fm fsyimf feem-:zf?z1ffzxgia:1 wwfigakzgsfzgygzufflashg:,ffm d1as.fs-.fax-:Qgpgiesgswf:wysvgag-gfzggwgyzgwggxfggs me fmg1gp-vzgyzggwggeggfewzffaswezf5ig1.2Xf.:wg.f2:4fsgv:::5ggggs:me.ggeswIfagusf1XQQQS1Q,QQ2Qz5gesffbzfksiifsgiwpHiw::g2gmef2fe?i:isirsggwf-gefg.,gg?eg14Q2f4QiT3 ,EXXQMQ4 -M562fwfsyxfizxfiggifswsifwifsfiifQ?5iSf5Sf2?x qw q,Wg11k,-gwugglg-,Tgg -g,ff-- -,,,fw-fewwzl-5.ff.:1,ff1g:1sffs:rf'4fg.zf1fr-fsww 1fm:151.mxf.,-,153 wmmss 16zA2Q,::m:mm-fi-..f,MiW-inf, ,mg-gi ggfgiwf-i 1,y4ffgg.:ez,fgQ-:wel -,ff-fn-:W-..Lg .ami I L,Kf,Zkf,,Q,lkV My ZH, f.:,,9,kf1,w,,kk i 5 .imgf fqsfzsf ,swg,L11,,kf,:f,,,.,,f1mff i ,WH M, ,,,i7,.5,.35Vi I ,Vw H W 5k5E,Lk3m-gin-A w:mf,,.: ,L,,,3,,f,,f1 ,M u fin Ks-4 sf2ie5v ,zgg.,Mg fs wie4szzsesgfaismmswwigswasffazwwimvfglggwfnariyssima gsm? .5s21g,ff,fLg: fmsiea f4s3sK9f?H25wZgz'1f5 2iff, ' fhifi:s5W?sf1?fi?? iwlififvfl' Lffwflfvfsi N ?51g?gfXK5ff2ggvff1S5?15s53L5f'fjE?fL5fW2i4?23f1s?f5f'Y9sfifiii'5S5VfSi525F125222545E?5fGigfJ57fs551Qs?1g4P2ggf2f22i5?4451Qf51VW'QWffiiifiigfiwfiigfiiwg'W1f2fWif1 ffff' --H925--QEEEQFEK -Sgfigfffxegl2S52H2?fc2Yf135isfgisfivfiifisffgfffbfg pawjwgggvgagfggg-:gmgilf'sygffffdgffswwlssfiafsgzssgwgsfggigssfffsqggsfggezgg-:qffgggzfgqpgifggqg15555253,ggglgvgzgkgzyyggfsgffffigigigqigrggifgfgfwi'ima4221-san1Gfgs,5,3l 1,514 Am QM, 512551253 ,L -:L ssfggrv fr-esp-. ,g k 55235452gei,i2fgg:?gWfg5g?ggegggegassggsf12213521:miKai-M?ffT2gfi2gsws-ZanEYEEKSWSE'iys??:'?'?4ei??2s?fm:ff?LsfS2'SW ff2f'if1bivkfsSfiSilSifi-52'FiVf5:eW?1Yi,VMI-PaiTIH75'f1Ff 5?1W5f555gffgfkfffsfff'-EQSW seg?fm-fg5?zgf?iggXzgwfiV5g??! 11gQ5QgffggsgifafiggiigggggIgigszggegzszgfi2-Q,f1ieffQs?2QK2X2ZsS5,5QgQ2S555S.Q-PImaiszrggzisszbgewgggg1ffgf2fU?g.gfgggz53g:?ffg22?ga.gsgg ggi. szgi 5 we giziiiiif ii,Zl,g.,,s' gg, fi wgs1lgsig5ggggQig5,g5,2zgsgsgigfesfsezfbss:asigwzmgigfggafiieg'iifigggwgsKzgf.sf5iggiggf21Qfgg.,iszggifgxggfsaisisif-?I ,,,m,1L, ww,,,U-f:,m.W31wwwww,,mf-,mxii,WM,A,ls,-vM,,l,,,,,,k, ,X W 3,-I Wg: LM, Mm W gm gg. -. 1 sl,,ff,f,W Zww'Mfg:w::fw:v:fwxifW:f::-fw:f,w-may,f,2:.:wwv'fs:weMifwefwwi:'S 'N-mffwflff'QswsfwsfffsfA--1:--J-fa-ff2kkfhw-fern-fffvl Mix,-Iffx1v12::fxg-fm-Mfg-ifg--I--If-,gx::ff:a,:f21:fe:wf-Qif1m?ifQ:wfassfvfvflwiffwfiv-Z-ffim-.mmso-w1w2:f:U::m:M,13141f1f,,i.fz,swz.:Mwgmffsx- wil ' in RWM Kew-wg mm -im amy: mms Q fy- -1.1fwishwsfyAs:-:mx.fmf15-1,gP1f-f-11-22145,-Mux'55,wifi::MSS-farffm:w:,:::fem-'fssffgfgwrf-5'-:HKse1f1mm:1fmiw:-rwffycwf wr: -ffwffgfg:pf:-21-rs,-sz.fez fmfwu 1:1 Qu ,S,vm,,W.lm,m,,m,,.,,,gZ,,f,,.W2,.:,.3M5W,5:,ii,mSw.fw,1fS,mm-img.w,:f,g.,.W,m11L,,l,,,MxL,Lg,,.,Q,.Mfw WM, 1 l,,W,, bm, ,fd W 7, ,M 5. M I,,wfkswwxiWM,.,,wf,-Q, M:fQww1.w,my:22.m:::wWfifwf-wf-22' K' W WIfwe-X1:im--fffiuffz wwf-W .MwwK-1W?W,,.Mi.,,,.,,v,,wfwi-v,,Q,.f--11,,W-ff-mffgwiiw,MJ,w.f1Ms,-swMWW1fimm,-ff' Wg:-fix, :ww Q: ,wx W-,iw W. fm ix, wi , ,715 lm ,-Wifqzsfm:-:wvfwiIlifwfwfwf-Sf:m::W:fw'1ww-www-P1121-ww w:fu-wwf'-'ffm---SWS Aw-f--f Miffwl- mf-L'v'fs-'ffifffiliafw-If-L51S35-'fgz''fx-mf-fff JwmmmWIM-.,M,im1,,fgXM3gm,vlgali: 1:fQ1.:w,.Q,:,,1,,m1,,.QL.W,5f,,a,,W, W M, W .,,,,M5. ,,,, K, W K., W. ,ii,,,,Li:1,ZM,,,,,,f,,-W.,,.f,,MW,AS-55,WfmmIQ:w:ag,LQ1.m1-Q-mwggs,-w,:es1fem:J..fwlmi-,M-fwwfwwHwwgifgi-.ww-fa-fs,-wel-L22,-fsmfmzf. .mfwmgw -,i,v,,.,mpfwzmfmwg.1,2ws? :ff :www ww fuifif.gmZ'-2'-21'-f2:A::f.:wq::fw,12z'img 1f,-M f-W5 'ming '22,-fzm--Us-2 , .mzmx,,..,,.,:-5,-M:H,m1115w:wa: fn ff, 6.15155-f.,:'.S:f:,M4 : 1 1 - A filsfsws-wfsfxsfvzzffwwz'fwk ffwfwf-ff, fwsnzfz :rm ww :sr-'fss-Leggffm-es 15: 11::m:.wwf11Wseyzsr-:sz f,.f1m5--.5-.gf T xii.,Amimfgwmwg.45:f,5.Sgg-iiwsgsy-my-fel :sw-vs-fes.-.fa--.fzw W my mf Q,HQ.Q,LX,.wmiivwwf-fwzwew fu 1wwff1,-fw, fs: fs, V- MQ A 5 H, W, iw.MMWY1-Hamm 1,:v,,2,.WE-my1Wm.mM mmm W, mf W immwwf ,L,k,,f,ffmffMm-M-W,iff,g.2z N, fm iwm. mfQ:'Qwsfxswflwsz is fW,1w1.-- wifif.gif.zX:m.M :mw:M+W-flgmfzg fi::Reef-sv,-imvs,,wg-sez-.fix-4 zwzgssfsswi12211292:fwfiwzwyffsw'wwzgsgfbssgqgyyuWaLf?fms11sf ies..f:gfgsf5f11q:2z5sf1mv,args--fgfgsfmszssfsasfszfzwzw,:m:21,-f,,,f gay- wgm fgQ5fQ.1Q-mivggfflgfqw-,H 5 '52 WWmiiw-wmggx,Myigsfwwgfxf,gg:,4w::ffiwfzaims:mwggfnewwfme:ffZzQswz14:ww:mem? U1 wifr-www12Q21sizw:fwf?s-:wi'ieewu1fK1-sf 552455-ixx'-?'?V?a?T7liW- W254526-Iii:lwffsf-weIwffsfvfsw fMffQs2fs2S 11:-L ---.fgfzggfg-w-ifg 2555252sg5sig5gs1fswQ:QimQieszisasssssfe ssQ'1s22f2?faf'gimw-13:-:wi 1.151 :mamfviiwsz'sez'-mfJmziwi- 'fs-igfiiwfss : 21.sSzv1fzVsaass.z5-:IQWfy:-m::f5:,.1Q, fy :ga ws Ass 'wigs ,Ia :Hzfgw455-zmg,,,w,gQ1 3 M1 ,sz fm!-f wg M- :-fzfsyvs.s sseisiffszifms: mg: V:-:,g+1-ff rzs,'4sfsssi.fe2:fgmsmzga:'zasffm-Tf'fWf fiivfvwesvfsf- 'W'SYEWQSS-fiilfiiiifsvfiMKS'-521-fivffifffiiffiwf4+-'df'kiff-5WPi'ffif1f?fi-Wfifffff54551452351 whims? Q4 :rf -ffwfy'-,fi ,E myIWmmfyximsw,-Qsmf,sff:-4-1ff-1v:.f:Qs:fmzwzm-:W if ,A 1 fQ1,:s,L:szf-fd : V--1:-wg' -:max :wi :mfza,-ffff,.zfgm:sff-ff:-15:11ff .gf :Z f.,...,:1s,M-s,,.f2, :s,f-:JW I-wff::ff.:H, :X,A:em.fQ,1w my fe,f-fifswf-swm,ww.:H-Afn fz-,ffvmw M waxy' : 'ww-fsvflw gf-f1:ff!:,f2s:fMMI--2ff'-f5m.ms,:fw-ff:1H,11'114::mvwrfwxizfw'ww3:1-fdsas.,z:sw-mmwz.fmfe-1fs1A1mfmw:1fQ-fr. Sfwssrs,zasgixsfifggsggyegiisfzsfafixsiiesziQggQz3gSgjaifafgifigefyeffgfsi 25:12smffaxes1fem225352fssiieiieiiiaillszIfiflffgsi22m21.151s mls?z,,g?ysPgafig5gg2fffsifgfglglffigg2Q4G2,5S2g5ffwmf2iQfff4fmf?iXs?ksigfffbsiiffyZfs522X2X28fH2Q2P2U5X2Q?2gg'62gcS2Q2ggQgZ,isgi:251gsQf1zg?2a4iS?giwiE352gUgi5fim'f2LsY1is2i15si?2iQ?'?iHfFRf?fgswiiviZlvffiwifsfiifiisiffififEff?4?2i1s?EffLi?qf3Sf3bfZf?f'5fis- flmii-flifi5fig5553555823WSf5553155N25Iif52?2?4f32WiNigi5E5W: ww :gg51151-fffffgevzkmimzkizgiiz fpsrfvf'famSsgr'2Xs1 -x2fSg2fsg2fmgeffxggmgibiami,-wzgwsgefsgegsfflggMy fm: 41.51 Q-wif'1-Q.xr-fzg,:z,gwgfQf,ggmi, any M2 51 sz'-gf' gfff:X2f:w-Mgzgeizgswffhswzesfirw'fffsgmfzwzgQz2f5fa:fz51212262 ififisfkfzgsbe iliiffww-iff lfzegwfeffifstiffwlaifMilf ww 422L:121f1Xf?fw?2xffixfw2sf'ixfQi' 1 fw ,E 3 -rw' aff -was zzss2i522w:gfmmf'1:s,g,sSgws'f,s ms:4Q5f2Q:f?mfwf iff Lfff ffifff'flfffsfkw-if wma-QQ.sfWa-izezigfsgifszggvzigi iigfgzzfmysf awsmimffsaf sf 2is?f5syfggfkiffg-fifygfiiiif22.12212'wi'wg-fgfifW'ff?iifkifiifssigfaiffifgffffiff ff5 11Mi1ifi2'1i?5f?'v321- is ZF? if F' Sf :ff gf qfgsmwiezfw-kgfwffsakwfle,gash .Mm1U,wm,,LM -if-,452'wz11:1-1-Q fxfsg-iz-n+,QfL.Qs mszfw QwzQ:.,- M: Mez.: Z . I 5 5 ,ffm 1 iw , :Qf -mfaw'swaiffeffef-.fm WW-1,ffz,1 aff wzfeff wwfsfwf I fiizf'iff'f2f11i1f fSfW if 'iffv-ffvfffffw ff-f ff-1 fffwsfwwl' ww- 'L 185:41-fkssm fmes:,esf,1k-2,efs..1fmfm:- zfgum :1a?iQ5mi5Zk gf?-EX!-25'QQ55gggefgswsggszygjiqvgggiggi11g15ig:5m?igmsisssggwzz225522,i57iagm2a'2i432i,fM55-2?s3??Qig9sgfezz251isaggfg ' ggi fn-isfggeggfiwg X5 R34-'2N ,gs5ng'3,,5rq .syLg-35gg,Q3ig,gig5ii5gf'-gy gyigsfigggafm,353w1g5M2Qggg,,m,SWfv5migggwigggg,wggggyz 53-fsim,SL51215531gas2?wx5?1g4S2,?5,:QQ2557145efgghsggrzgjiem-f7?zsfz?i:mmf?MffgkgfKggwgigsfsesjissiifelfsiu1ii??9z5?1!?!iWiXi53552v1ssfM2125fefiesgigii ijisiifiesiifshim V5-gif? an R.21-w,1L2-t-ifW-ws,fff.lz:s1fXewzFf-siggwwk-Www-wgQQ2,ggggggrQfw-gm:rg.E55 qiifm,ww-,m,, fm, if-5 5,155 ,wmwfgEmMy W, mggkggf,Q,WM5'H-Hywgfggggfgg:g5:Kggwfg,w1QWffiwfagsfgzffflxenewga:gfzwfgzsf,sifhslrzewfzwww::W Mzwsm.ms,141f1-,.1sbsQfffziwfaffixf-FL2-fvwwwzv ,LL wa92:2ggg22zfwggf22a,2-571532.212552fsiiiisffmffff,M1,f1.Wf21Q,z.5s1??12gfvzis2f5s2fXS?magm.1s+,:mg2ff:fMxf4frfsfgsxg'-fsmfmmf Q: , fi es g f Q, , Q gag? few :ma-ur1+Q-?fQsf'2sw.fffffeifgafsiisfmzffii'-if-ffmQswswf'iffIfifxrffrgiwfwe4521Ifwwifff3327251:asf:fsS5wff51eif1sif2ffffxisffifwSgiljfasfgisiiwgiw1S2fi2ffiff2ffff5fif9555?ff5i2iE:W''if4TWiMf1W:5ff3WS gs21a22ms:-mf1L3wea?Eq5EN??51f5i1fg5g5gs54-92452452wif..ga,ww1s:v4i2z3s?fggWigs-i2f4e2f4Q2g4Qsssesifsssiwiiggwfiggaifsss gegiiszgsszgwfggfepgffgggf:gg5 Q w 3 5,6 5352, ggi . . 5 1 ga -ff ,Q 55 ,WM 55375: ggwgiggqggggyfXgfig?ig,SE-Qifwffasifkis?gsZiL?33gQs5f5fggwzsfvsssL.fss1fssff:sfffs?:292145-f?fLliEi:l,if'53m:52liWQiffiff15i551129S2ff2ffifFfi27ff2l'ifsiwi:VEWVWifi-iifilfii:S21 -Wagggi1ff'-JIfY'f- fiiifvlfisvkfFQ45?lax-Qi-im5fX335?gs5Y1:F-iff? K L29 ,,, def -5 'mg--srzwskf-f 71f1e1sH'ff2vffP211s1sH21wf?sff'f:ss.sssfssisfe2-J--m.:xzzsaisssiz-lame,.i'--ff-fs,rwvzfwwwifg-EL.f.:2?zss?f-v1fff1wf'liifsgv-iizflwfv-fi'Q:-f'-113-'fain-:fmzziiixwzl.f1,,1fsrf'gf,-5-3gy,1'-:ws-5ws?-1,:fs1:f-,fl fxHgfgzfaspmsffw frm-wvswzfszkseziieiifs-Mmm-iw1f1v11f ff''-11,2122fbvliwffs'iff'-2P2i2Sii!S2iii22:frffiwi-ff--f1'fWf11 -'- --fxi'f:ff:'i WP-iiifiiffiylivfw-f'--'K--' , 2-ff?Wilffi-1iW'7ii' ig 72ffs?.ff, 2222514 gsvggmfswew QQffy?isfiQf?5ss??1Xi, sh a?5s1?wf-awk 25523gsiggffiiiwfeEma,fXamfw12 11fffffifffQ?WLif2531??'5f2fffHfs922Mif5L33E1f25as?fzfff2ff24fif25f5fwf'TMWSi?5Qi5isf?TQkfXf5?5i,:4-lfkmsmwvw in-1255 izwzifaisegfgsflbifvi,gaffsf'sifvfwixsvfQ21QjgfvagafggiggfgggfgsfLlmfiiaggsxfxfvQi555293fiiiyfii-Lif5fX2Z2S2w.2PZzsf155225iszzisiiaiisiiizi ,Y gf'-if -072:51 'wif ' 2559 22 Wi? if? 1iif?l f iff' 'L2g J f7? HfXL44K 'iQ ,f 52 sg 5?L 1 4 is X1 - gg? za Q ,Q --Wg? 5 L3 wg 55 21 Q is?2mseffgfmiggzgsaggspgyffgeffEggbigsige QQE1231gg535si5ii15fsggs:z:.isfifiQ2H1f:irgiifiibiggsifisivgsgi'-gswafsiafsiiimfiiffiwsiwma:1?imim55zs?2s2Q,ffwggfggfegg-iggzsag ff'if1f-if'ff-2f'fffv'fA'v M115ILFf1ifffisf1iks.5f'i:Ugg::A--.wgzfisi'ies-'Q,,1,wSs?fsivf52Pifi:fmsrsggf.zA,fstimfwiiffeiieesssexi-figHY-fH. fm. ' f' .J 1' i. I M' .132-..,.f:fes.,,.flwwffxf-f ,1 -- - 'W -A fi 1514. f: ,1? 5 'iN 14vffs , f 5:,13?41f.fS24:?if:ii7e5iffww-S1124e2?4i3viE1:255514:51'142-w'2vffi:i55'i'igiiigffiiffiiiFwwifmsfw,flulf-fHifi'-25212fsi11ef2.'ks1fgwpff-,f.Wifisfi,siriisiiiiixiicemx wwf- Q11 -Cgii ,fzfwagi x 7 mfgsifffmQas452-w'fmfzg11Nrg52'fffwQfizssifgswifwva1MgeqQ:g,1f-.fp: ,Q ,Vg fs,wzmfMwfxf--.kgwggwgsf-f,M,Q,wwwMAME MAg,,-awzsfgif eifaggifasmw gkgfwfef sms-11522232-.21faiifssyfimi1asiw-swf?-lhwfnfsfmmfwffffps-K fs1w1--2f1- 1'fi-:mgMiffes-fiskigsvwffk ik ff is 2112822Qf1ff22f12wf2ff2:-fef'H-fl. f1rs?wzfQaf,rzfaetEi.,wfmI'fQffw2gs2zas2w1P2U1fQffvisgazgwgswgmfietfgmafwmy,gizfsfm gmifigie-'si,'svfw.' 511 wfwggfsfsgeg5w,L1,ifz,g21Xz fmzlgglf. wwf-if-?'iffMfffv:?:-wg'wessvezsffisffizffigsmw'1211Q21'fQ2Sf32'QaQiff15214e15fss1fQ2igs5miifQfs5swei'1:ifieiffisfiigififiwkxfwswz'snafzsrifwl'V''ixsfw.QWiff1fi:fL2S232i?fSf?fii hfffifzW'fw 5isKQfg532qLg5,Wslgspfgmq-ng,,V,fM.gv3Q,3x,m,,,f,w:fS:.S2f.:Wmiggs2a3e3i:,img-M riMuff2,,5,fm1m,gv:aZ fs,.gsf55fi521f,Kq,5:f1m :gm-1 ,,f,,.swjwse2f: ,QSLIQQQQ :lx msszisi --,hfwiiv-W-,,,:f5ff9,,1fm iw -,mf--if-M mum- ag,-:,p5ggsq zgfazw- Q::gaymi?,Qe:,f1wA.n:-.235:f-:Svz1kwK-ff'k?3f1fkf,m 1f3:1mm-:fag:gfggzisfwf-e:,.sw.sQm15411,-5mPffw-SSA-12931:ffNy11wS11Sv'f1fffkhaw'19ksf'1f 1:5ff:fH?1f3if-swfeff '7fy5?5?i5?'f7iWWfi'Nl'f'lfgffffwF15--M55'PfRis59ffs1?ffff?HiS7i'ffifiizf??Ei37ia5is35Zg1:fEA51y5'5if7if5755?Ai5iZifSUi?5L'5'iiiisiz5z'i1142wL1!211?5 f' -1 'I :meg 2, 12? 3, Q: 1' f' '11, is ,mes is Q . 511: Assy' -as 5 :K gygggfgggfgafzz:f22s4a2Qf.':5'vTg?5-391sssigfai11553322,ifgfgwgfe-ifeqigwfgwggyifgmgsfzigszzieiiseziiiziimsqwmy fgigfggigggifiwz'f.1l1gH.5fsyiif -'i12.'w we-,ami-J Q33.s1+fg5?sg!:,f1sgys2'11 1iemisigf2,laiisiifgx14e??imsViss1f4g3g4sig352553315,:1s::15s-lam:.s1:.Wi55fggSg,4g:fgggg4gM1g2gy5sQ1Qsfz,sFg,.s,g ff, g f,,A.q?ggz , SK 3 Xi 1, gi if Q5 5 WSW sw H ,lg lg in-,gg Q? i i Qigwwzgg-fggwgggmfz',afiefigg:5fe,:w.:yffgsffgf-1sfe1f2nfww,-wefsms,if1wQQ1z25gfwgLfQsg,fQi1:fwmm'-ffffwfzfffgmzgggsfwswwgisffgfsi:ffs y:35::Lgg,g.my:1g 1gL,,H fggf5V'gQ'w 71Eg5,1pgjg5gQ,5g21gggjgggggggglsgz.,Q HsmggqgggfgifiggvzggtggxgzgqfxlgtLgizigsyggjlvzt'fztw 4,155-lgglfgfiggqligffiggw S 7 -'V -- -- ,mf 153 rf 15 W- ir 1. s gk 'ik :Q U My j- -57 7 M, 91' 91,57 A N rf 'Y j jr ,fi 2 153155 :AsHtAsgt?1ggj1g3kga'f'E7'?EEi!5ifi':'isi-wi-'ij if'W'iS'Qfiii?i5f75if4fi1Ufx' fd 7 f '9HSi715Wl1QiI'j1glTYiitxisf3ii3?fif3fKl'7''f7?73L'31Eiiff 551: 29.159Lis-Qzanlxmssvlfd' 1? fyfyfg fi, Nfl mfiwigfggygzf 1 12,,W,kg-,ffvgkmgy,ggfgmafiW,,iffffgwmgiii,MSMW,si3,,gi L,,M,W,15gw5g5,W,i5g3w, 5, ggeekiziwm igmgfg-12 Z:QsgW:fgm,W, wg, 1fW,w,Qi-zsfgxw gm ,3,fS,sf5m,zgfgwimg-mfff,falggwWwe-.gieifgsizgsw if:egg-fi11,s1f,4ffgsw Qimfmszgszgifeegfisgfzzwe iwawff-fe:-ffgeq3-faggf:-gggwwiifgifm:msFzgsfxggfswagrpfggffggi Ne:fiivfi-w?1+Wv5isE , 3gEgf5Mg-kgqggag. myLg5QslU,fsQu11w111gw4,ss,4.L,,wm55Ql5fef3gfzgf-ufwg:11ggsgbmgfws!Q5Wf22vfasvezbggggfgggqzggezg-, qwMWHM,,,Wu ,,,:f4fsf,a,g- Q5 gag 545 if:g5ggyz,gw,552m,fm1sf1Lg,:rms 1wfs1Hf4zS1sm ff51Q,gxsgwgesgesyfi:f74sf11z2f1,fQm: wee:fewlsififsiwilifgisfgiiivlfsgfhr www isiv:fsfWwv we-if22sfaf Yfi???s5f35955fW55T1'Tf'7-135269 652 ?XfA'???i?iV9 I '-K-FWEVLSQ P-1 'giidr-14f?T' f-Yriimwnffaf? ,Qs154Q3323Yia?iQi5se?ifsSSS2gJHlfE, F '1,Qsszfisi.196-Ygieigiiffazgwggi5521535325555,m,QL35,EgQA yggggggvgigffagWL?5-Wag Z,gkg.lg,eg5sg5qL.g M333-gvm-ugwgyWy?-Sf--Sf--lgflsmgssx3X53gsqyzgsssagfzggmgbiiIfff2igs?i93f23g5Q1gf?w3 fff2ggPf,sN,sNiy3y,gaygg,,f2,gQ1srfggrQ3,g2422X4?2,isifQMimgyggqgggszggfxgisf iss,?st?2.3?.iUg42,44Q35ss2252s??a?1si?Sgfi22?1f4fS?5f,Qi34is53422YZQ3f??E52SE55S2J4H2f3:s?Qif?g?ssi?LifiLi-P-I Wiigyffig.,A-',??g33gsfZsm3 LQ35?MMegL 'L-L52-imma? Eg! r'1Qfv1-was12,1Hifswzsewi.zfkfifieffwsfiW:mfg,5Qf,322z322:2?fxi2322232525325iwwm:Sm1g,eskgezszgswl,gglffzgfmwrzseaisrlb:age yggw 2,055 W :mf sf,,ff512fwsr15,x,Q3lffggwgqgsgggsz enszggsfzgsefxsha,asmswf1azlmfagsgff2f,ggfgfqamgsaWaneewfwzMywlggfsfbzgwzgseghfs.ses,4QQ22wfa1x.sf2m412ffff2?'iQfwfwfssf-za1'wffsffffSiW1Mi2'Li?1IMif1Qfwfum.+5V'-lagiwgfifffiffiwffii'iwfxiixilifxiilfgFfwwif 51,myMfew11311fM1sf,i1ffgx,f,1f,,rifafggzggfzigg:fiww:Q:::2:3fsWfmQf-Kzafffxssmz.:Qggfzfxfsfgsfgg-QL,-.L,Q2w,,yav:.7gg..t5gs,gwgfiW jg-1 xy ,,,ggbfye5 i -wg my ff gxwwffggsgmmmz.fm-WWQ35?qgwfgggggggifsgflgw-u,ffa1giM4wvm,1:.fw-:wr:gfgXsfwz,sQ2izfQg,sffSw45191pf?w,fiQfwaffKz4s11va125wa-'NK2T2Q2Hliffisfvisfwfwwfwwfwfffl'wwliwe QQ,-,W-f2,,w,.fw.git,.fNA,,,,,mm,,ww1?,M,Wi-Wmmme,sv,,- ..LM.1W,1,,-M 52 -M K wa ,M 5 . .W ,. ,W X ,W Mm,MZ,,ww,.f.W,,,,.1ww:,,5U,Z,,z,.fs,M, ,Qif12,1W,w,.fw-fax-fax-.iw-IM,WfkgfmswM--MM -f -f -X M'.WvwwHw:1fs:::swuf-fW'Lf2ixfv'wfwfwfw-mfV- wr- Siggf 'fi' ew M- if? 4 2 51525 Eiggfssif is 3: . 1 5' fww-w-zwvfgwr'ww fwsw fffse4swfs1Qf1w ff2wWqf mgfwm,gfgafzwfsvi f I+: . :Q ww M 1 fag 5 mimi ff-f27:wwf,':ff wgPfssfmw::m:fss: 2 ,iwgfew-1 wfwflfwrffwz A-1 A gsm ww: 214 Q-ir: 2: :www wffiwwlfw'f,rawffeffwlsxffw' 31555455 z5gs1XgS?gg:2ggg51gQE55f-2,547 fgg gm 45,fgiggfggffgimgg:ggfggz-:f.?g,5,usefxif4g?5fe2fs.si41z1fees seep,ffg5iQ251ss:fe'-s133ss1!?zf:2figgi5g-:kmg Qgfygfgpe 12334541 :siQ5ikg1i2ff5,gfg?gggggggggggwggfmq :gqQ:3mf2z5ssg5s,5-if-fEg,!'ff2,f,554,,Q5Xlp,x5HmLg,fgw5.55315gg:f5gY25f25g2safw:g:kggiwgwgiggfgfgg435,.21:Qisgess1fa?i?'k1f:5'215,5'zwz'4SsaQsxs?Qd2fg51f:5ffaf?zfs?i3i?1isskwasSSf?V2?5?iQiff5k3iv55'iswsi?l63fs35Zgs51if5iL2MPS?fiffiiifiifWQEQif3isiW??':W:?5'f5Z 55'995ffU?f32:f52'1 effsf4mg2me1f5!QfQ925!Sii:s1gg?k.?i?efw1. grew mfwgw K-f'wessf521.:21gfP:m521gfm: fifgwfxiiasfigsgiaiias.wzglvzggii-21s-ffwwf,Plfsffmfffs: seiiefgwf1912.52-Imzgfuefkiwef!mi-fs-'fws1fwf1f'if11f2 wi if fs? Us MyL,fH:2Lgsw2:4ifisw:fewikf'5wf,, wwfmv2Hff5??ss??i.:sf2s2f1Lsffg48i1km: MSQSQQSS ff4:fif:i5fw1f1fvggfgwgais22wiMH2g522ggf2g53gf'gf 'v1uif:Mf-131-Wgssgswfggsfglefw:'izf'2f'w:::f: f-ILSM4zgS1QUr25bgW,mfPvsfP! wwwwf' fm:ww?fl'-7-Mmif-II'gswg'ff'ff+fwffw::fw-,W-mmm:.lfmmfW:f1,,.nM.wf-.,lm. , fag fmfm 55, am,iiiim-WW-gm,Sammi,img57 ywlmfiw -ymmgm 5- W .. W.. -fm -MW :ff,:wfMfws1',,sfww- MN-fxz-mgfQW-we1'191221lfgffiwfwfIwi-Ibfwww'ff 'IX' WMM? Ky fi,-. Hmmm im.ywmmm,Q,,K,,N,,,.L.,:WNWZfw,g,-iW,-k,S,,M,w,, W,Mi,,:,,M,.:m,it,,. 5, -,,,,l,-M, ,G .,M,,,,WM.,..S xf..W,5 M21,swzjwwl-,f.-,,g,,3f z 1-1 iii: Q,fm:Sf,+w::swfW--amHz:-wwfswxfmfM-fs!A A 1-ew-fef':::f1m:f:w2:w1f'11 lv711fwfflevlvfvffssffxsf wf f: 11 xpzfmxugggwymwvl ww-V:+,1:f,Q:,Xg,Q:f4,i-vgvgff1my:f,,::1f-ry--M 3-u,,f5,k,kf5,.,,W-,Q-W,5,,m,-M.gqQ:.3 5,5 wniw- win, 5, mg, ., mu, K , in gy fy wL,,w,-wfmiw fgzw wg, V -fl--W-:wwf We .Rv mu -- ,-may15:fayMf2::fsK112ffm.f'f--Miva'-fmz Z1-H,-:gg-fi-ffzfwrw,-fsyrsef'rwf1ma-wszwm-ffswfwffe:'Swlwkfwfwfv41Hsmswma Z. f wgvgfnwr:wwwmfwgf:1+iss,-M,-:Qm,v:gg1mf:my:M-.mf,,g,w-,,Wggfgsygw,I-iQ,,,l,.m,..v,w1-M,JL,.., -1 ,, W 5,5 , F, ,, ,1 H If A fy , i, F, , ,,,,fL wg 514, 3 1, fi- .f- . A v- - ,M ,um ,H if vs-:msg,:,,:f2,4w.fKg.mm-,iwg--f,--,s,AmfxsmyVwmwg-f-My-:snfsffew-1:x::f,:1g5f'g:wf:ww1ff2:11Q11'11Sffvssivlni-V-fm-ffmew ,V -fff,,f1f 1, f.z-:v,L:.W,:,M-L,,f.Z: ,LQf.,.mfw:.v,5,T,:mff2z,fez,:fs,:fmWgre, LX,A.xz,:,f:WW -wx, S,.,,-,gk H 1 'Q Q me: Q, , , 7 ,A ,. 3 X. ,. , M is mkgx, LX, gf ,i zz S, z, my 5- fi H' wiv -M fffs-1'--M - -'fffw-:'w1f+1w'fr-'fA1PZf--ff-ff--1K'--Xf-- '-W ff'f- fk--1'-WASH-4--fs -W -fwrf:-wff:1w1 wf f1m1fw11 S1 1'-:ff--ffii,ff-fww--ff-WH: A ,.,.,.,7 A 7 17,,,7 M. 1,1,,. 11,,,. W .. ,. ...,,. 77177 , M .77..7 1,7, - 71,, F .W 2 . W A Lg K, , fx ,, , ,, .. ..,,..,,,. ., , ,, H X . , ,,.,, J. , , ,M ,.,. . ,Z , f ,-MS,.S., W.. ,,.. 171711,1. 771177 . . ,,,1,,,. m,.3,,L,,g,H,,W .MM A W, .MW-Nw W -I wg-I 77 --fi-.EiigXwMWf,,3fW,,.,,zL ,,,:efm-W'fi-fx--Lg,ASK. .2x,..5,,.,,UzA.ms3,-M . W -f 5-.. ,. . , ., ., , M Q 3 ,, ,, W K, , A. . -I f LQ ,iff ,M A,Mm-15,-,,iW,:v,,:a,Q,.LX.mLf,,.,k,,,. ,. -195 km- ww:-:---w-Sfi 1.771,7 mf M. 7 ,Af Lf H 7. Mmfm 1.771 7 ,. 7711 1711. ..,7,, 7 ,.f,,M 1,.7 -M 1771771 . , 7 M, . 4. ., .. 7 A - 7 7 ..., A . ,A 7..7.777 71,77 M., .177 17117 7 W ,.,, ,7.,,, U, ,.4a,,,M,m,W-W, L,-.J-Lfsz.m,.fXK I- -M-W if Q -f -im12ML.a,mWfWffgxAm,wg:,4f2,m,mm,sH-.QW fm,fsA.fn,--H---W M ...,.w,X,x,-,gl-,,2,,,,,,, ,..,,W ,rw L,w,.,Wx,,.2,,,:,z.fV,A.,,f,L,L,ef.,.,,--Uf,,.w,w:Sf-fmW-'Mew .fs ,.,,,.,,,,Ax,,W,v, -Msg'-swfffy11-M1 MW,-5 fA:.41:m:Q.fw msg-my Wm- mm, W- :Wm V: 7 1-.I,,A,W,A,.Mq,,ls,,,5:v,.,,u,,.gi-LW,W,M,,,,,M,M,R,QS,v,,,,kM,S.5Q,iffm:.fix-w--ww, Q Mm mm, ig16,l,3,A,,,wgfy:M,.W,,wzi:.,,,,iK,,,,6S,.f,,.:X,.a,,.x,M,sMy,WW-wmmf.fff, -gal--V,-www5.ly.QM-h,,fQ,-fmM,w::1M.fmsmf:2f,fQQeww,ww-axfwgiwfwVfwfvyfw-:Qwwwyffl-ffw1fw2Kf wwwlwm-U Q 71 M mf.,ww-WWW5-M,f,Mfsm,wgwsmgg'fagwfXf-fM,X-,:ig:1M-:1bg:f4g-1rq,f::,:v1fw,gifQ:fLmfQLf.,7-QW,--QAW..WWW, mx,fmI-.,VV,-Li?wi,-ins-:mfMW,.MZ iw,My,,,q,,2w,,5,.,1 -. K,-:www5,5-as.ww-.xilg,-1W::wwx111w:l-ffzrwwifiIgivwigzf.fw1:m::'mvawe2figff2w1:.I:--W-M:'Qwf,ifwf1Q-'hwM 1 1 Q4 -5- ,:fwsfwg--'ww-'fy ,,,:,L--W 7 - 7 mg wwgmu-.fsz wi.,I--.ffmiw-1,5,i.s,-:eq ,,fiM.Wxiimauwff,f,,,Q,,:.,,:.vU: 4--l.,:fm,,.f,,,- ig, .m,,Lm,,N1 mania ,J ky wfg,,::,,52, 9,,3:,wi gg M:w,,i, Gu 7. ,, i ,K -5 -,4g,,w,m,:if:,. mx, Lgmgzm, 3 5i,f,i,,lW:gQ,,y ,,:f,1fN-i-. zfg-WSW : fi.,fi-ewwas::mwgzfgglfb: Mews'fwmwwi ,sfwwf-:Wg -fs!-fm-mi AQ f -:V -ww W .wink M ,. f,,fWm-:,f-:W,M:, .M f M. ,xi K xi.z.f,-,Wmx,-15,WW:4g,g,W,,,i,.WzMm,,V,,,.,,m ,AME Q,g,,km,.fy Mff,,q,: I i ,X-A,g,,1g,-ig, 5, N, .gum .v,L,.m. 7 Ly mm, N, an 7 2,,, fb W-Wm,gwf-W1 fm. w-115wQw--2f-- f-f 1 Aw 131151151 Liar:-gfzfgwy-ww 121-:Kffwsmsz '1fwsPfAfmw,'fsz :sm z::w.-:www Iwffffyf-27 -M ww 71 K1 11 Qvwii 21 If-. zgfw 1-fum ggILg512Eif?tQi1Q51Q255Q2gf25ggs5gg21AsPfL:25Q,ffa:iQ?ff-M- MW WWII' fxfIEW'-Mwflsf'Wffmlfsilffcfl 1-ffl-fwfSW'N'f W ' ' W W U M :Mfffss .,Mwfg Hgg-gqgqgggfzggsggigggwfggyal,,zgyggggjafggjpif ,f 1- I-f?igf2igtviXf4esissKvss5v1Sfg,?zig5m?1f ,f1,,,ggz ig,-if mm ,Mm 71 ,,,,-,, .m,Q:,5:W,- Wax :Swv .f,::,, ,I :,.,,,w, ,rl Wwkg, .Wwy .5 11 :,w If, .gg,,AEf,gq gwy:Pgggggggf--13,1,Q .f-, Nw ww, :fm mg fm ,big gg: ,,ssegklezkseslsesmferns- ww wr sie 521435: 'SW 6 fair :Lf 'Mani :fi2iaiiS149s11ssifesPi2122425'55 1Ls5i5i,fQ?i?EMi3 'S fwilfgff fi?f'3Siaf?Enf3E5Wi5Li35V 1533235 Qg1sc22g,gQg5e1fsfg-L gem? ig 555lggggsggggms2zXi?ix??as:Qfgfwfifw 'Msvffffgsffgsmfii 1egzghiigf-fgssggfif,gQG-22g2f255H55f2L:225pf2Qz?1Qeige5gQ23fQ2352Qagg22442z52ige21S2b5I51ig,3535351g5siK20QQQj223H:fig5QAgQ23g52fg52ifggvffsfsggsggggafggifs W' msfazgggmgvgffggm:,QWfQ25Q2fAe5145H111s2g2!QfgiQf1?:fgigbs?zQse 2' :i?is2if:ms?wggfv14?222525Q55g251fa2?1x-?ffaw?gswz25fswiffef' 52ef'?fi'fiefXfA7 1w?W ' pmwe Qzlgim -WWE,,M-,.Mu,z-f. g. Kf,.XW,,fmi1mwww,:Wg-w,,.1W,f 55wfv,xfSg2f,gm,yQ:vW -H -igfw w.,fm,fi li, ,,,mi if M.,WX1igX,3y ,QXMWW,W,M,,,,1,, ,x,,,,,,,,r,,1 W Mm, WW-.,,,5m -1541fwm,-W,.,V-Ji. -,181 Mm-z,5g ,5gf7,.m1-11,-1MQ::gzvvfafgg11fg: 14 ' w-ffff--M vfmfbfm- Mffwwm::wv:fm me H. 21 mmf mm www: V V WWK .,,3WmWm Wg, ky 5, 7 ,xx,UkWl,m,,,M,,,,.KZ,..,,5,M ,,,l,M,,., 55, , l,s,,m,,m,5i,, My ,Z L,,W,,.v,,:5,,.5g ,mm-,T -W . z.fg,.,,M,2,,,,W,Q-Q ssmiw:IH,,,g-WLz,,w11.W: - f:.,w2::wffwffmwi:fM:w2z:f1::Q:fm, 7 ,gg we WMM-lmsl' -sv -f rw ,Hsfssyx fwy-wwf: ff 7. 12' U mm-M-ffA-m111111m1fwz.vzsi39fPf'k?W1sf??ww-wzfszifwihf.Ezszfmzvvvllfww SfP1v-SNP'---1:1 ff Q, fx sez-.sxf-.gf-ff'-1,1 S31 -W-ff--:w,z.w W fs-.ferewzffsiimsw 7 ww f2m?5v-mf: - M153 1 L., W few,lmww-5: ww1fzf'17asf2f?f2zMk:-w fwz-.:s52:w1 2,.1.11:ffm3!.fwHK-2:14122fse,4seiis2Zfx1wilswfffy'fwzllfwl If Sf? -v 9Wfff is Z-252121 wh uf v11w114f5K s1'51H-SW ww wm1,,fmm.1 MW,gg,.,---. A mwmgsggwsgw2,,.4,,m,.L,,,f,Q,v,M,fWLv5m,vg,,,,w-A ,,,,-,W I- Q , W ,lf if ,L 21 if ff Q1 Q2 1152 w.wf,1A qi, M lg Z, Z-v w 5.m,f-M51ww?::,,w:g:-zsagsfgwsffw,pkW'wefff-vu,,mffK5Z, .,1.-fimw-Q,M-M4225-Qfffffffgiffsfff,weM,,Lg,7- 11 Zn f wmm.Q.1.MHQM W,LM,,f ,,:,M,,lgN,wziifm.,,8:,l,:-m,,f,,f,. W,gM,v,,,,,Ji1,m,f1,g,w.f,, , . i ,,lsm,, ,K V, H 1 LS ,Z ,Z we Q, kt 5, 5, ., .E it i, hmm?Q,,Zi9,M,,,,,v1,-vp, mm,Wlgg.mgsH.fgwfm,mw-N1,Q-v,Af2M7,WMM,.WQ,1-Nw.--sfsxfww wfmsfgf 7-as-1 rw -.1 W,-ww ,ML,Q-v,,Wg-mam-,2z1:.,,.. f .,-,fl-,f1f,:,-,W fwhigfi ,A,f,f,,swz:f mn 4,l,,,, ,,,, . f,1L..,, ,,,'1M,,,,, ,W ,.wWM,. k M,k,5,M, A ,K , kg, ig,-fgmf ,-:,,XL,:flg:5,,:fX1 MM 5.1 ,qw ws4w1,1Xz,Wx-my -fmsyffszfeez-1.mff 1. 1- 1 .. www: A-Qu :,Lsgw1Qm:W5:Xs--- -- -feffizff ,L Aff K+- Z:fuxgmmf:W,,ms-m2l5,Xlb,a,,:zlU- ,, .ezkfmfww-wzy we-.f11ffsHf-fvf:1f1fs ws:,fww1Hes-fswwlsgqls,,,vl -fi W- M ,,.g,,..f,,Lx,, f,,-v,,m,xg,Sp- fax-422-mm? fbffwgmwf fwz 49- :M :SM ww: fw F- 741s:,fs1fff--'wh-ff' 2' M-f.,:f:X7,1mQ-www s 7 3-H ,L fmuww-ww fl H ,- f- ff -'ww ,mu,3,-2,v:v,zu1m1r1s1es1'esiiai2Qmzfaazffgiiisfffgsiigsfwessissgsvzxmfgffwiffiiffssffsfiisffsvszsfigvff:fpwgzW.W,ff :M-.wwf-W-af1:sgfggg'ggi-gg,gQ,gKgg:W.:if-,,5i1,fg:f3fg:1555155155-Agfqggggqggqi:,x,::,,::,, ,Q ,gif-,ggi yy in ,M 331 in .smggpgk -:ggygy-:,:A.,, -v,ig:W,Mgg,ggggM3415QL-me 5f,1:vm:f: r:gm,9zss,fszsisiilfggllg:fe,falzissiigfif4 w ffg2 fel? fffifwlffwvfaflffQ1ffswifvnf-:LM-fi-:'?T1'?y iv I1 -mimi.Miffgiifiif'1:'1 f-k-fW-fW1f-512 Y iw-.W,iffmsmmmm-fwW,,,?. M,,.la,Wwfy,fm,7,fWgW:s,-'w1g2,g..L1,v,g,f,Q:f-gffiwlgw,1,fgs,:Qi4-Wwlf,Ez W lm-W.m.s,:sxg:f .QW--:,,el :I..,,X,.ff,gz.Sw-11,f fww-fylifwjfg.,ifmvwlM15-W fes:-:sw-Imgfww:-wWf-'-Lis,-ev 1Wif?'ff?fi0?lf5?5f5fi--'if'--35 fS5'1W1 if Mi-fe-senses-rwM' ww mmf-fyMwmiwmxg-A-WMML.,f..,,L,,WM W-w,.k,,xgffxgvfxgigggf,ww-15,3V-2,-,,a,-f,mfQ..,.2m,A5,,5,L,,z,,,l,,,,f,,-Iwmi fy - Z W: , if f--, -,w-:.m,mwmmgfwswmm,-:Lm:gzzwweizWSW-2::w:1wM-:ffm-isffwfwiww-:fx-1M112-wgwfgiiigrlffwffiziw M-wiv' WWif-Mf-V---92'W-fwif 1 ww iff-WNW -w,wW,W,gyzg,g,,,Wiiw? fmmU,wm,ff,Q,4,2fSw,Q,W-Mwwf,gg,rp,5m,,f,Mf1,fL,:gv.1w -:xy-,,f,m,m ,lm 75, XL W ., W W ,H gi , , ,K ,L His, miifmg1mfqMf,m,Qz,-1mm-lwzvfm-Ff,w1Qmw'wfwfzMe1z2z,22zQ1ww:fw-M11fiQ-wsfiqszzsfew-fw- 1 ::.,,:f,'-W 4f1fMww-ifeins9mwfM 1 H14 i ya ff ff- N11 ww 11- -W www' ww fw-fw-L,ffm kiffm::ievfQffw:s::X-U mm-ffm---.wif :wwg-, WMNW- if ,f.,,i.,--if -,J i 1--.MQ 1- :wwf 7 . 1 , Mlm .K ,,g,i,i-W. 1 , 1 g Mm' -WM:1:Mywa,Qwaffg-llsfw, :sv-wfanw. ww-wwf:-1 M121221fsfffifff-:mfWHW1Iffeifwwz'few f-f--wffz-M1 fl K-1M-f1ssMs-fs-,wwf my zwmzmf -1: ,f 5:1 new ff If ffm? my is fawmfswl,-,, :ff N 5 im:,,-,:gp.if97Lm,1mm,,f,, R991 Amy' ..51,,-J5,,l,, mm M, gl, , ,K M, ,C 1,y,if,,,f5, ir, iyfgw, fs, :sw ms,-,Xl-,Xl ,isfwfw fwyifeze-gqkfggkw, m1m,ei,,Hl ,. swfzum-w1.mf--.wsf ,SU1Qff, wwwr191::m1x2mfmsz.f21 wif:-1-: 1-221 rP:a:w-:ww f'kwHf2vfw-fm-Q-z,:wz.f ,Q - LW-if 1 4 -1: Ifeswifww eww! 42g5qgQ2gszgga2ff1g,1yfnesifssiigsiifz'gg-g2is?fisiLa5fgagww-E,gf1gg11a'1wssgg1Mggfgggfgggizgfggfigmg-52?iMgigff.51m2i422523-222:21f15gQ.iQ?isfkfref4X212112: W1lflf-fiffgwird?'55igi5?n?Zs?7fi54 . ' 5?fsfmfifqfvimzgiwsf,g,wVgwggggQs?fE??si??5iff9?lf5l555gif5355?f5f7f5?f53i5W5mms?I'Miamxf'ififffffwiiifffW5ii?4SS53ii5iQ?flz?',i'fzffQsP1i2S12fb2i4iff'sligimmwfa,-ay.gg1.,q,1Wi.5g,?1g3g3M1-5gssgsssigsiiezgz1'jmy5,g5fggg mai!giyififgfsfv?:KfvisgmiQ:w1st7fQsW,,M,QfWU3figSi.ffis-fsszvii35.23gfgjig5g5,?pg:55Lgf5guszfsi?sez5s1QS1,gt11Rising? if 141234figs-gf5,1w1gxfm:2ffmwasMsagggfrfgszfsigsm Qfzswssaggesff fvwwqs'f5s:fsaw!sigfggxv-gfgwxfm-f'fmsbmifszgszvgszvss,:ssw2z:zgf2f22H2452fff-fQfS'sfSgg221ff:w1e'wa1ikf525?N1f?21'22gg2gfiff.ffS'fvhi1'gg-A3Wff1ffig,giifffS5?24f'kf?Z221'zmglbgfifiilfir'-dz-fif'fSifQfW2QEsWL-f-Agsgssggi 555157i'i2?s!V-555553271 511 Wifi? uVfiiifi7f'3'f'f7 ,L 'Wiki EQEVZQEYQETSWEE 755125515 ygi'-giggg' !iiQ59i75:Jg'y Egg jfjwjgggwfijagg.,-it-g,Z-:g5?g5.fgg'f3g j5gi',1gV, gp1,:g32g'f,fg,fg5g gkgikfggif -1 5. :lg .: Y, 52 :X 3 ,- .ygigx V, 3 ig. is SEV 5, gg 'MQJig:::V5495,g5gxg'ggfjjygjgjfgifgg:w: 55555,gggqjggafggsgjfgg'5g?fiEX:5E Siiiijitlfjjfgf-fg?E7Sf'ST.iiE.i:is'lkfrrfvffi55-7'ff g:iii,E.!3S1!F5f5!iff'5,f59fV?f5'5575-Qi5f5if7 9YiS3i5L1'b5? 'islwifzii 15? V- 5-ff5-5f'fFf51f5579iVf'LfFlz :gy will V7 2ISf2is5?fi?R2?'52aTisfS24522f?i''W3423225224iQisP3sgs23gQH2ZS215SS2Qiffifwfkffififiwffsgf5222521 :kwa3itQgiigfrigeafzsrfziwfismf Qrefi5ss5ggaqggXfXfXgg:s ,I ff 22 2, :Q -usgfb beige ,ffg 2 .gw-EWpi,-ivgg'ifzssmswzsf2mgf232551Mgqfvfwzasssfiassfi1fmf??w??me21,smEbfiiif?2sfQf5?2iQ59iiigsfS34??i4Q?3fi?2fS?iMYERS!figffifffgi,W?se?HS- Lmdigiwfff2MgM?5':WSW'SF 175325-fifxsliaawfevk flf21-Jf-?5- 51-f?'f?Fi?fsfli5iH??3551452152:siszksgissiiiifikikfiikiY WI2HYs3?i23'fes2sfsrsfs.,vgzgisiff ::2Efi?x2?fzxif:5ss 1'-'iriyzs'ggggggaisivsesifkwslsswszgsKvgmg,ggilggg-5155-gm .2, ,, ,,,,ms,.12,, 6, 3, l5,.g,.1gggyfV, wg, ,ms,,g212.,x..,,fv,kwgfgggf:-,fQ-fgszisfwasigigzigxg53:ggfggggfgigwggs'1sss14Qs2sQsiIsz21'L2'h:f21:f2v-smsfk'2wSLiif-mesZes144si:w?fQf'mWISV'-W-iffiifif?Q?S1ii57lQ?7iS???Li2WW-fm?'SWE:N:WWFKW-W1W5if5f1sQKi1sisfsQsS1.?Wifs2 Zi-lzzs.,f,x ,m,f:v, ss5mw 18, Asn, YxAs2xffw.x.,f -f -,L ---ax, mms, s3Szsu,:5:--W--W A ff . ,Q --uc' anim--1' Lf M A wsu , ,., N .M .... sxufxx :m awe? 557 sw! -W -x x f. . 1. 1. :.s,:A:V:-: ww -,z :.:f-:ww w -f :w :.::.:H fr: : :Jax sn L 7' 7 ff -ff-wg-:if :wh SEZ s9,,.xx, U, 4-,L W.. Han .Aw W- f i ,J-z,:z2z.1e f - f --w--me 7.x 7 ,my -A --'M Sf- 7 LS - 7-A :f -:w-:ff an-:,f:. umm. ,L 777 - 7 7-7 V :.,,-AW:-.,,:535Lss:.s:xx,xxwmx7 my-A -f 7-f . M V W,X,.W, 0. .y,.mw5f.,g, s,m,,,gigM.,3,,f5,,.g,fs,L.,,-.Wm ww iw M, L. ,.J,..M,,.f,, ami.i,fslA,vsi,m1,,m,mm, Wg,..m,,.Fz,.fx1 sp, .Qs,fg,,f,,,.,, ,:W,A:X,,,4 lBSm,9sw.5, .X,..m,, Q, r., L,,-L,rms,:2,f.fW.1ff-mwflwy -wil - -wrxggifsw-MmQ2v:www -W -if-aww ww ff-I' ff fwgkfwkfwm Lf-M vm-Wm 12 ,5 Yes-4'1f-.fwsxg121fwzsii'iwfeizismsfw'sfif-LgHt::semis-.4es,4ssi4'izfskggUgg',gg?g5:p-fj 3gig-Qfigz1se3ggslggXg,gg453.14 553335,1-,,gf.lgv,,ggfw gagfggg, ,gkgsfgagyuw,g5.fX,lM gmggngg Q,fszfwziiezgsmggwggzz3.13, igmg-I -:gfmgfzmssigasiegxg. ,si:pg??gQggm,:figwggz'-sssg4ez'sa21fam:1915:imgefggxggsfisesifi?f'sf?22Sffi2fS1liizwwf-fzffwwis-Pivfiffffffm-'eswisfff-552'5P2?fQ5v?6'fQW5i55v?SifaMY1'?1f'2?'I 0ifb?fi5?W'iWf5'i7W5fiidliW-5iYffM9Yf' 5155 L2 fJ'f5v15iT.,linf-f.'1fs1fisiVf71.1v1S611iS214sx,imisiffisissfsei'fifEififvff'NimifseTs'15244521fszffwsikfinfifxfzfwfeeflg,pL!?1X,m,giufg5,ggmg ,f's,,fyx:,v.: 2, Ikmgiw,f,gggpggf,..:W.:,g fu .ez-:sz :W f, -, LA: ,,. ,1,,Agk, kfgqgmggfiff-gp? g2sKsi45s.g5g imgfgwgggfr Sh555214922ffsmgffif--H' fUSvss:vs4ez1:'22 1P2lg-iff-iimeIrafnuiafasazaswefeifif5Yi?1'2PiLl4S,Lf2iT:2if: ffi' fi'-Mfzffsii-f+212': 7sw.f2e,i'1 '3 fwf1XWWHP2f'fflfiv-swf s.L2zsQs1mf -Aw-av w f - H W Xu-ff 7 - -W Wy -Mw,A.X,,.Q 2,, , ,, , . , ,. , V. ., , Z , ,W ,m,.fm,.Lx,.x,.. .. .W . ,J MX, M, gs,A.W,,fM-Wxxysw 3. JA., . 7- www W Q - .V X- - .V Nw . ,L,,-Wgmsq-,Q.L N, A ,wwssfwgszmw mf7--www:fw,-lmgff, wkxm -. H ,.fm,.fm,,M,-y,l,,,J,m,,gi1fm,kf,,:5.,f,,M,fii,,,,m,.,x,Wimg:J.,.y,.L,,,,,,,W-S-ZMW,Q,Lb,LS..,V-M,K-wx-1121.W.:Mwfmfy- f2,.-Wm, A--W-W-Q--fzvf.,:.-:wifW-H-MffwwrfH-Mwyfmsfwwswfw-,www ,i,LigfLz1,figligi,,Qlfalv,7515 15321525Tfssgssfifffffqggliz'535355353??Si52if7?i?f5?5ff1i2lfsigfxigfikiiaififf15535-?QYV:?i4g'fQgP2gg4?5e?if2?44Qsgf iw fe,3XQPKLg-X5,5P2g32EQ345i2fx2sf?52?ifa?5Q22g2sg5yef-22553215511g3U2X3Y1Ls?1fgg'fggfiggfiQg?1g,gf13,311-ffgggwgswziiqixi5352 Wg-:ggifgi13353555eigisiiszzgixiwii5HgW22gxfii?i5iQgzg15223532mei.4b2T4eiNi??Eg52gfigilQQ?52??isi'is3525551355521225422QfsigziQQiikiks?ifs25L-ifmfgilffflIHQQWEQ???i?23?Pf5?9Esi9Ei,?gifigg:lgillgiiggiii332235iif5fH5??Kif3Q??G? M, H. L mmm fl -,fu Z 5 1-1wM,e,,,f ,wmwigwgf-1g5W,w:M-M,,4f M V,-,Q:,11gM.1 M gfQWg5m11g,gM,,.. ,-:,L3,,WM,H,-,,,,g,,,i i Z .51gWgg,5fggQ,gmg I W: w-fszzgssasgaf W Z :Nw ::f-www -wwf ,Wff-fm:-MyV-wwlw 521-Pff1fff:fQ2f'N' Aw-fff-f--W:-P2111-Mfvlf ww-1 we ww -aff uf Afwfsw -f :A -MW-5 L.Wmm2wf K fu-QV Sw W., M,.sb,- lf, m,l.,-vn,f.,, 3, A 5 ,HL Z M, SMX-5 hwy, pa- i 7 .V LX. ,B WX, N, .L,mm,.w,:9v , V, ,Wm,.iW,: VW-,LEW-zf-,Q,.:,I-,mx fb, W- L,--fx--W,-ff :ww www :szffsg-W :v,,Mf2,,.w,,wfHQ- xg: u -Q wx byX2-mfr:fcwfwvflfsa'lsgffsfifwfd-9'-21'-911-Aww-1M:-N:-rf:,.n.fx,. WWE, ,ww -:sw -4smfw:.fm1igg,L -Q15 1 gifgw afL,L-Mgzffm, :gg mmm?:lg-15'-fmlmgMMMQVL.I-wg, f-,,W,lS,fm,-wgz-,v,g,.ww+1m:: Wy --in-.fwi-QQMsay-if W 1,,5:1w1151wfp,-ss,--2,,-iH-,vW,,m,,s,m,-M zA,.ff:fsl-,mf-:Q fy W1 HMzzivagsm-sw fiilffw-wf.H, w::::,:Mm: w:w.fX:,:sf-f.Q-QQ'-fm.,,: ,ff::wwQf21'f-I-J fw-12ww'1-swfw W-:,f-fwlfm-fxfMQ-V-:A-I w..mm ,W N-if-wi mf 7 fwwfi- 'wx-fm wwf Z nf uw 552'-Pzf1u-:wwwwwsyf H -f - M.:gmwsf1,21fm,H,UVf--ww w :gf -L41-ffwuxz-:fy ,. me -ww nv :q2fWq, My :img ms, ask sw -smflmwfmwmzgfmg:zgwfiiwfia wx fb: :Ku-:Msg Qgixg:-fgfzfisfsiy-fx' ww fxu fa:-:whiz :fir f:v,1sv1fwm.s-5::f :wwfsvvs fwfw?1--wfwfwf'-wr 1Sv'ffS-'fm 15Z'1?Y'1SWYf'1S? li?-fivwfM1M'ff'4f2HffS11ISYIISW-Kaffe! 5 - 'NWI vf SIMS? ws, fsMQyfawa,--- ,fel mfs:Qxfmuuumzgfsvlgvqgfgzmyffwmfsz 222'-szgfmmzzws 1351191-m,::Qggw 1:1154 :Jw'Q1v1ffWfEgg'215??:wEig?ff ,mu -:fx-ww-.sysvssffwkfeaQ1.Q:f1m:efy-wi-smgzggmmswsf:sn:um-fmszm:m?1wf,:2zfwv'1Svv11:Sf1sSmeis-vswzfiwrQ7fsvfwwfis-WfffS2Y232f15S2wrffssikfifiwf-H1fwws:?1-wwww11sK1A8K1K5rgsgzmfgzglrizlswllszfsms,fmmmfsgmewzfmymmsfgykggiff-7fiqfgb-22,1247-'sf -25'-swamm wsu. M zffswmwk 11 mgfumf K ww es'-my:mxLenQQQQMQQ'-sszisiesisfwk-,Jav131,':xx,fs7'ws,-22K-W5 7 SK IW-52715,-W'-157 wasw'f1e2.1Kfsw1f:ff 1--251-V 1-qw?:mmmu1:w1m1:mszz:5:mumfg zmw wzfssssisssxism,-1 me-E -54: ff M21 f V1 wiff:-ffxfwlf-ffik-P31-1S1v1fm:'fff2Y 321261-fikf' 125'-91-fsffl '1 1211151wrist-iaifwwM21-1PKf-fswifflas-vi-Szafiizifyffivikiffkff1ii1f?iSf':f':ff3fW ,f'Ws?5f '5f'1f5Hf 71 W , Lf 1 wwMfgummf-5:fumfsz:wr-f,,..,,,.L .. .AMW m,w,.,g,,..,,,5,,.,m,m,,E., wsm , -W ,Q N, , U Z-V-,J5,,3,,,,.lmiw-,,i,,m,i,l,,,,i--1,:Vi fsz,w,-W-Q.HL,ayf,,.mf1w::ww Lf-M--sw ww- MH'Swmf2ff.fezK:sQf.mQffvw-f'--wvwfexrffsf-A fwwfwvw -:ww -W -A A Af -Wg,fu-WWMmM,f-H55.1-grimyMy-Wm,,,..w.MH ,M 7- L, rl, gg ,Q H iv,.f,f2,.,S..,b..,L,.,,, M,f,m3,,-,H,-,A.m,.m,Lx,..W.v,X, Wwwf-:I-Q -Zfn,-anWVW-ygwfvzw Ms-22'-fw:w:L-1-1ww- A- f-KMymf-mf-H'-M-fx'-A 'L -- wg -ff,..Wm,f1 -H ,.,M.4-5W,m,,-mf,-Nlfe,3,W-21m,-Mew.,W-1,mm.-,,,i:,:,:1 .WW -,W -mi ,X ,, Q, ,54,.fQmf,,W QW,lm,f,,wA:s-mmww:I,LM,q,Q,,fszwww,Vw,:ix-:fmw-22'-:Sz' :Jay 'fi-:ww:Mwwwf'mf-Zff-HIf-if-wL::2vffws+ls-:A-M1 K1 K1 ff11211wf'f' 'lW?WiV'1i'1S -12,flgim-L-ffffsmmw .. ,,,,W.Wmmy5.wxfmg,li,yfM,-1lw.fa,A.m.w,,L,,,w:,,M,,g.53,m?5, M,-W, at ,L Ki, Z, w a 53 5 Hx Myf5Z3f,Zy?,,k,,,kG,,U,,,,kZE:,MM,Ahx,W5m,m,,,,vg.,S,X,-M5f,x,MM,W5,.Q,,1,,x,,f,:flgf:.,,,AfQ,,,1M.,gsm.WS,U,,f,:W,,,,,ww11,11mMw,f. -Q--wfwf ,.m.z-Qzwff:1Mby--ff,gwwgfilmff-gm, -Wggmiyzimifwi-1,il--VWEMM,,W,?,,W:,Wm-.iS,m,M.ww, ,Z WW,,wgfw,,,,,,1,,,M,,q,,.,7,,,,:,W 49. 7 5: .Wi W- Ai nw . H ,Mez gXH,M,,W,Q.,Miww?-M,,M-,,-,. A,ifimmgwwwfm-,-M:zzis's--fmwfsfmgzfszu 1wewus-my1Mww:fw::dv1f-:ww wffz- Z: f-mxffxxf-ww m.v,z.sss'4ggsv,7s Liagiw 3 saisesfaiisazfpifgimggefweifsesisawzvs.,qw ,w5,f1gg::f5:fig?-nzwsxzf, fagifxwggu:mxxeufsmf-Fwmf.f,i5ffV- jk: ms. Sm K ,if ,,kf,,.k,fgyii,34gqL5g5,3.5f-,,f-fi,,5f,,fg.lg,q5fy.,ql iv gsm Mgmt, --yzsggggffwgggggfgggvgxg,,I-ini-4,gss:A1s::m::Qsaqgfgvz,-sfzfaf.fe:ws:-W-1'J-4V:bsiismmss::ssvfy-wS1ff2wf?1v112111511S-wk'2'3wf:1f-S7-51321ff211f?fvffSf1sS-'emW9H'H'iviiffviWSW1S5ff5S2fW'21?42 11122115-5111.,lar-35.21 izvxffss'fs1g. f'm'wi'x,:.,ai 21455221 fswfwf-:f wiiis-r'2feizzirii'isf1,3ffiffffHi'fvf?1Lff!Y?fWf?7Ff?TwVfd'-114321522seez.ssnzf21,fM-V1 SK W 1f'is'SffssziiizgiezvsueQrfwitiszgifksyfrff Q:ry:vii-ff-ifIW5-wg::iff-Ixfsifgswsisasiismif'1+-K sevissiifasgfeswiffifflwffifififilif'5Wi,?S2AS2fF':ffff weaf,,TsQ22fawsifas-:ff fikfgiwiiifbiiIMT: 1- ?5i'?E,?E1e2 45322213452-.isa-'kif -w1?S'f'27-5'E :lf--J-imkefeiz fm v1 mmm Q21-s25Mf?h:2fa+-5211 s ff:111ss1-5521234925521r9f5M??isef'fszsiesigfxz 255 SW293??fss5f2s1fminszfaiQ'srzw ffiiiqs-iaikfsszissisikz,s?fm?f'4iEM9fs?i'1kwas 4,2 . wg-QQ, ff:'fffxiwfesifxivizxzgsss 45555151-:wzf:5f:55:::5i -gifI-Wfsikfgggilffgfif:2:f:?ff2i:f:22z sv ies 43525.51 '55 55M:?5?'fi5:1?55-:Qs 2fx2:4es:fasVf'21iLs55::9rf S'2QiS2Li+25L2:13ff9wiw.fizlisikfkighfhiifsiifiszfinii mirA5Hf5f1321f51sS1L25iifiiffa-Wieii'15wM!5:ff:s,1 -4 ig 2-'zssgfs55f:9'-1::f15?L-352:1-wf2H:r1-iM,V-35,1-Q ,HQ Lf WW. 77 ,MQW NSE, xv,Knf..v :5..95l5:3x,m, Q kd. LX,sy,fQW,,,asgff i ,,f,w, gg,.fs,s:s,g,1,M,gW,-M,gimLa:5,gQ:l,,,..,,4,,iL.X 24, Am-Aw in-f,, .,,-:1M6,,,,,f1sQ5,,Z LQWXQ. g.LWq?f2zXf sg,w,,,55sVL2:s,,,.,X:fz,sgz:gg,.1e, Lxyxgh-kf3mwS,fls, Wfemsm 7 7AWE-TGigi-M-s::vz:::wm::wA:wiszksgiify12g55,1fQ,,fwxLs.,e-5 -f -H,-ws,,l5,sz,fSgxfszsfmx:M55-ffk-iw21gf:1 wwfzgxfszzfswmf1WgH1f:H17-F'-Qvffz -swx3smm,.fs,g. bg QQ? 1mf2wSf- 'M ff -5211 24.x.ivesam11 11.21. 2-.5-4 wwf wwf: -w w:mwz:mff1MM:13--:w-wwk .1 nwff L: 2-:ses 11 111 HL fg112,fw:w:fvs .15-1m:.1mm1ff if, 3 : 3,521 5 ,Q HQ: 155 www?,ab-was ax: imma-gi f W K 1Xmvf,, f-M1f2vf- vaf-lem-1 uk: 1 was11-PvflafvfwfwM: ' ffx:1wsM flf-,I ffww :4mm,vz f w,w,,f In .7 W 5 SSE W A 5, If my LM , L,,,,Wm5,f M ww, , W' 7 'I 'fi 93 WVA57' i'uTF9I 'f': ?iavf'i 7 TY :W SWF- iff ff-7W'i1Z19 S5ffL:s1? SWiil?'tL.?5fA9?fAif5 if iff' Elf Q: :EE:,i4E:Jf5wmi5. 1' - : 7 ,g 5 . '-Ewiivffiw-: 'fg-53111 1-Q' ,jg g.gk,,ggV5Ag5,::,::g, .,5::,.EigwgV:A57,,gig,:::3g:g3,,:y3L:gg . gg gf 'Wxwffw5:k5v,::V:,i? : 'W i ,El Hfffwi Ewifiii S5115 ffl?:f:'51'53W5vE-ESL.. iW'5f7'f-5f- - - A WN A:zfV51?T5 fi V5 i3f':5f'L:E 5:f'E:E'EemE:ii5::7f5,QE ESV! Vi iiW5?' sfifrwifiwiff fiwifrfir 1: fl ff? I S K Fi 'V YZ erm,--sszwzgsezzswf igfiiif W3 Wav : 253521122!w:ELs5525gff?'.:w. efsigfgz--SSMMfwwslgwss,:swg.:?5:-2ss5lf,Lfg,vfwavSf' T4iiffiwifligvisff1sf3iZ59L?iiZi!i??55iS55'S+''5P5S25Yf'f? -33zm2Wi:Q::ffif Q23 52:xii2xif?2xffF2i?fiiQLaffffszvm-Jia,sw-115221551wffwffw WIT?,gwffmwwmsmwx2W5Q255Q155K1Agszwzsrzzgsalsdlsffef-ew- ' Jef wi 21 swf WV, - . 5 H if 7, fwlfwzgskzssMwsafie-fgfz ga5,:qgf,if2fXmWQgfzggaggggge-:rr:gqggsmmwfWgggggfmgmfimem, ,gfg:fww1a,es en- :ir-wrf-swwzfr'fzzsmswfisaixfwfzfwy'fwwvzssfvzg,Le 142'-22'L1f'?GfMFf'i+i 72-fmfxilgfgiwffs wikis455.gehgswgfsaw.msszfxlxss14sz:nsH'v1M33-2L35.fsmciffsiffgsgsissixgwgg-?gs?Zw:f2s?fiffmw55253ggtgfsslwessiessgegvgf5gg5igff'fi53?,,g?Lg?Zm, aww' :gf si vw-1 -gsifgq 1 -Lg fig. QR, f,svfev1231532153?1gwg,5?iggsg3gg?gig51g55fIvggmkssif12f'a,W,:-,wwsigmgmgggggpggggggg,lggiggiszgg,ismgggggggfggfrg2z,1:?21is2swsf-t,?fX5:lg2xzQ.v s?fgg?:WP5ggtf25ssf:xmas4522ififfiifiilfizffiwie14sg51fswfQ.1mxfg,wk75,,7f,,LWQQQ-Lgz gggggggmw gigfgiggiif 1fw::swQ.V1ff:m11fX1v1Wgfm 1 ,1w,,5,f,WfWQ51fgf 11 wf2z,,Q,Wy,gggqgggqggrggggqN:gy-WM,-15 w,1u,,Vz:g:gg.,m,Iwi4 W 7. f gg, -,giiggig ,lf -Zh 1, ,i Lmgfw-, f,WL,,W,1i,ffiwvfk::gg-gggggggg,lf--WW,-W..,iw11.-11m::qgfig,-f:sfAsszggS,,1vwg::gmXs--,fif-if 'fif:-W IfzfgfizI7-ivlfvllsvllvvlfiv-Q''lv'-:f-P11,1:.Q'1r' -- M-Vywfffwg uw1fmx11wwfse7 'ffffSv'L'1m11fHw lffwsmsill Sf' ffxvfff-mgaI-mgygfixfei:w:ff1:Y1i,gfw3:-wv15,:gzf'-W1:mwH:9iK -W1 Q lg :QQ wwe,A:2,NW,:2ffsy -myzw. ,nw-. , ,WW fR,:,KfL ,,,,M,,Lgg ,gw f,,:.viM,,W-:G5f,,,5:,f i, ,,ff335Afg:.fy,fg,,,X, N,-m,5:,ff , MA: my-Q1. 1: -:lfmm-I,I-sm,,,feMz.1sQ,1-1-f,f swsS,w:1wf:zg- 7 f Svfwfmwfgmmz- ,L--S1-f211fSf1Hf-ww M -J -JA-ffwfgx ms-f K1 ffwwifv A H512 1 fffsffliflf view W-ISQWL if if ffmwgzQWW-.W,.,.aiywsiiwgimm,.1,,.M,,f,,mm-f,ffg7 , -ls,'lx,fw,,w.,p. g,A:,,,.M,f15.WM,fMzg 7,.,,,Wk3,,Q,,X,,m.Wx , fs! m,.H,,,, M.,,Mw,Sf,km fx,,,-15,-WMQM,-fgz few-.1255WM..,3.2,Qw, Wwifmg- Hs, mx'wrmii'W-,ff-wg!iw-f2z::wf:w1ifww 7 f-ww mf: :I-rf-QM-fwfes 1 fwvvllsflgfw-wx w,,,,,.W,W.5,,1f,x,1,,.1wm,m,,, fgm,Xk,,M ,K-4W.Lg, , ,m.,2,.,U,,kM ,ls,.Um,w A. .V W,,,,K,x,Lm,.f,,,,f, .. ,. ,Q m,,k,v N, :5,.iw.MW w,m.m Q,.fS, :.H.,w,fM , WL -W -vw-m-an -wwf.1fX,f1s:Wf5,L ww K-A - M H W W -V W--si eip A Pa L,.zMmsm-fl Lwmx,-:.wAf2ff:W.Mswfm, ,L ,Q 77 7- 7. ,X 71 M. -gg, ,L,,..5,,,1..W, fem fy fsmmw UA. ,. Mfg- ,K-, ,rl N fm M. 7 Ha,-I -:Wei-W my13,-fQ:ee:.:s1,-XM,mm ff-ff :ML fb--M-W m e uf vffmwf-Hifmfxffwwyfffm my-:SK fsfffwwfwf ff - lf 1- 7-fm V2 J-'L W: My 5f:2fg,gZ5,gQ'2 gy:gr21,25.1E'iq,V1fcLf..35QE5i5i555igsmgessgxigsizgsi. gm 493515, iifljifiif W sizfziig' Uzesg.9gg,eefffmggzgsgi--223'fiEfitfig?E14232Eiibi5?fSfiiegQgeiZQQ?giQ??fkgQi?i'savage,,gsfgggfmeLfmsem3geS1fS5Pi-5Eieiiseggsesifgsizssfzass,gsmggegpsigig'iii ws: ixfwzgsf'iQqiKff.iLXs.g'feagffg2i wa:-251 saeg4Xf1fH1Qgssi4seffmalmsmfwri,Elwgggigsgiggll,Egg 55155Wggggggfgaggwggilgggggi'uQ,gifgg,i,.rg-gkfgyggfggggup,K-.MSXfxgiibsgtmgsmlax,'Jug-,fg:w.xmsfmsiiefisszm15541231511ggggzggg-:Q QQ gg,,g5,..:3A-2 -,gm 3- --Lg -. ff 1: mgim 5,W?,g5fzQ.,,,f:v,f:,,,,,,V,Q:gy:gQ:-1gg-,ff-gfffmff,gummQ,lgygkggggglgglgggsziswzziasifseifk1iwgg i1s5f45v:5'xv1 211'ffwgw-,,,rwziwesssswfss-wzigfgwgg,flfeyf.1411wwissszfmskway,igfvgg!'54,i5Kgg2?ff25fwpvfsilsisfissfsaszfaszfmf Y1111fasQW1QKW1XZ1fsf1fmmmmm-.xumwmy:A-1:-mgm-.15115:15,ffwsz-2.1'-up-wgjmwmg,mf -i,figifsawfmamaxz:waz-es-V,-.ms-:uf ,MQ .g z, W , L, L, in .f vlm5,L,f.,,:,,g,:x,,.5g,.V,,fS, -T-vm,,A.,,.Wg,5gxXggg,, -1W,,:fQ:,w-xxx-wxz-155:wg-2-5 ak, -l,,,w: ms, ,wwf-QI'ifezfssmuwwwg:rw-,,.f-W-,msmuHmmmfiewg-vigsfyzgvffk ffwkwy-aw.zy1fsz.fmw wx Qmwgx-fgmfmxu2m1m,1mmm1M:2fisfmmm-1mw.fgmf.LQ,.w,11w,1'M-aemfMQf.ggf:fame'-.wuem, M-M, Q sway 4- 1 Z-.2 1 -- 2 7 M1w:2'fM-QM,V'-,W-A-few-vw A-wmewwxdw::es.f2Q:1wfw-f1xwf,f:fff.m1 vw B4-fmfkiiiffiV553'iiilbiflfiffiff l1'1?K'27-'Aff''1921fWSF11WkWH-diivffu'fffrefgmzWM3''PSSA-f2hfH121Sffsffvfif gwzegzgz-5.my-f,ff,,L:1i,s1we fmeisfwvisa.Z-gil-gs,-mmmfwwfgeisMedawiwv-15:wwis-'rim'weave:' M Q y swag-ml, fi, w :sz gag, , Sf- f, 5-1. gy,,5gggif1f5,,zA5MgXg-255-255-gwfwA'eiz-11'--'wzemyQwfzrzfifgeffgsffgsxfsz:fvvifvfw S1-25112:awww -' ff 5-fwfmzw-W1L21-ww.:wifif-si ff -fs. EEESSXELEQEAS-?'iWW Qwgi-LQQHMQSSA-fs-Q--www: 1 gilmfggifiggz'fy::gyfw:sw'.mf .,-lwxfa fwxeszm W --'mm ff M . , Q, ,, ,. fa.. fmaf 7 95513 .2-.W,,fQ ZMQViw,:Wls,-fsbiiszffgxifdlgs--257 Mfwmzffsf ma z5fgPJfs,2m:f 1-:www'1s:-M151 :fmfgw-fffzf:-1,:1:, I fi FW'-fwfifi'w4wfY'ff' -1fwwfflilfiifiifiligkfxl fF'fM2?3 K1 fr: vgfsfslsf MM1-WH,1l1W27f5f7K25'fM11ki?5w1fws5f'MW gg55-wgJQFfgs-f3g-,gf3ff1Qg1E'5f125225r25Mf5gusgee27.!!21gffggilggiLg-um?Xmi,ssgfiggiwzgsegigifiiiWas:fswfggfiriifgx-fgszfsssiffsviswz'swzfszg-ffgwggag455igwfm-wx?11mz,srsfszzksfwsifffm-Maw-.fp:f:gzm:Wf2z:fsz,:fmmzs,.fa,fmm,.f2f.fgf-1gg-,g?E5!2ggs5s5rEigms.,1Q-wmgflmg3,3552seatsSsi4szffgMxf?xL:Wdw- 'e:?ss?Zfff51g11 'fs :seissgfgggxi-ff:A1?S fi?fiifffifisf'fsigiifffgffi-W if 'Wfi?'ififgifgfifgisifii-fwizffs,-Q sLff,,-Mum ff -ff frW1'wfg:-,,g352 Hzmszssfgifsisvsms-,1smmfs:m1+G11ax11MggfkgsezgiszlfwgzfmgagiisglgefggkzwggiwM.,,,1wfm-,faffs 7 ,ggi fwvlsvflxvvsfw,fLhzQSng:,,gm,f ff: wgfwsvfefggew iASgz.f5z-fgnyfwqvf iw-1,7-m,21,,.w,yL,ggg,X55k1mfgg,figg,g,,fQgfi 513,'gf11x51,5,p.,5,w9K-1.515-Wgggkzgi.,1553551562419:QZ-fwszflm,zwg12zv1vv11eSf2s-1 45: -'f'wv'sSwt-EW ii ffiwkvlfe WWI1fHffff2ff2v4fH? ii fwfiww 1 7' F- ff 11' Si N51 MW1-921iii-G7-ifi5ii5'5?SMf?35f3755?W55?Hfmf mfmmff-5, fa www ff 11. ,f1x:,1wm1M1,: -,wf2fwm:w--W -2,5-WE, JM, Aww :eff-Nl Ly J, my fx.: -fmgzf .gszkwsm-M-M, N, W ,mf ,fy 'wk ,vm-ff l,W--,WW LX, Aww,-155, fm zAfm,.w,.m W M --wi Aim Q.m.1aw if m,,fMS N, M ,, my 'rv' f 1-fi w-'M'ffKvfwSv1f kfZ LSZ1fPff-w-wX-fX- is--wg-Eff Q52-wwf: ff- ww LQ hmm mm-m--W' FS' mm-wsfi.Z-fy-2Q1WEKmmwwmmflw Mff,ffSX:.v-fag-,yfxg-iw-if,-11,1'51-Mmfggd,wwe?W-1wS:..,i,W,,w,fL im, . ,L A ,K if A ,K ,, Q Sw,1,i,f5Mf,-3I-my-Mwim55,M.M,.kww, ,I -15,,,,,,i,,,M,w Sz Q,:P,,W,,JM,.f5:pMQ- 5 - aw, QV -11w,v,g2ffwvfwnzvfgf-fgwfwq,,mvwffww-w:ww'M-M,'mmlzissvlasvfuif..'42 W v1f'..,,1s3g' M. z. N wv : zz wwVfg:-mg,fgmffwtae,-iffmg,-gg gf5,gyggQg:k5gy:gqgk..SzA:4, H, :,, M51 .wzigf,,5,,lM,:.,-xg, ig, 3 ,2,, ,X gi, 3 A K h,3lg,,lg,,,m WW,i2MV:w:R,Zi,w1 ,K in ,igigqgu,E:mX,,W-W5,m,X,W,zM:,.,,im,1lm,Ji,,,M::,,fw,,fg,A ,Hs we ff zfff.a:fgf:v:g-fgfifkslzfsfzfiswzwmggr rw qw fm zf.J1.142f:'v4'iwsfw-ff-iH1,wif-.mfnfzsm '11 ww- ffiiffw E511 mf' 'w1 'fSQ1-'fsdf Isl IW f flwifi:-ima:-1K-in-www,.MS1f::,fxvZfax-fmfszgssweffksvlai-fvis-J. :M Z, ,fi ,. ,i 7' , , , ,f -W, ,W-fm,X,f1g,vw,,,W1,,-'Xigmm..zg:.,ff.zAffex.M,,,.g,W,W,wszQe-sz,-fxwzwm:QQ715-fffvvsrs,:z,.fxw.5 ,. ,..-qw: -SK :V rn -1,ww--wg-ugfw-25,iszmf,ww --W PSM fsqvf -fs' 7 M-m,1m,1 mfifw,aww-fwflgzli '21fs2i455fef.sfi1nif2ss'fAiigslsss-14eS1e2ffsr?es'Q:12-sm-fsfifis2525.5g?Qis351s5fMS'1HS11ff1f7iif19P53555-.14a214szW4wfwxlfwimfasfwazfiafffff-.fe3.:.i1,,5fu,'M,m,1Q fi,x-iw ltsmiz:?5Qs:f.'2-fia--swf:vw?fxwvf1Sff.,vf.if4s-fieffiexiss-255152-.Efx2ffHf'f11iiffS1wifeQlssfsfmiiiziiii1figifiiiiivfffkfyfgifwfizfirm,.sez-KWz5i??iYSffHiw 'S1352-.,ffgiiiidfLvl:1''51'sYis?MsXufPwsfN1'1w2':'v:'s1wii25Eg,,EYWff'fiv'Ni11HwiH1f'71w'wf' A'A9f51as5iss5i4i5Efi22Zfl g4ggW5w.w fgmwsf 4afgg2zgg2zss2zz 5f?Q??i527i?4f :mf LfvlsfwseqfqspzgswWgqfgffrkfffygggf W Q1 fy- :fL,gQfs,wgfq1 ,:,9-iw wi -Ufsmsw-sszK2zssszye?fme 1-5 1- ferimg,wisfzzeenzsmssw'fw eg wifezzgsszssseewfiifmffi 325 fsfvsf1w21ff2:wf wi'swzsfwwiffbsf flwff ww EGM'-W im 71 Q, 'Y -Q51 .W -fm? fww 1wmw:1w1f,f.1 Wu -1 -:ffQwf2zAg,:ufm1unffmzzi.,A:..s.,'f:, img k K-fgxzfwgz-mggmIflmgwgggggq.ggf:f:Q.:ls,.,N:q,,1,s,1m,,f my MM ,, ,LL,,-,upmfg-lf,-,lgggggfg:Qgfggg-gwggggygggQ7gQggpyzgg,Mg:,,,.gf-.vw few g5Qggkiq5v,gg,,gs21m-,pe I-svmlfwxmgmy-if gss1v'v ,.fQsifg Mft ww sas my 1 N vlfvfsswflix-1 :-'fff2Sfif1fi5vfifv:l vkfzffgswf 'Af ff Ikffflwffswes 121521 m!v1GfsQfieg ff fm:-:H :mswwmkgfasff nswpnf ffxwwmwm:-1mffm-W'-if-fm,y LW K, myfm,x,4,:sz?vWX, J, .MZ i HA.,Wwsg-:mfg fez1.f,f.e.-,,f-.W --, usa, A. X K-LX,-Www? L27 -sy -www Q- Lx:-iw 1-P ww- 7 - ff-wffgw-A wi-fy :X1vfwma1::s1 1 Aw -1:--we U- fx- ff f z if A: ,, M-w5,5,1,3.,W W W -I - 5 mszksswsz-fzf. z, M W A A -W f if,-,f -sf'-2,-:sm -Mwwff W fi-,f fumm,isimgim,-ww-swLg-,WWwmimWg-ff,1gM,f1S,fly,-WMI,,l,m1,,,,1 ZX H ,H ., ,m, , ,I - -- I- LS,,,g,,,,2zmm,-m.,,,,W-,,M.LX,g .X,,.W,,gz N,w,,db,.,X,. ,V 5,gwwaz-kf,,-lS:sgs,1sww -:fig Mmwgm Awww-:WSfwvffwlmvlmwfefwfmf2z--mm ,v-,,7-.,f-wfgxfzzfgz,-sz kmwfz,.ws-uf7fW.mmfx-wfmf.lS,.Q-2-31.93, 1gffmw3,m,ffl,g-WMiw-.Mm --m3,.,m,.,.,M, in Q .. 5 mg, , , i ,,W,-my m,,,,L1w-miM,.LX,,E,aww , ,v,9w,,m.,mg,Ai,gg13,M,m,QH1sx1.1 'QM Z If iffw., fyfwsff-ww:wffgz-ww--f-'wffflwffwwwwzxx'sms' 1 mffa-vzxfwf-Sw Q-me-,-Lfzmfiwswmryfasufwmsi!ewsw1fmf.swIfgurfeziiey-sz'-Infm?wxmfzz.fsziffzx-fvssk:-U--Q1151:wwiszfw.U-:.wfEw2v:Q1ffwW I: - g-,L ,g QQ 1 . zuw-iwf. K 2, Q- ig 12 f ,WWW2115:113511nw:Xm-:wiglg?-iff,if-I,fswmmisg-ds:15--gg--fgfys2Ms2zf:mwQfgw:?S:ffK1fff is New 4? V-21' vw ww'rw1f'2 fP1Y1f2Y-13?SME-fivf:iw f-X'wf3K'M' 1ffWSf'1Sf'S 2? L?-1 ff-fw-fe-J-fgkf-Sf:f1 -:-5 ytlimzvzzlfd 'F Srl 'V xii xg ,xx 3 f N zaxsii' s.1sstvg5mf1ttf5t551--59:rziufwlfszxxt'u1ffaZ,'iSZif19'--?YEil'z:i5?i5E1S55-iiiffifki fwigfi' isarxiffz W' .fl 3- ff W -ff ' ' lam: H557 -5 'X ff 'xiix ,ISQEZZSETSSESi5iI55i7S?il5iiE55552155!QiEiii1.iii.isia?5374?3':?5ufYnsm,s tu nf' WV:'iam''-5-?3f4f51f:?z,f9s1.mz1xxwr151 '4iff?V?5f: fi' inf mi , lssflxg- 545' ,, sh .wxxlrxsgzii-gf'-151 535 5?Zi555Q:g'gigfiggagggy Egg -5'45L5HzQsmQ:EfsQzr -V 71 vw w 5,1--lf'-,I -.4-fgq1Qg,zA5gzAggq.:g,A, 7239572-L2f'i?' 41191 'iffi-Lugqgfgwf'ig'23554225559225221ffsiisijigigiiigiiliwiifEQQ5?EZ5L?L5r1fQE33'Q4851Q51355gXQ5EQgiE555ZEgffifEg9fEEZSS2gl5QE245262:wg:-iii 1g.sgfszz?Mg,,wz ,m,,53gz L,if35,A557AMs5ski3w3gfg,g35ggQy1L33g5g,E sz swim.,K:e3gegggQg5gw:2fglmgsfxg ,QLxgQwzgssgfiggwgMsigfssg' miamissfggggjgwifg ssl1535meg2Swf5fQ?ffsfi22fi2ifLsf21: ,sg 9' Q-fiflisiigf Lmgigfzgfw:5!3,ff??4i?4f35isf51sf5'?f L.fs.a.1w1 L,m.4 ,...zm.mQz.,ww.Mawmzzmzwmggmezwileww,lmx.vwfew:z.:::v::hfggmqgwgz,:,:7zf,1.1es:3.ez -wvgqwzzkzgglzgzemi wzewrwfvQfwwwwwg wwwwgzqfgbgggv 1951133551gmgm4f214NL:4S121SQ2Ifww1w2+Si.fmg.4e54eQ15ffZ4Az1:r'1U4f1sff1sffwKHfffQf3iU1fi'an'W3:f2m1P1f1SSPIffH2M5H2UA22.sf:.1wwfihff1ww'1'1 ixivffwfwi2mEU:.1fxii :Ffswwflilififkif5ifv'1Uf'fWmil'arwwmmfw zefzmfzzsffzviyf zvfwifwflffwl wg 5,123 Ezmiffffg-f15gga,. zzga:'6gf.g33g1f1fw amzfag f33gfS5.giggfiwziggigfflggf iirsfiiegfigki'?f'i7 53'iff''3525325525555sfiggggg5325?353335S535255?2532154gsligigswiveziisiaiziygi,59E'i.gn??12.521221gi2ii57gs5gs?gff?,g?wifi S mf sexi:,fizisffiigsfif-i?i'?El512 SQ! as :Simmsfaszzgsbsisvsti 'W -- H' 212615 iaf' 1 2123235Ekigvfgfif5EQ31gi215S22Zfi2ff'??W2QF2Qi9Ek'f:igf5?fgJ1f51f-M1wf'kf5 ??'11gi9i3:li,rgiygfgxgi,igiwgsiigfiigiii ., ,, fig -5 52' V -mms.w:fvs.1ssxffsmaswsg-L1smzAm-sax:xxvgxywgdy-Qs,-s -ay-2i-W1gavfQwfSS155,-2,1-ww-mwv--M ww--ff-11:wfsfsms-if,.s5 fi -.muff Hex, iw- -A G I Ms , : v.fvz:V,MfLfu,-.Q, .mam -l,,,,s,,fi,W-,MVZ1 ,uf :ff:mg-4--Vg-If-fem-swsuwarns, - ,H K.: mv 1f-mf-Mmzf,:1wmmw:Hfwkx-W-wk -A -f X-xmfwfsa:awww1 11 11 sf 11 W V' ff ,lf :NmL,M2mm,im1-M W fi.,-L,zA-4--fy1-iw,ff,,w,-mmm-iwme-fx!fxwe 11 -wwwm My ff? M4 fy. Q11 .f V :Xl W 15153 Hifxigzig 1PV'f'?1fii'i2f11F4Srllsflssszssfff-QM'fliwlls-1---25312524-,Wf2wm-mww,- ,. f,,,,,U LW. U. w,,gXz,sL lei,iwww:mxgmsffgfevfssllfef-fwaskfegfufmsvwmf-1-ffrwswwy fl zzw s.sl53:v -f few wvfwfwf! 1 vw :SK Q-A -?hm?.4wSvfew-fb-::ww-:wnsaz-Sw-fel ifQ?f4Q??Qs?fsffffev+ ., .V - if -as -M, . ,, Wzsfm, .Q9fx2?fe2?ia22?Qs:Qs-1'-ff2vQ?wffi:-ws519??':x:fswsw1ff-f'f2f1W1w1-,, ,?f4mx5f www? 1Sf1xKv5swsm, ,,21 :ssww --M-H1 -W.fe:.u::mHW--fgif-fwf:fr-mesh-4.fiwx4a??QQS?K-3S11:,i1-xwffxxxfwifw ff' 1' f'f1Lf5f1f9'57X'5Ww.'z-. W: f: axis! .SV , 1 5-1 Q: igsszgfszsssggfzgsfgiggiwwf'fwgglgimgzwmgss .gg,sgfw-a5f:f:w mm . mf1Qug3,gefM:2' -SWEmmm,:sai3:3f,fl,f:,Wu-,-:Xi XZ i,,,w,-Hwww:,gfsyiismyQmwizgs -1 W,f1,Mg::L,2wa:sxgfw1Wy.,giV:-:ivMweff5sfgfW2ifxz:fs11:a: wfimffqzgfw-ffifwzvxvfafV-iw ffw-W:f2vgAmAwwf' ,Sf ,A , M Sf V mmf 'fffmfwwf f ay--,miwfis-fafffl,H,wwfmmsvfffff-1:lr-igafssz:QXs1ggz:w-vg,i,.65 f.2:yzLs?:,sff.fQeww-mwgf-7,5JW-Mfvffffaefwwff,gffggeQmfigff,1M,:gWfig?fy,fW,fwfggL5,,5,1gggqg4g.wffwfeffg-WQ,, mpgfweflssvfssvw,:?z1v:.w-fffssfi-iffwigs:Msfkswussf'lwrfwf-1'Y-'fM-as-M11lwffbwmisfiugi'ff-XY'Wxfflyfifflf''vvvfivw Q-aw1.:wf1f --S47-fix-QS-g:,vfg-y -- f il xi -1 N -f ,visa-:Sr--ff wgwff-f:gi-.:www:fs,AMz,fw:f -wfwai f,L,,g,i ,,,fm,MM,Mggkkk,S -K1 iI,-wi,,mm5H1swgfw-,,f- , :li W-W - W-fS2f:ww'1 - Q- w 1: wiffmifM1f2ffw1'1w-Q-fv M- ff f :1M2'-Wffwwwf ,- ,. L nf K. ff . Mm, L. , ,L . ws,-:W -W ,- ,. .. zwywiv -sz Am ,f Wm .sew ---- Q,-Ls,-La, A. A , . , A, , . , . , V, ,Ai A -A ff sez-fem.. .W-Q wx W -- ff-Sg U 451. ,.f Ms, A -W f- f- f- www! fx- fy- fx-W' -. s-Ls, mf.m,Lm,,LM mg .V ,L ,V -A -A Y -V ,W W W . ,. 1.25-fssf--ff-W -W --gm, mff--,,WA.Mx,.,.W, V, .4 ,W ,Mez-.ff,e,fw, .fx-M.,-V,--X---f-.ffwzkffq.y,Mfx,,.,- -. -f -f--SK-wwz A . . ,Lg ff 'bm Z-fy. ,f .. .smxmmxmWW,--, ,mi ,A f.w,,m,L. Vg- - -f W JM. W - My - v,m.1H,gwms5zXsv,,,L ,. N-5, W-g,X-W ,vi ,,w,.Mz -2 ,,v,,,., ,,f,.w,Lm1-. ,QV ,K H 4.1,MM--,1M,,W,,m,,,wm11,w,,1,-IL,-M,-,I ,L-ww-. :sz,f2,N, .t,.v,,.,,x.s,, -'Q f gm, -my W., -ewfmwmgim,my.227f:w-szrfxm-MK MW -A -fWzpwsggwyAvy'-sw-www.2 my -if ,f sw Ligewfwfiykgiggf ga gi- 7 sv,A:v,M,Q-,Q,ff--ig--ww: xff-sfyzifqgkgxw1.511465Q, ww M, 5v,1fvzgfJX., - 'Q wi-:Lzi 'L uw- -iw -. 5 'ge af - fr-w:2f1 gugimwIfgsm,13,1151A52,115lK15Q1w,1,13m,,q,,X1-l,,,q5W-mm ffwzzm-.:gm-.L -,L -.W-ss-Lsyf.a-Q11 up -wg! fl -WK'-' 'me sv wfm1,:.:gg.qM-eg ,W :ewwwf 11, .ff.ff:fggWv:f2v1fHK H911 1 1557-Qmmsgfam Q-,gsm W--If-fMxf1xf1w1 , my A -, ,X if W ,V , J 3, , I , 5- -,- ML,m, W,,a,W,v,,,H,MM14,k,b,s,1,,,--,WL-W,?Jm.k,,,MQ, HW, A --M fm, www Mfg,-Ls, Hs.'f-Qff-.vffM2:4:z- rzfvffggfffmgwm-ff'-.M H vw Mm ,- H W 75371 M 7-'mm . it ,X Nw, fmsmwm,-QW-:wk -Emi 2f:Afz-'Bi-12h-,gg 'Q Xa, A M fs ga -fy A 2,-mn W.,.w,X.xL. ws'-21'-fsusfsgirlsivwsww Q. my Aw, mm-'L--1 - -W Lu rw-W ww ss: xv Aw my Aw- M ff-2ff-wMx::fX: :sw-V1-1 NM vw:fxw-'f- X M SN-Lfw'47fwww fsMsm my :f.w.m-uglaww. f if H Z1 zf. ffsf-we-12213111 1-SH f-f-.fsxiifk--wlvfff fwwf--??f-wfssfswf.w,Mgmmxg11rw-HK gffyffsg- --fi: S by 1 Q m- F- .ia:1s2fe:msugaagQ1gk,Qkg4fmi55N-2Wap,15,qg,v,fQ,figfLi,,,5,,i,,,f.,,fgx:gWg-,giglfgigsf55'---.in--fs-:Q.fm:1 515A-N543zggwzffwf-:yi -. L w .ws-W ul If SS Qs-iiffiifikffv lwzlfxvllsvffwwdffff?'Yf?fYA5211-ifiiiiwuf fY4Ar?fA:55W'-?'WfL5'-'SMW5 fl F- fhifvwiw mm 5:2 uf fx Li zu mm v ff 1. lf. mm f W wf.,fgi mg-ggggg:p5zi.2M:si,s,i,i,f Am I1,g,fp,,5:,mWWXm ,uf K-.,f-L,-Alf--:ff,,.Q-gg, f ,, S-,f ,qi-,1 i1g,,,15,k,,.2,isqhwig,mimiWmfg,Mg.M-gvlggfw,fgZ,WL,g,lm,'wg'LzA:,,--smwg-gpwg,5g,2WKirf,:szd..,, Am ,, fsfwzw J' 2M.,,:fss1sasifsm lggff-F: 1-51-Qflfvlfxz'lsvfsggiffmffifSwiy-9321-W S11 S11 f1QsX?S?'A?W Vi-ffN'f-fQP1f1!2ff WW! ififfixif ,wx ,vi Q S H 1,1 ll W H ,WKw5335Zg::EM,WQ:,Hg,,,,,k,Qlg,VMWm 11 z1mzQ.:z.NW,.,WiMfg,kWw,,,fQ,i,I WW,K,,,Q,w.:K,L.,,.,,.,Q,,Q,Li,,,,,-1.m,,5..,,:.,,,,Mm,,,,lmw,---gi:gk.k,f,MmE,,,,ilr,,,m,,w--.,img.M,m,,,9i.,:gQM A,W,,W-V13,11-A1W,.fwggv,i,.-2,,-W-s,,Mw1,WQfwlgmw,,ffsvf2,fsszfam.mmfwwi gy 51 y -f. H -.1 Y lf-uf f- ,W 7 K. nf , -,I mf f 11 ff -ww, ,.. ,mu ,M-l5,.Q, ,KmQW,,4X,.fg,A:. ,A.,,L.g,,..,,..WN,E5V:,m,,w,,,m,mf,Af gk ,. lmww. fx--'W Ja s, 111. .w ww 1mx-MK Wm-wg .,,.f.a,Qf,,f-Msgw,vW..f2 ,L w,W,.1,,,W'f,.fL xy K1 Km-Wm 11 11 , ,www,.f3z.Lw,s1sf.xf27-me ,WSWifmmw,lm .W .Wm:.,,.f.,WW, .Wiping-, M we,-www7KzfffmfwyMwma-:M M 7-M-ww'X-QM-My A- -:wwwf--Iup M My ww mm, mm ffvffg-vfXmm,, - 'yy ,ami,,,w52w-W gl -ggsggif5i1555,g1,f'gs,Q,g:smfQ-Wff sf-Qfggsy me-z gwwl ffwgymggskpl, fag fwgiiww:5wM,5W,ff,,Q5a,5fX,,,4,5-2gi,21X,51M,wfgQMl,ffwf3gXLzg.WF1,Plg Wgi Qgfegfggmfw wfu- wb aww ww - Wm 7'f1zm:ss2fz2ww fQ21:wsffw2msszw1fswi-if'ffmf2fXfS1af2?ff fgwwz amz-sszmsfff : Hwfrw'--f f' V -f' uwz ,f Nw-,V L1 sixxwsxzxs z-1 ,A-:ff-' 'W 1 las lain 1':ki1iiisswzSii1iiiTi57-5 Ti f-fs-JM-fi rix5lQ 1555515 if If-PW-V' ff' ff SfixEfi74i5iiIiSi QV .fff3TffYf'5iiz'3iTi'74 iii!,E553V57 lUi7f-J'-Jihigifi.il!!-ifiiigiffff'fl7.L,i5555'7535JS35f ff75X5Vf83Vl 'WL-:iii?-Siizlkisufxfgl' f- Zi- Tiki' 255 7555? 395' ' if 5 - 52 3'.:.1?i-ii: M0111 '-fu? f5Tl1,TiQi 5i: 'i1' i-1' ,:i5b55I4?5f5-3 - in-iv-rli4i5f'7f 5' V -L -W'-J'-W':- 5-iii. fi Iii ,F , jk! f ,X 8 jwffifgfsf Wm V -W V, :,m,m,M..w' 1 asiaw:.,..,-flewVw 1' 1 :f,ff-mga w:fm,,ff.v g,mgyggggm,': yf, 1: ,A .i -i i Z- ii Z , ,Z ,,, , E. ,f -, .. 1mum:ffpfHwz1fww11Wgf,,Sf:,,fW:k,,fm,:Wffgflg-5455:f,i.,'L.,1i.,1gg5:k,gmfmsgvff M, mv uf-1 -sk my -. :Mzsi..azmifisz-fsfwgrr::ifsfvfwffaxwfii'eff'W4H-Sf:-+1wf'sHmY+s:-'W1V'ff'w1:-:f'ffJ1JTM112 wiggfg-,VWKV 41. W mmm , A. M. Hg 5 mmg gL. ,m,,, .M W ,. , E . ,Q ,, A ,, A ,Z H , , .,,m.W, kg,,,,,fpmmmk. S-fg ,su - zf - - - - W..W..a,..WxUs--ff-iff-f-Szf:.,usK,.WM ,,M.,ffr,f- Mfml Hx, - KASM.-Q-:fff-'W 1 1-A W W -fswewff fw,w,z.f.z,. MW-fmwmf, -I ,- -Xvww .. .. A A ,M W.. A. . . .. A JK, ,gb 5,15 f5mw :g,.:g,gg,L LM,v, .Q-'gn f-S . .,..,,x,. ,. 'Riffs--LN-ww-Vf.ww,fs1fww-, W-MM'-ww -V-- KH 'IW xU,,mMwgsh R wsw-W,x,,M1swszY ,-922 ,v.,,.., W Lm,u,, kX,f5Z ,V .mksm U. ,, A , . , , HL , :W Q, . . ,,,. ,MM,A,Mq,k,,,L,,.i,,Ls, ,..v,..m,,,.wwwL,,,,k,L L. W .,,,.,..,m,, ks, ,Mu N., . .www -LM V--:ay-ww., -V 'www ,WM . I gf miss'-:vfiwffxigfigfl 71-1ww-mf:wmwv-:w:ffwv H ,,,-mf. ,,- f Q ,.ig,,vw.,ff,f.,gk . , , QIfMyifswmzgmm,,1Wgq.g,Q-QMAW,-f.f2,flmawf.wwxggsgggz, my Mlffffwivf-fmfgIffifffffvfiffwIWW- f2WffffW +ss-4ass21.+su.ffrQL If I sz zfS2i-sims fwaf-'fi'sv'-Ifiifiuwffwen fi,fss1+mvfems-imgwmemz, Im fi?-wsmgiiw--fig 1 ,wfw.ffm4,,,:w ffl-,-W,Q,:,ggilfggkfggwgggfggmggg-:gggqggggggggggg-.gggygggsgggggggigi,,3:2,f:v,Q:ss1.R41.fqgwggw mgqsfigff ,seam my im-wif-sgzfss Sziiesiisff-1H-S:fff1'fSKv1 sf'1w5f7Z-- f fw:-'Lf rf lie:Ifcifim'115fAfM224si?fai2fww: uw-rszfsw-fwf.ffe,f 11 f,fpgfLf,lg:M122-fSsf1ess ssssfsss-mmm, ,mmm ,-gvLW5g,,5,g.5,,4x,g,g 1,7-W . 5,g.L5iQ. ,vfKm,5,..,,A.,,wM-.L1f:,,ewwmmkfmbzMeg,twig.,ff,,.f-..,.,A,,,,1f My Q, 'W 5.5 A M,wwfIV,-If-wyfs,,l,,,,,f,ffgziyykfgzifZi,y,,,,:k,,k,12m,,lW-N1fsmxziszzmsg:Q ,g-Q-rg,-M,w ww :zz :sww::f:::2,A-sz --Aw M lfgmgz fax gsm gm, A.gg,kfm,,Q,1 ,V-.,-:,M::,z.ggg MSM ,W3,,l,i.,,4.Nmm5 mf 51 z:g,f,,g,,f -,f-:Q ww.: Qmgfixmmgg .,-,YW -1 ew ::w.w-fsfssizssizf'Qemmf?1f-MmmwMfX,S,vWQ,.15,Mg,my.Wf-zr11.,z.1fffwfmW Y. V ,fmfmfsw-gf,-,M-,lyZIX,-Xiw.fy:Q,,mSiky,,l,,f,m,,f-ea,-ig,W ifmyMg,L,g.,l,LqsgfqgfszMmml-mfs,-:sz.mm Q 11: fwvmwQ-Aw-wifi'-fgzmmfw-sw-fffwlf mv-f-wfgzszifiiwwiffvf- vf 1 fl 'iwgfw:m-if-.viWw:W,gv:4,.13,vffwwgilfgefzgigwgi'Af-,.f1g,W1mymiif1gX1lfxfggggsgiiwfwyfLwsg,wgQuiWWW?3:1,:,,,5ggf,-V,MyW11,55t5,3QM,ff,f5gQglggvsyiigifw.,-M21-MQ1Q,115-Af214w5g.mqgmg::affggfvgmiz-.fx,mfwi.Mmgqnfsvgzge91912132215-ww,:ff:pswz,s21L-swfff ewQsWx,:mwf!Sg-W wt W Q2 7145! -fHz1sf1ffw-ff ins:- M, M-5 1-,WM1,1M,,M51. WM,w:f,,wm,mHmwf,,,,,, ,mi Wmwm fx 14 Qfwz WWW, ,L-5,-iv,,,,a,5,,,.,12.,ww:WW fm,fmwgwiw-WW,wh. ffwu my,.W,,,g:Qf-.Jwwzgmmk-ff'ff::fv:wAwwww:fm:-Lg,-La M f2-f2f.fffw 1ff1- A wmgyfsavza-Q 41,e2:.m: mmf-mg., W .L Mm- f wmvmggmmy-SHN 7- ww :fWm2,AfQ,,M-vm ,, ,W ,W3,,L,,44,.Nfmi,,,i,,,Z,,M.i5,-1 Z,,.Q,,v,kW,,:,.v,,i.M.Q,5,,W,M,,f,,5,f,i1,w,f,w,w,w.m,4,gg, 3,-,i,,.5i,,-.zMAff,,.m.fn,ww,,Ai-,,,,MN5-,w,3-,IQ-My-.f --,lww-f-1:1 X1ww-f'--wa-fsww.wmff W -vfmwwe-Wf ,--feafmwff-,,fw -1 gy,--Igmfffi -fm K1 X115-lm-iw W fm:fz,Kf--f'-:wie-'s ,ifgwssm ,W ,lf-,f-gLqg4,,g.1Q!faz.,,,fg,f-.,fA..,L.,f.V , 19,m,w,gg,,,.s,,f:Wz W ,W ,f,,.Q,ff if , ., was mwmmgi ig ,mg ,ff,,,,g,,,,,,1 X, W, .,,1. -f :v:s:mfQg-gig-,WA-sw,--fmw:Wg-a-Qs,:Q1:w,fi-U-:Wf fu- 1: fllw-wsvfam gif-122-Qwrlvll-H'1 '-sa-wwf'-1:'-Fifi-ek-Mwzffxslfwfzwk-fffvll 1ffi1f11f'S -Aiiwllv 75,25-,L1MMex,wx, -, M Wi, Q- ..M.mw MM-A-,,.,,.,g, K, ., ,,,,,,-m,:w,,4W .L .L w i, .,,m,M,1MMsW,J,WM LS, ,,M,f,,i M,-NjKMfSs,W,.Wff.. ygwwxsm. ,W :ww-mwfla ,W A W 11 -N -M521 .AW , Q, Q, W,,,A ,m,,,,M,,,,W,.X,,gm,., ,L,X,A.,ff Lg M .ML , ,MM -, ., M WW. ., ,.,,,.M..,3, J. ,MW , .wfmffsz .Q W,L,,WWWfA,Wffmfxz,f M .W ---- 'swf A my M 127 , A-:W-Wmff, -W ,WM W, ,fXXz,fw:,fwAf,Hf,m ,N vi -S., i 1 ,,s,,,WX,1 ,1 , ,,Q,N, k,,.,3,A.., ,,.,m,W,,..,,,,..,.f.X,:W M, ,V , ,.m.,m Mm, ,--mzwm-V ,gf f 1-.f ,lf A- 1 W- mfg www-f -ww mzfmmww ff 9mf2 Msg- WW, W- M . Mb H . ,X .ww--5,I-2,--x,,-m.m.mLL ,WA,.L,.Wm, .... W.W,,,,,,,A:WE ,5M..,s.Xv,X..,X,,,,g 1 ,XM,,,9LN5,M,, g,,km,k M ,W .,,,. .L W ,A --W.NH..m,AfS,,.m,,vLyW,,,.W.:,L.M,.H, A . ,.2,, if gm-iss Mfw ,Wgff,-w.5-Lyyylyillgfsggg,-.3is www ,mx,Wfwgwwgiff Q,,.,ff vga,11-gflyfwz--wx:-. Mmifsm-Lgpfqg,,g,1fgfwggQWwwgy-wma,W -,IwwQs,fysyssgggsmg-4.5:gqffwqgfwlqwwmm-IQ'gm? vi-mffaq-:we.asffww:fLwx5:1 5.5127''swf-eviw-few-.wgr-IA-fw'fwz1fss:ffamgilfmzsmszw mm. . ff: zfzsfp 33 if 5i'2vWf'f?L2' 2' fi! if fs' ,gigwf :ii-'Eggs -. W im ' ,f V5fw?Zf3i22?FSL1: -97 if gQ5'?l-:WL - Qs -fw fmfwwibf ifizggwfg. M :fm mf - 1fS1 1.f .,1 f 1. , Lg, , Qmfkif 4 SM qu Ln N 5m fswgglixggssfw my 5 Q 1 mrzwz fx Q- gf QQ 'WWA gf 5154 g wz.:fm1-my fl mu. ffhfmz, :mu 1115 :ff -5 Www M1121 we 191, 1291 15,91 f2's,1x2?' z:fszw1f5:f15:'w:fzU331 1 :y,ff111Qg.1Mw .,, .. , ,,. z,595Lsxxt'1w1N ..,-'mg'swz?2Qfh Q wmgbm MWMM, LX,.,x,,1X,liE.v,,,f5 gm .3- is A swam.9wLui5zg,,5ff by bf gp my ,Y HF, J, U mmi,,,,, zmffi' 'fmew ff: .mms 2 4w::1w,,, M233 ii: Syma, .Mus 1 mf: he fixiaim ,, i f'1-fm14e2?Qm5r,f ' 1+'w3f5ZfHY M5425 mg, mu Aw .wx Egg? fm My Q L K Q so w Nm Wm. Q mm fx ,qw fm L sin A1 N Q 1 Q nw f 5.5 fm f K Q ,Q 1 ,Q wh Q X is 11 S 42 43 fx N K K X fx Q IQ ,K 'kg 2 N wx 1 4 1 hm Q fl is 8 ww S K K QQ 3 Qw wxm Pl X Q 4 we Qu W 5 ww fa ,N my xx xx X se Q, H Q m Jggw Q Q n bei! mwpxm 1 2 K S nw mms 'Wi3?fs???E5iiff51f'i?1??Zi?f3s5Wg:Ef1Ss22355 f -wr fm W Mi,ms':f,,.f, ., ,mf1-,.1- ,2f,,g2g?ggg,g Mez-:xg Wm. ,, . ,,,0,.L,, .V ix: Hx if: Q 15:63,,3gm..,5wi?. 155 ,UW .sf fm- mtfsezv -ew fxzkfxzzsxwzgraz ..., Q, wziazffaxingXfdfsskfizessw my -.mm QV mf'-my fxwflgfid ef -sw -sw ax E 3,367 wwf. :fm -. 3 zs.mM..v .zmmm 12 Mwmy. aw -A 1:sfwrAm-fwmffwmw1m1 1 1, Ls, Lx, Am Lf, mx, w,QgM wuwg ,,,. T w, ,M ...,., 'SV' niWiwELgfsz'fs ?s5ff2f'QwfseS114ft5?Q WDP- m?'Eaf?mg:msz,' s-zsi?EliSsz iw 'i'gsfsvW422fu,f,,,:aw iff?ifwsisisxgfssiil V5522l?iFiii,:QT?ELE2i33iL . wx ..,,,. ,,, --.1xQ -as M iw f-M'wf'fs??igf.'Lss,m, :wax 14 seg fy: msfmx lg 1xfw,f2311mQumm -vi? ,,f.. m:,.1mw,v ,3,s2z.sm1w5: msg, 2 M KU mv: ffwzfxmnfsmfsy.swis 'Z -Sfwfvvffswsimsw swvgiwsz-.s4f11fM5J ..,,.fwb, Mx.,w,Q ,,,,f,,m5 K ww:-fwfsgggfzmgsszs 'S as ml. 'L my A ,. LM mfszufsz xx, fx, .m:gm:,us?:av,1N 'W'sissff,:ma.fwQ1qmgfmwgwwwggmxfsgsmygl 513552352354zggssi.i'f1L-wie?.f:t2a,:f'xtw.s21.wz5NN gwqbgm M2,J,m,,s,,,x ww, W- - 2, -s, ,, ..,,.. v,x..M, N W ,,,,m, .,. ,,.. M ,. ,. mm, .ff,.fq,A.M, M,,v,,W..,, ..,, gin, ig, .U,WW?,,,,i . .,,,,, A -fm Q: ,.,,ff.m ,Af Q ,,m,,,W. Q. ,. . S ei' if . w - , M. , .?5,..V, -Efwsilgw fwzwwggvygwgfggexzefzqswwww? W 1,maz.fqz,f , msg, LQ M wwwfmfffz:1xx1.1x-mygsiwswiz-.ffwk Sim .,,.. X A...K , ,,,,, W2 ,,., yx.m,,5.,w is-Lpi'E,..,,..v,.,,,.. .Mm W, Q,- 9? L ,-,,,, , l , , wmsfzzgfizisx .. A -1 W1 Wm my A wffkewsmiw :yy fm rfmmi' ,ix fx mi gfww fa-fm yy :gm 15, L, Aww-w-W W, ,M ,.v, , Z, ..,,. is ,,..,,.. .,., ,.,,,. S . lg .H . 5. ,wg ., 1 S fwyigw QQ-1555m?wb M5 is sa fss,1w:wm,m ,Lf AE :wL,fw1Jez1qg gxmwyl Q5 - U swim, wwlgwllmvk-lfvk-wvk'1sv wmfzmmsngsx s1uxx1e,..,,, -. ,M ww?-.M-sz W m ., , . HQ f37iU9'f95'i?99 lim xs,..ams, ML ,f , ..,,,. . . ,,...,,..,,. hw, MX, Wwbiwwwfgsg .. ,, fssvfxgikgwgqgiggsqggm iIii2?f9i'sx6f4atf1i,i1i1gsK W. W, V, ,X wv1ww-- fm .W .,,,, , ...,,,.,,, 2,, f'2fZmx1ls9Yl'aU?.f?7 ,W .W.vmf9 F4 3Z w'WfSS-'M' i,1s1ff51gs5zL,sSggg2z,,wmT?fg?Es,?1fs 75 mywwHww'fmv-fxzwws., ,. ,. . Ysgiwzggfegfszgsssfgsqg mmm 135 VS K vs in SK 'SIQWSES s X S E H 1ff:w1:,,71' 'fi Wm zz iw 'sez ...X N, ,Q S 2 1 :SMSM ,,m,.k:,,. ma HX V::3:gkmz, ESQ? 55? msgsesmimggf as vw my K X W 21 aa mm Sq Q hw V Q W Bmw .3 H Q Q X Q on Q 2 J wx Q xxx: X ,, www mg X 5 ,Q ,K :Q X, fe YQ wig: F QM xx fm my wx 82 My Mm. mm2w,,4 Q ,,L2S'S,12w x H Q gpm K X Awww K an N X -Q Q X K ,N aww is K X ww gif W J Q3 ws xx , Mm. A ww my, .gd K1 xx K was fa Mm mm'f..6 awk 1 vim M, we Q K wx my w ,ww vw as 5 .3 A an ww Q, mf ,2 M QM fm X X Q we 3 sms fx Wm X2 Q K ,I 2 L ,H mfr ,fm 4,5 vw asm 4 Q hw 5 P 210.4 ,M fa X 9 f S ms w X S Q Q MXH Q QSM , H M XJR' xfcmw wx ,hx mm 813K Mmm QQ mms H M fi My :ms X 5 www W mmm, 5 Q wmmmkmi L X f X snag, S as wa. U Km 91 Y Q fm N my sm fm www am www W , W fx X is Q X in xx mm ,fimxwxyf S' X as Hn Mm X 1 mm ww K mmm, M M ww ,Q kwa wax, aww? 5 hxsmu pmkfmm Mr use gm mmm sm m M M we Y K w Q' 31 My we 5 Q fs B4 9, b H Xa me Q Sw if x ,K www 9,5291 Sm, ,, mmfmaa qw-,ax an ,N awk xxim :Aww Mm! Kwai 5 ww Hx xx w K 1 Q ww 3, Hug mf vw we Mg L ss S mlm Q mx 51 Q 2 Q K mga waxy B is Q ,G Q 5 L L Q is fx ag sw an Y. Sym aw mmf., 5 immffmw 'S Sm vw Q fa, I' S xr Q, sf fe ,K fx K x vs Q Hx ,,, QM 2 mugs! y, f E gf Z, ax hm 2 , S Q L 2 K fm xg QM wp We 925.9 8 ,mm sg Aesefsiaxsx Q an ,xwwfsazfmfax ,mx may S MW we N N 91 X Q 2x N L, nam Y H as 1 sum Q fm, in L 1 Q Q 1 U Ufaamsx 1 Q 9 xx X Wm ma., 94, ay N S H2 Q w L' K E Sam K 2 K J U X 353 W mx ,gm m 3, K fs S AMS ,I wx 5 Q Q is my -M, fa 3 Q' QPU Lf 5 MQ gym Q, HW ,M hw ,faqs 9' Jimi X Q 12 E s A a Ks ff Q vs Exp M fffx ,wma WW W in 1 3 J is , 1 is Q me Q wwe S W M L S Q S Quang is is K wwux SIU K 3 3 ss E 1 1 3 N Q pm w GRM w w wx Q Q fm. ww dm s 3 K A X 91551 wx gf wx sw Q M' is Q Pawmw A 1 X fe Ax iv S X Q 5 .3 31 Aww Mm X Nm 5 we 3 SK SJ' ' 2,, f fm X Q Km ax X mm Q S N fe Q N mx X Q M, K H Q my Km M mg X Q S 1 X gx mx X ,K K in ww! H 5 N 3 xx ' Q2 ,K Q S 5 sex ZX Q Q 5 X35 ,uxgsgimmiwx Q H Q 3 ,Q ml m My is fsikaizwix S S ww KL W Q5 mifsxm Him 2,353 2x xx J W X ,Q Bn Q S1 91 mx 1. Mu TQKQM aw wx Ms K mg, HW Hmm a Y as as E www fe ,G mm sm is X wx mm sw! 5.5, X Q2 Q sm fx Emma K Q Us fx Sv glmmmx M13 aw P may Q fmmmms X xx me X H of M, K Leaf' Vw Pfam M M, X wg fm mf, H, M mkiwg H mm 5. H ax as mmm fi 23 522928 pf me Z 3 sg ff ,mmmgig w X ,K '5 3 mwss K Kd mswfg as shaggy fwxf A M K s 5- , S 5 in v www se W Sf X xx Ki N S1 ww S X Q sg Qxmm, mx ,ff WEL, LW., 1?5214ez1m Mel mm 1'-3452253254522 1 xx S mx, fee, .. 5, WEQ .. , wg, miss ww 3 wa ny, ww awk W fx few s wssymmmw , ,.m..,,w3s,f, , ?z W. fe -.fwifms-ata, 1 1, f2M,,'-,f-s.xf,, 1 ,, fmwx-f2m5?q:M5?fume:f:s!Tfx?Tm.m5w1fxwxa51 Szsfgfsswi-9'1's2i ssiagwzW-sez'sssiggszasswf-:W Q1W-.fwgmww lgqfgglgsgxw Lgmsslssmi, ifW,fm,.n, few M,.m,.fm W A lm, iw, s,,am1w-:H 'Hwaz.xx.1X1-fXfm1w1115 :mi gy, :W 1s s' fsysmgfm-:ww:mx:mmmmmxqww fbfgwhfffkwfzm5-X9'f3iS?Z53?ZE5isll53ES?ES5eEQ'fXi5i?5l5iQi?51l?v 7-sssxfwgifsvifmz-ffmwxz1135251151Us--fix-.mlsmiwig! ,v,M1.wif,W,f5w ww fsm1.m1.mps1.m-Z mggxw-IM fs, mmsi,mi,Auntie--921-wT5H1f59:'Xfw New :viz ':. : 1-zwz 1:55. - Aw- ly-wwf-wfgf1g,2Qf2,.f2f QM ia' -ff Q--if IQ- wmaef-ff:ffwgfs--fel-55,LsQ1,ps,--ff-sws7-s-ASM' N sw fs A ' M 'WS-'Li--'QmF'ie,a9EmMs xx: 5m'ia,f'3Ls?f?IhIN35's'5'fQ5 ffmwffiwflsswai-fam,fgx-.qyifsmxfixfmg'ifg::gggfxgqk2,qw!2 fx: ss, Aw wx-fam,'m.mm mg: ,ngv,w:.2,,, ,mess -Q' fs!-mwmgwwmz fmx www- X X Xxgssksgsszmwwgfsswmmm- .55-Mg Mg img,IQ-fQseggssigigsegggsgggiixsigs'eas5gzf.gsfgsg.gg5-,M Q?wg,,.,,, ,SL ,:k,,.L,,. V ,.,,..L, Lb. Mg, L, M f- we J W av wx fy-my'Q-famw..-f.,p, W f vlsssvlwsg fs:Q5QQ4saxizwas-Amaami-,gfaxmw2wSz'f ix, Am .www -M--If-W Ls, mf WW, M, Aw ffwgyfw-fig 1-smsvfesfesifssxZQ2QQm?aiss:zEiws5?QQg,EiffiQz fe Q X u wg mysmfxiw M ,K as X mx D S P' , If Rs y D, W KM V XS! 93 KS S mx .5 K Q Am ,X , S M H, 3 2 ,Q Q ix SB 18 5 al. K K H X Q, wmv-fszz W-35? EY X X fx Q X fm 3, H Q N. mfg PK X xi X SX SX X mm 3 ammmw, NA ,A X K me Q mm mm ex QE sm my we mm Ss 3 Q 2' 33 is W mx ww ff W S LS Qi 91 E MJ mfs 3 4 B sign 4 gram m U U 3 3 fd zu K ,id 33 SK V ,Q ,Q vw A yd 9 5 51 JK Jaw 'WK 31 mx M ig 3 su W S Lf m H .4 an 33 1 Xb in M V 9 3 fs in sm M, wsu wg Wk! HH ml K ag 2 in wx gms H fm yu U M 3333 mm 3 md, M xx 'ima Q M M 3 3 ww K,L mfw www X , M., mf bmi W lx? ?x :sm H. Km M swf an aww vm xi. 3 is S 91 :Q mx K 5 WK ml mf., wx ef N341 fm! 91 W f ,eww wmv ug ss aww 33 Max 33 2, W v sm xg , W ,B as KM Hg, SU? mfvidsx 3 , wxsmm S 3 dm Sf, fsffmmaww Q 3 1 Km Sf 25 SKK mmm JH me Sw 2 v b QL NWS, Q fws+ ?'f'Q 2 X mwffa, X Wmnimsmymx rw 2512521558 1, 12 ana :,Lsw,w, mmx fmwgxg sag ,H +8 Wwe mes 4 MW Q we X R, X K xmgg sm H W dk N 3 2,, 3 PE ww Q M L wfaawfk imp X fmnmmim mm ff my ,X 3 W ymixis 3 K 3 sa 3 gg 31 ami sd 3 W 5 is em 2 iq fm im gp! fswisfsxssfwxwq, S 5 xx ,bp suv.. sw MY' Xa 'Q Xgfww Mgy N Q, Nmsmx QNX V 2 nw we Su 3 S U1 s QQ 1' my , s2Qm3x,m.wm mg A wmv mmm QQNJK' ,mf Wixxq, nm. Qffk, 3 Q 3 fl H 3 N Q M, Q85 M sf 3 y S ms: gag 2 S Q ,www mmm S., my wgwsx ms am Mfg igmmwmmxmm ,www 2 ,mm A H 3 is 3 S1 y WWSHEKE fmwm R 1 mx Q mmm ww mm. .K V1.4 M Sf N WH xxm wigs Sw 'Q' vw 'wma me 134 3 me 1 is M V5 N wily mm X W, 5 Q Sims ,mug B wmv www mm Q , mapa. Ilif-Xwxxx N sm :aw H up '55 mais xx KB X w?M.m mfiww W QR vm 93 X sxxsx as W N Z mem wg eww bw sw Q mm, X my X L23 Sw 21 9533? sm K aims 3 3, 3 Kfssiwmfgmmnx, my ing, Wgk fqmmmm W ,5 Sximm BPH, wma ,mm seismfg QM QXXQMMQQQ S ,N 2,1 Q Kew 5, Q ms mx w ima ax wx fm 3 6 aff? Ly 333 U mwgfi .3 A 46 A. N ww R 5, ,Q 3 fmsfmaf UK ,, 2 Q 5 M niismxe Ss 29559, QWQVQZU Q as 'mwfqxwxx mg 3, ,X 3 2 Qi? HW Q M, M, 3, V 5 WX: ig in Z if wx 33 Q ,Q 6 ,N 11 m Q , Q 3 3 W m m 2 Q 2 my 3 fm ,X aazaww mmmmfn Q 2 K af M S sa L 33 3 L is K al fn fx XS V 23 S M91 mgmixrffa QW D, Q Mx 525 2 'H W M 2' 2 mx fm 3 gi ,X mnxzr 33 3 Q ,Q Q , ,Z 5 fs H xx K sz me ss 45 4' as is fsxzgmwm X wmqgwgggwwx W we 5 xsgxgw,,,,mQ 555598512 ff Q Q Q Q 233 , ,M ,K S fe mm' 'X H' L2 www S. K f4fH'9'ssmovmsfw cs X 5 W s 5 Skim m9i'qq5'.,5Hmk,g51?K1gi bg M 5 Km 16 wk XX wk N fmH.mwm1,M,a W 33 X .4 X H am m W VV W as K ,cdwsmmsgfskmxwgsggm ,, Ss fx mxggkf' fg5x5'VWiiLxxexxxsx2,9' Iss! w ,MQ vsffgi A L, 9,5 09' mm em H1 5 1835523 K1 Q, ai as sm mm S 33 B1 fs iq mf sl K1 K fx S S K w fs 33 K Q m X58 maxkfimgmfghfw wwfmfeyesx 3 X311 , ,X53m,wm K 'H H Q mx 33 54 Q gi 3 ,H R1 M wumxmmmw 55 Mwtghswxisnmmxu Qfelmsfsfsiws SMH X H Hggx J am m nm 3,25 ,gow X N. w K W Wm xv sf a mrs my 55 51 mgxgkmgigggj mga X Mwwfwfw JMU QS X 5 2 w,g2,w,w fmmxgxxmxxjzm as Uvwlfslfsmmm xxgwwgwimmwmm mmm 5 ig Wm ma X xx, ,, M HH Q X WW N fx H HH ssxmsmsmi KW F K was wx K HT 33, as W mg? mf, Mg M Q B2 Q X X Q, H www MM, QNm,wa,m W hi SK Y ,S S Qfmfmvmwwww XM M W!! 2, X 'Y X 'gmri ff S sf ,Q Hs! ,, Smvwwmfgn JM Q S mg y me msg, ffm Q, w ws awww K K K Q ZW? my fm Q W W , mm xx X3 95 51 E 5 U, qmmis' AS WX R' H Pg 5 F K H5233 mm ,iff M ad 4833 fx H wg, W QR , Q S N ' X 6' M wwsgm mass Www frswwm X m2u,kg,3 333 gig mmm, S xx 'WW' 15x S. fix M Vx Q if sf en Q 'S Q 5 Sn mil sp mf N331 Kwqiqiib 3, www? 6 92.3 mm? mis X im 3,5 ,en UJ5q,f,,, Q, ,fm is in Hg, S ,Q Q H M Z X ,N K ,,x 5,83 Wwe fe mga? 23 X W N ,Y ' 2 .Jew H 1 QF' 2 wg 1? X 2 Qfwgpgw N wwqx , Hmm Mm, fwmi se MW Ms, ,-G .ha ed emories ADA TING, CHANGING, AND DISCOVERING ome for EMHS is a community of 4,000, settled between the Chuckwalla and Black Eagle Mountains. In the years to come, what memories will stand out in our minds when we think of EMHS. What aspirations, triumphs, and fail- ures occurred during our high school years. Hours invested, money spent, time lost, lim- ited amounts of sleep, the continuous cycle of exams and finals . . . a weekend of leisure, enjoying the opportunity to catch up and get away, down the streetf' the parties . . . or leaving Eagle Mountain behind for a few hours. Intense emotions joined closely with high school memories . . . friendships made, friendships lost. . . feelings experienced when aims were achieved or disappointments felt when goals were missed. High school years . . . a time for adapting, changing, and discovering. Learning both inside and outside of the classsroomg events have shaped memories: A nervous first day of school, hectic finals week, long awaited concerts and plays, team victories, home- coming pagentry, the mine's layoff, election and inauguration of a new President, a senti- mental commencement . . . all dimensions of our campus that will stand out in our minds. 4 Lake Tamarisk moon-rise. A A quieter moment: The EMHS office and Senior Quad. A Mr. Samuels relaxing. 5 Students enjoying a few free minutes between classes Fall Preview 3 4 Fall Preview Stars in the Sun NEW THINGS UUTOE THE SAME OLD STUFF amiliar and new were two common denominators for the 1980-81 school year. The athletic season brought formidable opponents with the formation of a new league. Adding to the community,s popula- tion was the arrival of new students, families. With the exception of woodshop's Mr. Ram- sey, all of last year,s teachers returned bring- ing with them new approaches to learning. Talon 1981 volume contained new ideas and traditional themes. However, several traditions remained including the Senior Quad, Homecoming, Prom, Spirit Week, and graduation exercises. A Juniors running rampant! 4 The daily routine commences. A Sandy Carson illustrates a new version of the swan dive. L Summer Sunset. I -Vs w Y Q Fall Preview A5 ,.. 4,,,,,.,-, , ,AAW ,,,, Y A YV W' V P H Something peeial . . . the First Week of School PERSONALITIES TA KE sf-IA PE! 6 Fall Preview A Scott McBride munches down. A Between football plays during Physical Education. L To Many, the first week of school meant getting close. xcitement and apprehension were felt by Eagle Mountain Students during the first few hours after a summer apart. Teachers and sponsors were introduced, and the schedule for another exciting year was revealed to us. Football, volleyball, and the Back to School Dance were some of the events that many students encountered during the first week of school. Preparing athletes for the football season meant long, hot hours of practice, starting two weeks before school began. Immediately after the first day of school, volleyball commenced, with the girls stretching out summer soft muscles. Eagle Mountain Students came together socially during the Back to School Dance. Personalities of each class were evident during our first successful dance, which cap- ped the beginning of the 1980-81 school year W:-H n' 2 i N iywf - M 2-,rf 32:1 2553 ' as1aff'2ii2,vfa Mbfsziws, if Confusin Times . . . CLOSING O THE MINE SHA PES STUDEN Tsffx TTI TUDE he shut-downf' These words cause different reactions among EMHS stu- dents. Many students were concerned about where they would be the next month. Some students were glad about the possibility of leaving. Others would have preferred to finish their senior year. Faculty and administration were also affected. Finding new jobs is not an easy task, for either teachers or mine workers. Knowledge that the mine would reopen in late September helped to sooth many individuals. Confusing as times were, the 1980-81 school year would bring many rewarding memories. A Up in Smoke: Kaiser Mine back in operation. A Heavy equipment. 5 Aftermath of the 1979 rainstorm. Fall Preview 9 5 1 3 3 1 Bum , Set, S ike! Rico ous TRAI ING CAMPSHAPES THE Moo ifteen points to match victory . . . a i partisan Eagle Mountain crowd . . . six butterflied stomachs . . . On defense . . . a serve skims the net and is cleanly bumped to the front line. A set is positioned and a screaming spike deflects off an opponents hands out of bounds. Cheers, confidence . . . only fifteen points away from the sec- ond win. Bumping, setting, and spiking were the basic skills demonstrated by the varsity volleyball team. At the beginning of the 1980 season, seven of the girls, fresh from a week of rigorous training at the South- ern California Volleyball Association Camp, held at Chapman College, eagerly polished and perfected these skills while helping others develop theirs. The close comradarie of the team members and their determination to win, along with continuing encouragement of Miss Karns and Mrs. Weitz, the varsity coaches, made for a highly productive season. 4 Anticipation among the Eag1e's varsity is appar- ent as Vonda Scanlon spikes Serrano. L Emily Sherwood's spike clears the net. A Saving the ball, is one of the most difficult of volleyball tasks. L Patty Casillas and Bobbie Rose block an oppo- nent's retum. Fall Preview ll Y Volleyball is similar to chess, each move is a crucial play. L Up, up and away, Vicky Yates spikes Needles. Y Sometimes bumping the ball with your back to the net is just as effective as a spike shot. l.V. Volle ballers Build a Future TOUGHNESSAND DETERMNNA TIONDETER OPPONENTS dedicated unit of disciplined J V Volleyball players took to the court during the 1980 season. Victories occurred not only by winning matches, but also by having individual players meet personal and team goals. The JV and their coach, Mrs. Grover-Casillas, shared a special closeness during thrilling game situations. Toughness, determination, and an optimistic attitude propelled the JV team through a spirit sea- son. 4 A beautiful set can be synonymous with a gracefully flying bird. A Dinks are a deceptive type of return. A Tricia Fostercrouches in the ready position. Fall Preview 13 'sv -1-A?-'1 - ' -5 ' ' 7 +-- - 'f-f --v --'- W f--Y-4+ -f ff I f , . '. I. ' 1 , I I I V W, l l Y K 5 l Break to Dajvli ht UNDER,AROU D, ND OVER. .. OFFENSIVESTRA TEGY TAKES SHA PE agle Mountain offensive strategy is clockwork deliberate . . . to run under, around and especially over the opposing defense. The bombs and flat passes intercept the fan's attention, so the running game is often overshadowed. So dig out the best running back adjectives and cliches . . . good size, tremendous burst of speed, balance, and agility. There is more, a well coordinated offensive line to form the needed hole . . . and a solid defensive unit to contain opponent drives . . . Teamwork. . . Eagle Mountain returns eight veteran starters and boasts of a swarming, solid defense. But last year six starting players gradu- ated and the team's running unit had to be rebuilt. Head coach, Rick Brown's task not only involves innovating and refining game strategy, but encompasses the transforming of tactics and building a solid winning determination among his forces. 4 Brian Timonen breaks free from the grasp of a Serrano defender. A A perfectly designed play results in a long gain. L Football is a game where punishment comes from all sides. ' p Intensity of emotions is just one of the many elements of football. Fall Preview 15 Y The exchange from quarterback to running back gets the ball rolling L The Eagle's defense holds ground Y A qua terback can be over matched physically by rushing defenders fu 'W 't'v, ffl xlglf fC'?Ly QI in ,.1 . v it -fy ft 1 aan VK I Y in , VV ph- if Lf, C-ew u 'N A' D' fi' C-J jr X I6 Fall Preview e've Gnly just egun to Fight srmwwc TO BE THE BEST Consisting of mostly new players, the J.V. football team still proved to be a success. With the help of Mr Bon Tempo, their new coach, they learned new skills and gained valuable experience. Their hard work, good sportsmanship, and willingness to improve helped them grow into a first-rate team. A Lateral pursuit by Eagle defenders shuts down a Serrano run- ning back. 4 An Eagle end breaks a Serrano tackle for a long gain. A Offensive linemen lead the path to running room. CIF Volleyball: Karns, A., Jamison, K., Casillas, P., Carson S., Reeves, B., Rose, B., Sherwood, E., Palomares, A., Scanlon, V., Burdick, E., Weitz, P., Varsity volleyball placed second in the Arrowhead League. Their overall record, including the CIF game played against Our Lady of Laretto at Los Angeles Technological College was ten wins and seven losses. Selected by Coach Anne Kams as the most valuable player was Bobbie Reeves. Varsity Football: Top Row: Timoncn, B., Tisdel, F., Kain, R., McBride, S., Gray, C., Capp, D., Anderson, J., Second Row: Brown, R., Brake, R., Stanga, A., Fermon, S., Enriquez, R., Colwell, E., Sanchez, F., McDowell, R., Third Row: De LaO, P., Garcia, L., Moody, R., Garner, O., Richardson, D., Bottom Row: Ballard, J., De LaO, P., West, A., De La Rosa, G., Peterson, T. Varsity football finished fifth in the Arrowhead League with an overall record of three wins and six losses. In league competition Junior Varsity Football: Top Row: Knight, T., Green, E., Stokes, C., Major, M., Tomlinson, E., Gaines, C., Olson, B., Second Row: Taylor, M., Ottinger, J., Morales, R., Hudson, K., Garner, D., Buzzard, B., Third Row: Kawalkowski, C., F errnon, E., Bon Tempo, M., Ballard, L., Green, L., Bottom Row: Smith, B., Guti- errez, E., Lopez J. varsity football won three and loss four. Brian Timonen was selected as the team's most valuable player by Coach Rick Brown. Junior Varsity Volleyball: Weitz, P., Cieslar, E., Reed, A., Picker- ing, C., Vasquez, B., Lewis, L., Foster, P., Anderson, C., Cope- land, C., Mendez, M., Yates, V., Grover-Casillas, G. Junior varsity volleyball placed second in Arrow- head League competition with a record of ten wins and four losses. 18 Junior varsity football finished in last place with a record of one win, seven losses and one tie. 2 1 ,, ,ft 5' 'liii vilf K if :if-gg,. ,:,ei:..:fe-1212i1i,.1if 5, , 5. I kg I ' 'ffm - - H .- .. -ftNg,.j,'jgj'f-5 ff - H,..:::z' H' 'Vi :'? EE:.51SiPsEE ' ''ilWilifiiffffniiiWL151-VE?-llifsiiifWe1:?ii...li?lEiiffEi5E:'iff'f5:wiiiL.2:5zt mess: IH E - V. . , V.-..., rg ,.:.-. ,w,,,..,,, f- W... . A 2 'ei , 'ws--we 'wr 'ewant,5ge?3,etzesanzz,flass. wgesfw.:..:ff2e::-'rfQs-,W:t7ttg.sazz..1siaiswf- 4. f I . . 1 ' - , ' ' , ' i Y: S' f - , ,' C ' i gi , I ' ' f A gg ' , ti .1 f f iff W ff sw ' ff, .Q 'K f Sa Ha X.. . .Y 'E , . 4' . ' 1 ' V 5 we H 2 . We-Wfsfat ' 2' as 5- ' .-' r , - ' s , l 1 Y .. -, A 'fff' .94 M 32 ,,,, ' ' f S 1 s , ,, . ,, ,,,. . . .-s.,... A Ma., , E.M. Activities MEMORIES CREATED BY TEAM WORK r I l Exciting school events, important class and club activities, ath- letic competition, and the teamwork that goes with it, are all intrigal components of our school life. Each club, class, and team plays its role in shaping a part of the lives of the students. The activities or events that each group participates in, expo- ses members to important experiences that can not be found in classrooms. New friendships are formed, and old ones are strengthened. But, most of all, it's having fun. A Yum - Yum. No one can eat just one NHS cookie. 4 Just try getting your car door open now Mr. Carrow. A Anyone hear a semi? '11f+gr3i9s,wffrfnfmw 5 l 1ysilirlwii'ff?55Qf55f'!ll'IS'lE t IM21-flttrlfrrtlelttilfalles C ndie Kni t ASB Secreta dili entl records notes taken at D y gh, ry s y E a January session. Y Tammy Fahey, ASB Treasurer, and Bobbie Reeves,,President discuss a current financial report with the audience. Y Glendale Underwood and Cyndie Knight acknowledge a com- ment from a student visitor. A S B RULES otlce Bimonthly legislative sessions are held in the District Board Room all welcome Despite this open 1nv1tat1on, few students attended, or par t1c1pated, ln counsel meetings ASB s purpose 1S to develop leadership and insure the smooth functioning of the many school act1v1t1es Under the direction of Steve Weitz, for the second year, ASB processed all class and organization petitions, insuring that there was no overlapping of activities. Mr. Weitz was aided in the tasks by Student Body President, Bobbie Reeves, who presided during ASB meetings, along with Vice-President Tommy DeArman, Secretary Cyndie Knight, Treasurer Tammy Fahey, and Board Representative Glendale Underwood. The meetings also consisted of 16 voting members: the president and representative from each class and club. e uf aa... mf'-M-,gunna ,, A Presiding over a busy agenda ASB mem bers handle various PCIIIIOIIS 1 ASB Top Jeff Yates NHS president Vonda Scanlon, junior class presidentg Aga- tha Palomares junior class representativeg Laura Dostal, senior class representativeg Brent Smith FHA. representativeg Bottom: Tommy DeArmen, ASB vice-presidentg Tammy Fahey, ASB. treasurerg Bobbie Reeves, ASB presidentg Cyndie Knight, ASB secretaryg Glendale Underwood, ASB board representative. P Sherry Lewis puts her last ounce of energy into playing the trombone during an autumn pep assembly. Y Terry Sutton holds an ending pose to a halftime presentation. Y Band: Top Row: Vann, K., Fermon, S., V. Owens, M., De Annan, T., Bryant, M., Kain, R., Green, E., Lewis, L., Horn, K., Tomlinson, E., Lopez, J., Rose, B., Second Row: Enriquez, A., Ragsdale, C., Reeves, B., Knight, T., Reynolds, P., Meler, M., Lewis, S., Fermon, E., Chipp, J., Barrackman, M., Brenneise, C., Epperson, S., Ragsdale, D., Colwell, E., Third Row: Meler, J., Vidal, D., Anderson, C., Burdick, E., Green, L., Robles, R., Knight, C., Fourth Row: Reynolds, T., Crane, J., Barnes, N., Smith, B., McKissic, C., Hopkins, G., Evans, M., Cieslar, E., Williams, J., Bottom Row: Reeves, T., Gutierrez, B., Lopez, V., Sutton, T. Y Ross Kain and Shelby F ermon perform during December's Christmas concert. l l X X 1 76 TROMBONES xecutrng precise marchmg and manueverrng technlques while providing exhilerating music and crowd contag1ous Splflt were goals successfully accomplished by our Eagle Mountain Band Ded1 cation by a sol1d corps of student members led to enjoyable autumn half time presentations along with appearances at the Liberty Day Parade 1n Bellflower and the Date Festival Parade in Ind1o Talented Chet Brenne1se directs the entire d1str1ct music program consisting of band and choir at the high school level Being seventy three trombones short of the traditional seventy six did not prevent our musical groups from grvmg outstanding per formances at the Christmas and spring concerts Parents of band members were also kept busy this year working in the Band Boosters Club selling Halloween candy candles and raffle tickets Money raised will go toward the eventual purchase of new band uniforms 9 , . 7 ' 9 9 , . 4 Pep band members perform f1ght song after a sconng drive Y Flutists Bobbie Reeves and Cyndie Knight contribute their special sound to the cacophony 4 Jessica Williams concentrates on perfecting her performance dur ing an autumn half-time show Y Varsity Cheerleaders. Tangi Reeves and Blanca Gutierrez. L Blanca, Tangi and Bonnie Aston await the out- come of an Eagle varsity drive. Y Enthusiastic cheerleaders Blanca and Bonnie dis- play their high kicks during the Serrano game. Y Confidant varsity cheerleaders end their routine with an impressive formation. Q 4 Displaying both determination and uncertainty, Blanca attempts to raise the spirits of the pep assem- bly crowd. Y Tim Peterson makes a break-through. Y Arms raised, a poised Tangi leads the juniors dur- ing a yell competition. HOW FUNKY IS YOUR CHICKEN Words for a really good pep assembly recipe . . Blend: Spunky, spicy, flamboyant, elite teams, jamming band, kicking drill, excitement, chant and cheers, and Alma Mater. Mix for twenty min- utes in sweaty confinement . . . oh, yes, be sure to add a heap o' spirited cheerleaders . . . Cheerleading is a continuous activity dependent upon collective student body cooperation. Lack of spirit exemplified by an apathetic student body contributed to disappointing displays of school pride. As a result, few dedicated cheerleaders remained to cheer in the spring, a marked contrast to the enthusiasm of previous years. Despite this uncharacteristic disunity prior to Christmas, cheerleaders did an admirable job when called upon to represent the school and community. PP a -s a -n v U Cole, K.g Ballantine, D., Graham, G.g Wallace, C., Payne, J., Bren neise, C A Christmas concert dress rehearsal participants Gina Cannata and Cindy Kivisto, break several moments from the rigors of practicing. A An off stage joke, eases preopening night jitters for Agatha Palomares, Carolyn Wallace, and Kay Cole. A Soprano Carolyn and alto Kay, keep a watchful eye on Mr. B's directions. 26 P Choir: Top Row: Fahey, T.g Olson, B.g Card, T., Kivisto, C., E erson S ' Dostal L ' McCormick D ' Front Row: Wallace, J.g DO RE Ml agle Mountain High School s cho1r and band were kept busy performing at various musical events Choir and band director Mr B worked long hours preparing the cho1r for these perform ances The all girl choir gave excellent perform ances at the annual Christmas and Spring con certs, as well as at and graduation The tragic death of Mr Senecal, occuring the day before the Christmas Concert, prevented many students from performing with the traditional zest and appeal that 1S present during the holiday season 4 Practicing for the Spring Concert are Agatha Palomares, Janet Wal- lace, and Carolyn Wallace. Y Vocal music instructor, Mr. Chet Brenneise directs the choir during warm-up exercises. Y Concentrating on a difficult piece of harmonization are Carolyn Wal- lace, Sue Epperson and Tammy Fahey. Y Allan West mourns the death of Jennifer Hepzi- bah Meler. L Pantomimist Phil Reynolds prepares to rearrange Brent Smith's molars during Drama's first student body presentation. Y Drama: Top Row: Cannata, G.g Carlson, R.g Jen- kins, P., Meler, M., Middle Row: Wallace, C.g Evans, B., West A., Front Row: Nunez, G.g Rey- nolds, P., Meler, J.g Smith, B., Munson, L. L Backstage director, Lynne Munson cues on stage ' R pantomime performers. 28 PROPS, PERFORMERS AND EMERGING PERSONALITIES Eve seconds and you're on . . . Drama, under Rick Brown's tutelage, emerged as the new class on the block. Successful October pantomime programs led to December performances of A Page of Destinyv and Rise and Shine? Acting is the main fine art practiced in an informal class setting. Each student is encouraged to pursue his! her special tal- ent or desired field. Making faces, creat- ing and setting props, operating gym lights and sound systems were necessary activities that insured successful perform- ances. 4 Statue Mike Meler overlooks squabbling picnicers, Phil Reynolds and Gracie Nunez. Y Co-workers Phil and Roberta Carlson share a pas- sionate moment as Brent looks on in pain. 1 Brent, Coni Mattice, advisor Rick Brown, and Lori Glenn makeup their faces afer a demonstration by Jan- ice Goldsboro of the Mary Kay company. A Hours of precision-practice pay off as drill members leave the halftime performance grace- fully. A Gracie Nunez and Michelle Richardson dance to Whip-It. A Drlll Team: Top Row: Wallace, C., Richard- son, M., Second Row: Gonzales, R., Graham, G., Olson, B., Fahey, D., Peoples, L., O'Yates, G., Third Row: Ballantine, D., Fahey, T., Rich- ardson, M., Kneeling: Nunez, G., Patrick, L., Sitting: Mattice, C., Garvin, T., Cole, K., Wal- lace, J. L Melinda Richardson enjoys the Homecoming Parade. 30 ' 2 s YT MARCHING TO THEIR DRUM he ad read Wanted Seventeen spirited dancers Requirements must maintain a grade point average of 2 0, may belong to other organr zations that do not interfere w1th drill perform ances and practices in April s tryouts Camaraderie ran rampant as veteran members assisted those new to tryouts Programs featured routines to various disco jazz, and marching music Although primarily mvolved with performances, Drill raised funds by selling candy and peanuts, showing movies, and periodically washing cars Money raised was ut1 lized for uniforms and an end of the year trip All high school girls were eligible to participate r A Practices held during activity period, after school, and first perio dinated presentations. Gracie Nunez and Tina Garvin show the ha some leg. lftime crowd 4 Michelle Richardson performs the finale to Dim A11 the Lights. A Lorena Patrick leads the way for other drill team members. 1 , Z A y 7 . N f rv jr X 1 f lf 'x I '- r I ,Z ' ! m ,Vg I ' L L ' 1 J d, assured coor- RESPONSIBILITY THROUGH FIRST-HAND EXPERIENCE llAstronomica1 best describes the growth and respectability of the after hours 4-H Roadrunners, Involvement occurs as an outgrowth of animal breeding and training. Animals raised from infancy on borrowed bank money are primarily used for show purposes, breeding, and slaugh- ter. The shows are held at the Blythe Fair, April 9-12. Judging is based on the grading of animals. An excellent animal receives a purple ribbong very good, a blue ribbon, good, a red ribbong and for fair, they receive a white ribbon. Hogs are not allowed to at the fair if they receive a red or white ribbon. Roadrunners show their animals on April 10. Ribbons are based on the owners showmanship abilities. Purple and blue ribbons are sold on April l, and on April 12, awards and checks are distributed. Although hard work is a 4-Her's trademark, members gather for hay- rides, projects, dances, and bake sales that benefit their education and the community. L Bill Evans prepares dinner for a projected purple ribbon razorback. A Students learn through experience Tammy Fahey repeats an every morning rit- ual of preparing feed for the livestock. 32 LEADERSHIPAND SKILL What do you have in common with Bo Derek, Eric eiden, Miss Piggy, Walter Cronkite, or Reggie Jack- son? They are all homemakers, and so are all the members of the Eagle Mountain FHA, Future Homemakers of America. FHA's purpose is to develop leadership, sharpen skills needed for the job market, and widen the member's circle of friends to include young children, the handicapped, and the elderly. FHA in Eagle Mountain has involved itself with the community by offering a free babysitting during the Christmas season, and readings for at the library for the Saturday morning story time. They also collected for the Heart Association. The members of FHA attended several confer- ences to meet their fellow members in other cities, such as Pomona, UCR, Sacramento, and Riverside. FHA is not all work. For play they had several holi- day banquets and took several fun daze into Palm Springs. Overall, FHA came alive and became a respected 'organization on 4 Patti Jenkins and Donna Owens discuss the merits of purchasing a FHA candy bar. Y Patti and Donna plan future baking projects. Y Patti Jenkins and Brent Smith discuss Date Festival entries. Y NHS play practice involved rehearsing several eve- nings a week. Agatha Palomares and Jeff Yates read their parts from the Beautiful Beulah Belle. L Jim Anderson munches a Ciro's pepperoni pina dur- ing a NHS outing. Y NHS members clown before viewing 9 to 5. Top Row: Jesse, M.g Anderson, J.g Middle Row: Alum- nus Eisenhower, B.g Karns, A.g Front Row: Burdick, E.g Reeves, B.g Knight, C. 1 Among the many Valentines gifts given this year were N.H.S.' annual carnations, Emily Sherwood ponders who her secret admirer might be. Y National Honor Society: Top Row: Knight, C., Underwood, A.g Yates, J .g Mathes J., Anderson, J.g Jesse, M.g Meler, M., Dostal, L.g Payne, J.g Front Row: Carson, S.g Palomares, A.g Meler, J.g Kivisto, J., Scanlon, V.g Burdick, E.g Reeves, B. Y Jim Anderson and Jeff Yates sort cookies for Thanksgiving' delivery. GRADES COUNT ebster defines club as an association of persons for some common object usually Jointly supported and meeting periodically Most schools regard their scholarship societies as groups deserving recognition for their academically successful students Unlike scholarship societies NHS maintains higher standards of qualification by requiring faculty rating in areas of leadership citizenship and service Over a period of seven years Anne Kams has transformed the image of scholarship society to that of a closely kmt club Although the rigorous entrance standards remain the once inactive group now sponsors several holiday cookie sales and delivered observers for several months Service activities include ushering at the awards assembly and graduation and putting on their play for elementary and middle school stu dents Their activities create funds utilized by members for leaming experiences and fun activities Journeys to Los Ange les first run plays and overnight accommodations at the Kams residence in Bellflower are annual activities in which the NHS club engages VV -.. ,, -- Y - , , 5 , , Y 9 POETRY, PROSE AND PUBLICATION Nl nk Blots , Homecoming Programs, and a tour of NBC Broad- casting Studios were several of the activities engaged in by Pen and Scroll members during the course of the year. Diligently working members also held bake sales and took tickets at football games. Combined efforts of the members, with the guidance of sponsor Phyllis Sparkman, produced an excellent Eighty's Homecoming Program. Published annually and sold on campus, the Ink Blot presented the poetry and short stories created by the club members. Services and publications provided revenue for Pen and Scroll's activities which included an autumn tour of NBC's Burbank studio and lunch at Universal City's Victoria Station. A After a tour of NBC's Burbank studio Pen and Scroll members had lunch at Universal City's Victoria Station. P Eva Cieslar proofs for spelling and grammar errors on a Homecoming pro- gram manuscript. 36 1 C K7 fw, Q A X7 Cl lf Q ju oft a O l dl QQ Q if do Qffs W fff ggi, 'Qi if 4 C ' QQ J A I 1 Q? till lf Q, as y QL U T' Qmf? gl? 9 J CL, 6 If K gf? z 7 ri, Q . fy if r 2 if 'XX. ight 1? ix 2 A Dana Lawson helps type Homecoming program copy. 4 Mike Meler coaches proper linoleum carving techniques to Roberta Carlson as members Brent Smith, Gina Cannata, and Dana Lawson observe. A Pen and Scroll: Top Row: Smith, Bg Mathes, Jg Meler, M.g Bottom Row: Carlson, R3 Lawson, Dg Fahey, TQ Cieslar, Eg Pickering C. 37 PROFESSIONS: BEYOND BOOKS Two forty-five signals the end of the work day for many stu- dents. For others, the work day is about to begin. Holding ajob represents an obligation to family for some, and to others, a priv- ilege, but to all, extra responsiblity and the opportunity to earn extra money. David Lewis is employed by Dannyis Cafe. Earning four dol- lars an hour has its advantages and drawbacks. Positive aspects, beside the salary, are having an unlimited meal ticket and being able to prepare favorite dishes. Of course, there are on-the-job hazards. Once, while preparing a Lewis speciality, lobster, Dave cut his finger, which required four stitches. Texaco's attraction, according to Jim Anderson, includes meeting interesting individuals. Denny McKissic, another employee of Texaco at Desert Center, is interested in upward mobility in station management. Although Eagle Mountain offers students only a small variety of employment opportunities, those who search, and persevere, find work and earn money. A David Lewis prepares to gamish a sandwich plate. A Between customers, Jim Anderson keeps a watchfull eye on the shift cash box. L Denny McKissic keeps a watchful eye on a gasoline pump's increasing rate. 38 Y A NOONHOUR CHEF ROP restaurant students assumed roles of waiters, wait- resses, and chefs. Lunch hour customers, consisting of teach- ers and other district personel, enjoyed deliciously prepared, and efficiently served meals. Operated by Edie Heath, the ROP restaurant has been in existence for five years. This unique class enables students to increase their knowledge of culinary careers while earning five credits per class. Students enrolled in the ROP restaurant learn, not only the responsibility, but also, the fun involved with workingin a restaurant situation. A ROP chef Carlotta Gutierrez prepares lunch for some lucky teacher. A Tim Reynolds tightens an A bolt. 39 TALON ISIUSTA PART OE THE EAGLE Munson Jewelers, Kaiser Mine, and Yellow Mart are just a few of the businesses visited by Talon students. Yearbooks cost big bucks. Student prices are defrayed by ad selling junkets. Each year journeys are made to Indio and Blythe. Pens and readied to record the sale, and feet patiently carry hot, anxious ad sellers from business to business. Rejection is a frequent result of ad selling, but after all, it's the business- man's loss. Selling ads is one part of creating a memory. Innovative layouts, flowing copy, and capturing fleeting moments through the photo- graphic medium are but a few of the skills demanded of Talon mem- bers. Hard work and combined staff efforts in all these vital areas result in the Talon which is published yearly and received by students at a year ending dance. L Staff Photographer: Lance Overson prepares to snap one of 2160 exposures. Y Talon. Top Row: Overson, L.g Casillas, P.g Graham, G., Scanlon, V., Burdick, E.g McBride, S.: Front Row: Vann, K.: Sanchez, P.g Knight, C., De Arman, T., Payne, J., Sherwood, E.g Fahey, T.g Smauels, L.: P Janice Payne anxiously anticipates the Indio ad! expedition. H f..f 'Q V' 5 40 4 Shelby Fermon signs up to win a 1981 Mustang in Taylor Publishing Com- pany's contest. A Cyndie Knight nervously critiques Pablo Sanchez's copy for the fall dead- line. 4 Yearbook sponsor, Mr. Lee Samuels, is caught off-guard by one of his photographers. STORMING THROUGH NOVEMBER Long, cold after-school hours preparing floats and skits . . . careful selection of class teams, anticipating week long activ- ity . . . the coming together of faculty, community, and classes into a band of friendship . . . the Free Spirit of the Desert. Spirit Week provided opportunities for individuals and classes to develop school wide spirit and unity. Individuals attired them- selves in ornate garb celebrating each of the five days. Flappers, mobsters, rockers, unwieldy boots,', clowns and hobos, and Reverend Sparkman's black clad following of mourners,' were seen and heard. Class competition featured gastronomic themes again . . . pie eating, peanut roll, and lifesaver pass, to name a few. Seniors were selected as competition winners. Spirited blue and golders spirited the Eagles' gridders over a beleaguerd Webb team. Not to be overlooked were after school and halftime parades, and the selection of Carolyn Wallace as Homecoming Queen. Students, fused as one spirit, danced to a senior hosted, KPSI disc-jockeyed dance Saturday night at Lake Tamarisk. L Oh boy, I wonder who I should give this to Y Pete De Lao carefully observes asjuniors Patty Casillas and Frank Tisdel pass the lifesaver, during Spirit Week competition. AESTHETICS OF HOMECOMING COMPETITION 7ime, effort, and a lot of imagina- tion were ingredients of this year's floats. Using Free Spirit of the Desertf' as a theme, classes started working toward the impending com- petition. Afternoons and late eve- nings were reserved for working on the floats. Various materials were used, ranging from news, crepe and toilet papers to chicken wire. Work became tedious, and a few classes thought they would not finish in time, yet students still managed to make working on the floats a lot of fun. Unveiling of finished floats occured during Homecoming,s afternoon parade Later, senior class efforts were awarded during the half-time of the Homecoming Game when their win was announced. 4 Freshly hatched freshman float competes in Homecoming competition. Y J unior's eagle watches parade from high vantage point. Y Sophomore float displays image of Ser- rano defeat. il it X 'ff' ' . A A Winter like temperatures could not penetrate the radiant smiles belonging to Cyndie Knight, Bobbie Reeves, Coni Mattice, and Carolyn Wallace. A Marching band proudly supported the Homecoming Court consisting of Princess Bobbie and escort Fred Sanchez, Princess Coni and Cleve Gray, Queen Carolyn Wallae and Tim Peterson, and Princess Cyndie Knight and Bob Reeves. CHILL Y ON THE QUTSIDE, WARM ON THE INSIDE Homecoming evening temperatures can be best summarized as chilly on the outside, while being warm and moving on the inside. Everyone excitedly awaited the half- time activities, to learn who would be crowned Homecoming Queen. As the halftime procedure com- menced everyone could see the colorful floats, but the evening was highlighted by the crowning ceremony. Eighty's varsity football team selected four homecoming princesses: Cyndie Knight, Coni Mattice, Bobbie Reeves, and Carolyn Wallace, to honor during homecoming week. Riding atop new luxurious cars during the after- noon parade was the first exciting activity involving the girls. They were also presented at the game, where several hours of shivering were spent before Carolyn Wallace was crowned as Homecoming Queen. . . . An eighteen year old senior, Carolyn was born June 14, 1962. Caro- lyn has light brown hair and green eyes. She stands at 5'3W' tall. She used to live in Parker where she attended Par- ker High. She has lived here three years. She is on the Drill Team and Choir. She likes drama. Her favorite sport is track. She would like to be on the Honor Roll. She plans go to to the Beauty College in Indio and would like to be a Cosmetologistf, 5 2Es 1 QE nw , 7 A Homecoming Parade is a traditional community event. Princess Bobbie Reeves rides aboard the Thaxton's Cadillac. A Queen Carolyn Wallace prepares hors d'oevres during the Homecoming dance. A Senior float The Heinekin , cruises Main minutes before being announced winner of float competition. GRADUA TES MIXED EMOTIONS, MARKED MEMORIES fviixed emotions marked the completion of high school by eighty one's graduating class. Most were saddened by the thought of leaving E.M.H.S. and the security it offered, but were eager to get out and face the world. With four years of exciting events and experiences behind them, the Class of 81 remembered their senior year with fondness. Seniors began the year with controversy and dilemma over the planning of the Homecoming Dance and the senior trip, with few funds available. After several class meetings, members decided upon serving a pre-game barbecue dinner, and the host- ing of the traditional dance with a non-traditional disc jockey crew. After paying expenses, profits were minimal. Spring semester marked a change in thoughts and attitudes of many seniors. Mid-term graduates and students with full of part- time jobs all began to understand what life is like after high '.s,!sa-25555: - ,I l'5::5ffi555ZI'E A school. They had the responsibility of paying many of the costs pertinent to their senior year, such as portraits, announcements, caps and gowns, college aptitude tests, and college applications. Senioritis , the classic chronic disease, left many full time seniors restless and bored. While many students took off after lunch, others saw the need for hard study, so that their last E.M.H.S. report card would be rewarding. Finals added pressure to the strain of striving for good grades, but realizing summer was just a few days away, seniors somehow managed to muster strength to carry them through the remaining week. As the formality of graduation ended with cheers, clicking cameras, flying caps, and switching tassels, seniors realized with a sense of achievement that E.M.H.S. is an important part of their lives that will be with them always. Pains, frustrations, joys, laughs, good times and bad, all suddenly became insignificant in relation to an undefined future each graduate anticipated, and would be remembered fondly as times of growth, change, and maturity. Earnest Colwell Earnieg Baker Street Band l-4: Drum Major l-43 J.V. Bas- ketball l: Varsity Football 3, 4, Leather Craft Award, Who's Who Among American High School Students 41 Most Improved J,V, Football player l. Tommy Pat DeArman, Jr. Tom-Tom: .lordacheg Fool in the Rain I Can't Tell You Why Band I-4: Honor Roll l-45 Who's Who Among Ameri- can High School Sludenls 4g Class Representative lg Vice- President 4: A.S.B. Board Representative 2, 3: A.S.B. Vice- President 3, 43 J.V. Basketball 25 Varsity 3: Manager 43 Most Improved Player J.V.: Most Improved Varsity 3: Music Scholarship l, 25 Yearbook l, 3, 4: Lay-out Editor 3, 45 Win- ter Sports Court I, 3: Homecoming Court Assistant 4: Pep Club I. Become a well-known designer, move to the south of France, and party. M EMORIES EXPECTA TIONS art1c1pat1ng1n sports, working on a favorite activity in class or after school, sneaking off with a friend to party, or just s1tt1ng on the quad benches talking and laughing, they were all fun times that w1ll be recalled by semors the rest of their l1ves Seniors disliked somethmgs about E M H S such as having to attend all classes and not just the work should be left out of the schedule, since they had already left it out of theirs Confronted with a multitude of addltlonal costs such as portra1ts, sen1ortr1p and prom, many sen 1ors sought some employment Students already achieving the goal of obtaining the minimum number of required credits in Eng l1sh, science, math P E and soc1alsc1ence, had only to take a government course and other elec tive classes in order to earn the credits requlred to graduate I 5 . . t . rl i favorite ones. And most seniors agreed that home- if mv' I gl l ' ' . A Margie Merritt conducts the senior class in yell competition. George De La Rosa L Pep rallies attract large crowds. Seniors Tommy DeArman and Bobbie Reeves are doing their best to win the class compe- L Away from the noise of Spirit Week, Senior Homecoming princess Cyndie Knight contemplates the upcoming evening. Laura Jean Dostal Loadieg Don't Fear the Reaper , 'Over the Hill and Far Away g Clux Vice-President lg Junior Class President 3: Clu-I Representative 4: Cheerleader I-35,1-lead Cheerleader 43 Drill Team lg Choir l-4: Softball lg Pep Club 1-35 Daisy Cluin 3: Honor Roll I-45 N.H.S. 2-45 Algebra Award lg Geometry Award 2: Award 23 English Award 2: Computer Award 2: Whaiv Wha Amang Amenkan High School Student: 3: Principal'l Honor Roll 25 Most Likely to Succeed 4. Go to C.Q.D. then become A computer programmer. tition. M olly Escobedo Tammy Fahey rill Team 43 Choir 4: Yearbook 4g Honor Roll l-4. ove g F.H.A. 21 Pep Club 21 Leonard Garcia Cleve Gray Gordog Always and Forever , Wrestling l-43 Varsity F ot- ball 2-45 Baseball 2, 35 R.O.P. Auto 33 Become a mechanic. ball 45 Wrestling 4. STUDENT HOMEMAKER C an a teenage mother go back to school and succeed? Yes! Martha Fajardo was married to Dale Patty during the 1979 school year and had a baby boy, Aaron. Martha's first reaction was It is going to be hard getting everything done. Martha believed the same thing many teenage mothers take for granted: It,s easy to be a mother and babies are so cute. But soon the daydream ends and reality begins. Martha was faced with a decision to either go back to school or stay at home and be a fulltime housewife. Martha made the wise decision of returning to school to com- plete her high school education and of also enroll- ing in R.O.P. Martha is a member of Eagle Moun- tain High's Class of '81 ! After graduation her goals are to be a good housewife and good mother. It takes more than dedication to return to school and pursue a goal. It takes strength and determina- tion which is something Martha Patty has. A Second semester aide for Mr. Samuels, Martha Patty reads servor class minutes. Ne .Q Nu 0 h x 'V fp OXIN L 'yu QQJQMJQIJ Ilviolsk Ig Neo! X fs.-,N N . i QV- 9' y y GJ V V. C UU flu . -X y if 5, M V rf V t KU 'N Av . At J L, Av ,W xp fir OU' AIU' 01 4-xxx 1 ' Cy xgpl? a jtkl if it af' Jldwttwjffgi V . -of Ayr Q Wt ,JD 59 LQ . A OJ, bo Ove G' QM taflv Whiskey Man: Hot On the Wheeles of Lov V ty F t Become a graphic design Y Blanca Gutierrez carefully selects a senior proof which will laterbe used for exchange. AN EXPENSIVE PRIVILEGE t s Senior Picture Time , was the head ing of the letter seniors received m mid October This meant that the graduating students from E M H S had to prepare for a special session with the photographers from Executive Portraits of Anaheim For many years it has been a tradition to dress in best attire and put on a gleaming smile to have pictures taken All of this preparation results in the most exciting aspect of senior pic tures, exchanging the finished product with friends ' This tradition insures that although we may part and go our d1fferent ways, we will always have the memories that the pictures preserve Blanca Gutierrez Shortyg Together g Drill Team l, 2, Basketball l-35 Softball l-3: Most Improved Player 3, Varsity Cheerleader 49 Honor Roll 3, 4: Spanish Il Award 23 Advanced Typing Award 23 P.E. Awardg Who's Who Among American High School Stu- denuf Banner Carrier 4. Go to college, work, and enjoy life as much as possible. Mike Jesse Another One Bites the Dust g Golf lg Baseball 3: Princi- pal's Honor Roll 1-49 N.H.S. 3, 43 English pin l, 25 Algebra I pin lg Geomerty pin 2: Algebra Il pin 35 World History pin 23 American History pin 35 Biology'pin lg Physics pin 35 Spanish pin l, 24 Industrial Arts cenificate 1, 39 English cer- tificate 3: Whoir Who Among American High School Students 3: Class Treasurer 23 Class Vice-President 3. Attend college and get rich. Richard Ross Kain Let the Good Times Roll g Football l-45 Basketball l-4g Baseball 25 JN. Lineman of the year 25 J.V. Most Valuable Player Basketball 23 Most Valuable Player Defense Varsity Football 43 All-Arrowhead League Tackle 43 Black Helmet Award 45 Band l-43 Class ,Secretary 33 Who's Who Among American High School Students 45 Varsity Football Captain 4: Honor Roll l-4. Attend college and major in business. Cynthia Lori Kivisto Head Varsity Cheerleader 3. Y Jerry Ballard apprehensively awaits for a shaving cream covered balloon, courtesy of Bobbie Reeves. Y Seniors sponsored this year's Homecoming festivities, which included a halftime barbe- cue dinner. George De la Rosa and Jeff Yates serve hot barbecue beef to hungry customers. Cindy: Stairway to Heaven , Choir l-43 Class Secretary 3: Class Treasury 25 Tall Flags lg Class Favorite lg Winter Sports Queen 3, J.V. Cheerleder lg Varsity Cheerleader 25 Janice Kivisto J.K. JAN: Run Like Hell , Daniel g Choir l-33 Pep Club lg Honor Roll l, 3, 43 Principal's Honor Roll 25 Pen 8: Scroll Club 2, 35 N.H.S. 2-4, Class Secretary 23 Class Representa- tive 3g ASB 33 Who'.r Who Among American High School Stu- dents 3g Typing Award lg Advanced Typing Certificate 23 Advanced typing pin 3: Business Math Award 33 Student Council Pin 3: Daisy Chain 3. Become a ticket agent, reser- vation agent or travel agent, travel the world and live it up. l X'uUi5 i .Q ,- rf ,,,., .fZ:7f'1'11Qf,,, Cynthia Louise Knight Cyndie Lou: Sai1ing g N.H.S. Vice-President 45 A.S.B. Sec- retary 41 Pep Club Vice-President 3g Daisy Chain 33 Princi- pal's Honor Roll l-43 Band l-43 Basketball 3, 45 Homecom- 4, Winter Sports Court 35 English pin 35 Arion ing Court Award: N.H.S. 3, 45 Yearbook Editor 4g All-State Band 29 Whaiv Who Among American High School Student: 3. An art or stewardess career. 51 A Brian Timonen supports a slam dunk attempt by Bobbie Reeves. A Cultural foods prepares holiday theme meals Denise Luisi eagerly awaits her serving of Thanksgiving turkey with the trimmings. L Cleve Gray tires out a stance. SENIORS PLAY THE CAM S uccessful survival in athletic competi- tion encompasses teamwork, sportsmanship, and leadership in playing and non-game cir- cumstances. Seniors Bobbie Reeves and Brian Timonen have continuously demonstrated these characteristics. Bobbie has been a three year positive contrib- utor to the sports of basketball and volleyball. As a senior she was captain of the volleyball team and was selected as Most Valuable Player. Bobbie intends to pursue her athletic ability by majoring in physical education. Brian has lettered four years in football and basketball and has been a captain of each team. Football awards have included all county team membership as a senior and E.M.H.S. most val- uable offensive player. Brian hopes to compete on the gridiron at the college level. Denise Luisi Coni Mattice Ziggy, Nisi: Hit Me With Your Best Shot g Volleyball l-33 Softball l-25 Honor Roll 4. Attend ajunior college and keep up my natural life, Partying . Conell and Smiles: He's so Shy g Gymanstics Teamq Drill Team 4g Homecoming Court 43 Attend beauty college. l Mike Meler Don't Ask Me Why g Art Award 35 Honor Roll l-45 Who? Who Among American High School Students 35 Attend Art college. I ! '! Margie Ann Merritt M 8 M, Tootsie: Street Band g Softball Manager 23 Pep Club 35 Class Favorite 3. Get out of Eagle Mountain and party hardy. A Dilemma of whether to look cool for the yearbook photographer has been solved adequately by Jeff Yates and Bobbie Reeves. Patty O'Yates mb tix Debra Dawn Olson Martha Paty Love Hurts, Another one Bites the Dust : Tall Flags I-35 J.V. Softball lg Yearbook l, 33 Daisy Chain 33 Class Trea- surer 4g Varsity 23 Leather Craft Award 2: Leave Eagle Mountain and keep partyin. Ma, Memories : Art Award lg ROP Restaurant 2-4: ROP Awards 2, 3: Pep Club 1,33 Drill Team l-3: Drill Master 3: Yearbook 2, 3: Class Secretary 4g FHA Secretary and Trea- surer. But my greatest and most precious achievement was my son, Aaron Owen Patty. To have at least two more healthy children, and to be the best mother and wife. A Racing toward the toilet paper finish line is senior David Richardson 5 Cindy Kivisto prepares a poster that will be hung from the senior's homecoming float. , .. it I Janice Payne J. P. Paynezane: Free Bird , Already One g Majorette l. 25 Yearbook lg Copy Editor 45 Choir l, 2. 4: P.E. Award lg Honor Roll l-4: Varsity Cheerleader 3, 43 N.H.S. 3, 45 Who's Who Among American High School Students 3: Daisy Chain 35 Pep Club I-3: J.V. Volleyball 25 Powder Puff Football l. Attend college and become a physical therapist. Tim Peterson Peteg Lady g Varsity Golf l-45 Varsity Football 2-45 Band I-43 Class Vice-President 21 Class President 4. Attend Ari- zona Automotive Institute. Bobbie Reeves Fuzzy You've Lost that Lovin' Feeling g A.S.B. Representa- tive 2g A.S.B. President 43 Varsity Volleyball 2-4: Basketball 3, 4: N.H.S. Secretary 3: Band 143 Honor Roll l-45 Presi- dential Physical Fitness Award 1,21 Daisy Chain 3: Typing Award 31 Volleyball Scholarship: Homecoming Princess. Attend Brigham Young University and have fun. CREATING AEST!-IETIC AWARENESS niversally reconized talents are usually encompassed within academic classes However as in the case of most high school programs, artis tic accomplishments may be wrongfully over looked Fortunately this is not the case of drama, music, and art programs at E M H S Participating stu dents are able to develop completely as 1nd1v1du Talon IS proud to announce that seniors have selected Cyndie Knight and Mike Meler as tal ented standouts in the f1ne arts Cyndie excels in band and art classes Michael, an outstanding drama, band, and art student intends to further his art education by majoring in art als. - A Mike Meler and Cyndie Knight critique a final product. i I 3 s David Richardson Diana Sauceda Dina: I Can't Tell You Why g Volleyball lg Basketball l, 2g Softball l-4. Go to beauty school, become a housewife, and thenjust live it up. Darrell Spencer Smokey , Ol' Deller g Another One Bites the Dust g Honor Roll 4: Get a goodjob, become rich, get married, and start a family. A Senior traditions include the Quad, being first to leave school assemblies, and filling out many forms. In upholding these tradi- tions, Diana Sauceda labors over the Talon Senior questionaire. L Richard Enriquez concentrates on a Mr. Weitz government lec- ture. 56 STEPPI OUT! 87 980 was a year of many changes, and fashion par alleled those changes Students chose a wide variety of styles creating an image reflecting their individual per sonalities For guys, the look was casual, yet clean cut, created with cords O P shirts, sweaters, and the traditional jeans Girls were subjected to more decision making because of the wide variety of new styles which appeared The look for the girls was comfortable yet Calvin Klein, Gloria Vanderbi t, and the popular Jor dache matched with dehcate print blouses and Cherok ees, played a major role in the girls attire For many students, the ab1l1ty to be well dressed didn t come naturally but was something which had to be worked on A neat appealing and original appearance was definitely a necessity for those who set a pace for others to follow Seniors who paid extra special attention to their 4 Fashion trends at Eagle Mountain attire, Tommy DeArman and Com Mattice, were looked were set by Seniors, Tom DeArman and on as 5tY1e Setters for the Class Of 81 Coni Mattice, who gained recognition for I Deal HPPCZTHHCC. 1 1 , . . fashionable. Fashion designed Ijeans such as Sasson, . . . , . . , . . Brian Timonen Remember fWalking in the Sandy Football l-45 All Arrowhead League at Offensive Halfbackg Basketball 1, 45 All Chapperal League in Basketball 33 Honorable Mention All County Basketball 35 Most Outstanding Basketball Player 3g Football: Most Valuable Player on Offense 43 Most Athletic 45 All County Football 4. Attend College. Glenn Underwood Pooh-Beary Bohemian Rhapsody , Tuming a New Leaf g A.S.B. Board Representative 3, 45 Honor Roll l, 23 Princi- pal's Honor Roll 3, 43 Algebra II Awardg American History Award. Become a lawyer. Diana Vidal Knok: Reunited , Together g Honor Roll l-4g Daisy Chain 3: Basketball 'l-4: Softball l, 2, 43 Volleyball Manager 2, 41 Mat Maid lg Band l-41 Who's Who Among American High School Students 33 Class Officer 25 Attend Southwest- em College and enter into Criminal Justice. Carolyn Wallace Let Me Love You Tonight 3 Choir l, 3, 43 Drill Team 3, 43 Honor Roll 33 F.H.A. 23 P.E. Award l-33 Homecoming Queen 4. Go to beauty college, then think about marriage. Alana West Ruthg All Out Of Love g day care center. Pep Club 23 R.O.P. 33 Work in David Wick D.W3 Honor Roll l, 2, 43 Golf l-33 Most Valuable Player l- 33 Football 2, 33 Whaiv Who In America Among High School Students 33 Homecoming Escort 33 To attend college and to succeed in whatever I do. A Several free moments are shared between classes by Seniors David Wick and Cyndie Knight. P Senior govemment students ponderla thought provoking pohtical science question. Y Earning outstanding grades throughout their high school education, while finding time for involvement in extracurricular activities has helped Laura Dostal and Mike Jesse to stand at the front of the senior class. Tom Williams E . Jeff Yates Hefeg Another One Bites the Dust : Certificate of Award for English 9, Spanish I, World History, Spanish II, English ll, and physicsg N.H.S. Presidentg Go on a mission for the Mormon Church: Attend Brigham Young University and study veterinary medicine. SENIORS A RE THE FUTURE Drive, determination, and dedication are required to achieve excellence in any field. Out- standing scholastic abilit is a goal which few are able to achieve, despite the efforts many students put forth. Faithfully completing homework assign- ments and studying adequately before tests requires more time and concentration than most students are willing to devote. Scholastic excellence is often considered the key to success in future careers. Mike Jesse and Laura Dostal selected by seniors as Most Likely to Suc- ceed, have demonstrated their scholastic abilities throughout four years of high school. They, along with other achieving seniors, have been in the forefront of competition for scholar- ships and other college financial assistance. Enduring four hours of multiple-choice questions on the Scholastic Aptitude Test was only the beginning, as they filled out endless forms and wrote numerous essays on a variety of topics in an effort to gain acceptance from the college or uni- versity of their choice. s A Seniors Bobbie Reeves and Cleve Gray pose in cap and gown during picture day. A Senior Class Officers: Top Row: Laura Dostal, representativeg Tim Peterson, presidentg Bottom Row: Tom DeArman, vice-presidentg Debbie Olson, treasurerg Martha Patty, not pictured, secretary. DOORWAYTO 1 TOMORROW NDifficult is a word best suited to summarize the 1980-1981 school year. Seniors started emo- tionally high and continued to grow and mature - the year progressed. Some athletic teams achieve a healthful degree of success, others were disap- pointing. Old, worn-out materials failed to hinder learning as seniors gained knowledge and experi- ence that would remain with them forever. Everything ends. E.M.H.S. will lie dormant for several months, but memories and personalities shall never be forgotten . . . the fateful day in December when the community lost a good frienc in John Senecal, pep assemblies, planning the sen ior trip, Spirit Week competition, special times in classes, with friends or alone. SENIOR SELECT F or the first year, the senior class was asked for their views on a variety of subjects. Some may think this poll is si ply based on popularity or just a trivial exercise. We hope that this poll will become a small mirror of this year. The things that you will remember or want to remembe for many years to come are hopefully listed here. We realize that along with Homecoming, basketball, teachers, classes, and all the other things which make up a school year, you wi remember the songs you listened to, the shows you watched, and the movies you saw during your all important senior yea We hope this poll serves as a happy reminder of all those things. Slickest Flicks 1. Rocky II 1. The Blue Lagoon 2. The Shining Master Musicians 1. Led Zeppelin 2. Queen 3. The Cars Wheels with Appeal Choice Champs 1. Porsche 1. Mexican Food 2. Trans Am 2. Lobster 2. 280 ZX 3. Pizza Tops on the Tube Super Song 1. General Hospital 2. Eight is Enough 3. Dallas 1.Another One Bites the Dust 2. Free Bird Spring Story VISIONS OF SUMMER DANCED THROUGH OUR HEADS 7imes of enjoyment, laughter, and worries accompanied spring semester activities. Students engaged in many events, ranging from receiving fall report cards to participating in senior commencement exercises. Halls were filled with more secure freshmen searching for their destination. Sophomores, further accustomed to high school life, hoped to gain success throughout the next two years. Juniors anxiously anticipated their senior year, while seniors were at the point of making decisions that might affect the rest of their lives. ' ' I ' , 1 g,' f1:?'f':w fg .if-it Q, . Q. aer iiiii ia M 5 ..... xy, -J x,,i . Sian . 14.555 ., . M , v .x . i .. 2.412-':g'. gf- ,yr-sm'H.23lsg:fEfuw'li'?. '-i JMS I H- 5 911.5 ' 1' s LQ. i wi, ,U i t ff: U vllilftffsif iliaf i i t , iii , - I it , .V A Q , . 5 :K gg A sti' y r . g 1 ' Sfaf gas-. ,,,,, 5:1652 feasiigggzs, . ,.. . -, .,, - ,g a n Wir: ,V 5 'Y 1' ,'f 5- rr ' Wtstsifiafs wfil sa t if till -:fi Egg-itffiifeezi'.fasiixrfftgi , . ,,g5fSgf3!,EM 'ill we f t,,' tfw' , ' f itfgiepifisissgmfifiugglszlgs fiiiitiifi . ' . yilililll, rggpiiil i 1' wif P .itll-in intl i ifxsmciiiiiflgtfitlE1f'ilWizf lllh f QQQWW will .gif i miii'iWi.iiiiilfWf'?i2.t2tgQ522971351 ali, fwfifli, liflwlw e E, 2, ,i ttf.igggilmjlggjlllaiill SL fl ,Qt if ii -iiii ,- I View V for . i liliiiiiliiillliiifiifiilliiiiiixiililiigtifliiligl' rtiiaiiizlit W m fliiil f kg Zi n 3352 w rssiEi 1 ..te5 sft eV L , w x ag fi 5 .K ml. glfli E51 :ggf5sgf', 3' 22, 2 A ,t ,..,. H . , Vgpg x- -lgillts ,Hi . ,, ,An, :y,,5, :gin gi !E5W,,, ix . VII : ,. f' . 'fxfff - ,V - Q sa 't' 5f3, 'f--i n iiftgifl- iiixgf. .i 13631 . : !2,e'?'fi 2322. f lff iv fi. iff ' sxiiksgii L 35 :E- ,Hi . il fili lli ti A John Todman presented various illusions to activity period students at an ASB sponsored assembly. A Lance Overson and Greg Ganside patiently receive pre-season advice from Mr. Sparkman. Golfers won a February 26th round, their first, against 29 Palms. A Late February baseball tryouts involved stren- uous workouts. Prospective second-baseman, Larry Ballard eagerly awaits an oncoming groundball. A Debbie McCormick and Brent Smith boogie at mid-February's junior class Winter-Sports Valentine Dance. A Faces in the crowdg Phil DeLao's and Patty Casillas' expressions signified good times for Em students who attended the National Date Festi- val. L Glenda Grover-Casillas coached softball through a rigorous spring training. Kristine Jami- son pounds her glove in anticipation of a fly ball. A Band members marched down a traffic-free Highway lll, enroute to the National Date Festival's judging area. A Senior Bobbie Reeves was selected as the Outstanding Girl Athlete to represent EM HS at the annual February Riverside County School's banquet. s 5 i TRA DITION: PARADE, INDIO AND DANCE Spring brought an assortment of exciting events. Indio's annual Date Festival allowed E.M. students to participate in the Valley's President Day festivities through traditional band and drill team parade entries. Other campus curricular programs also fared well, such as the magic show, sponsored by A.S.B. Spring dances included junior class' Winter-Sports Valentine Dance, and sophomore's Sadie Hawkin's Dance. May was highlighted with drill team, band, and choir performing assorted musical routines and concert pieces at the Spring Concert. Last month activities centered around the senior grad- uates. San Diego or Malibu trip plans were finalized, and the on-campus rituals of baccalaureate and gradua- tion were performed. , w 4 A... 3 f e 1: :uzxsizpgsifms 1 K . ! ,. I V! 'x W . F R i f 4 x 3 1 A Learning Experience For All SETBACKS SET MOOD FOR VARSITY ROUNDBALLERS Setbacks were synonymous with the Girls' Basketball Program. From the out- set, eager, and hopeful participants were kept waiting well into the second week of the program for coaches to be hired. Coaches were finally found, but problems intensified as individuals abandoned the team because of a disrupting, disunified, and chaotic atmosphere, created by a con- flict in coaching responsibility. Girls' Varsity suffered through a diffi- cult season which can be attributed to a lack of experience, the small number of players, and the lack of a full pre-season of conditioning. Led by Terri Sutton, varsity, in spite of all the setbacks, did not give up, but was respected by other league teams as poten- tial victors, rather than victims. Coach Mark Carrow, with the frustrating season nowin the past, anticipates a successful year in '82 for the Girls, Varsity team. 4 Carlotta Gutierrez and Emily Sherwood rush to take advantage of a CSDR offensive lapse. A Cheryl Copeland successfully keeps a CSDR opponent from making an outlet pass. L Halfcourt pressure is applied on a CSDR forward by Emily Sherwood and Cheryl Copeland. L Timing plays a critical part in any sport. Bobbie Reeves gracefully arcs a jump shot above a lunging CSDR block attempt, as Carlotta Gutierrez waits for a possible rebound. A Hustle and determination were typified by JV players throughout the season. Becky Vasquez narrowly misses deflecting an opponent's chest pass. 5 During the second half of the game against CSDR, hot Laura Lewis pumps in another two points. oung Ca ers Set Style ay Ups and Dri bling Fundamentals Produce Fiery Spirit l Learning fundamentals, such as lay- 5 ups, chest passes, and dribbling, coupled with a swarming defense, enabled the J .V. Girls' Basketball Team dominated by freshmen, to an 8 and 9 record. Dominated by the fluid presence of Laura Lewis fifteen foot swishers and effortless lay-ins, and Patricia Foster's crashing the boards, the lack of height, detrimental to other EMHS basketball programs, was not a problem. Average height for the J .V. girls was 5'8 . An added advantage was the experience ained, and a winning attitude established by Assistant Coach Manuel Casillas. Along with Laura and Patricia, Sandra Carson's leadership abilities and Becky Vasquez' skills should contribute posi- tively to next year's varsity team. L Sandra Carson dribbles past several Sherman Indian defenders enroute to 'the basket. L Vicky Garza jumps and shoots for two points against Sherman Indian late in the first half. Y Positive aspects of sports programs include formed friendships. Martha Mendez congratulates Laura Lewis for a successful lay in against CSDR. ,Q 5' V wwfifv ' ww .11 H L x v Spirit and Pride YOUNG SQUAD INFILTRA TES NEW LEAGUE Offensive game plans including running a 1-2-2 against a zone defense of powering strong forwards inside against a man-on-man coverage, instituted by first year boys' varsity Coach Mike Bon- Tempo. Emphasis was placed on a youthful run- ning team. Three starters, one junior and two sophomores, had little varsity experi- ence prior to this year. Varsity leadership was instituted by senior center Ross Kain and senior forward Brian Timonen. Hustle, enthusiasm, and willingness to leam were clearly not enough to replace a lack of consistency on defense. Willing and able, the Eagles forcefully held oppo- nent advances, yet the job never seemed to lighten up for the varsity, whose efforts were more often futile, than not. Oppo- nents averaged between 55-60 points, while EMHS could only manage to aver- EN.,-' Lzf , mx f F3 i age 50-55 points per game. Also, noticed by players and the coach was a lack of support from the student body in the form of game attendance, so necessary for a positive attitude. Ample playing ability and dedicated team members unfortunately could not overcome poor school spirit. 4 Ross Kain desperately attempts to deflect a Needles lay-up. A Allan West displays good defense by not allowing his man to dribble down court with the ball. 4 Crucial positioning allows Brian Timonen to beat a Needles' opponent to a defensive rebound. A Guard Roger Brake alertly blocks a Needles' forward jump shot. Frustration and Fumbles VICTORIES ELUDEJV UNDER THE BUCKET Often displaying inexperience and apprehension, the ambitious boys' J .V. basketball team struggled through every game, winning only on rare occasions h when the team's chemistry permitted vic- tories. Severe height deficits on the front line caused the team to lose many of its games on the boards. Leading scorers Larry Ballard and John Ottinger helped the team earn a record of 2 and 18. The fourteen players faced a dis- appointing season which never seemed to get off the ground. Held together by a few outstanding players and Coach Mike Bontempo's never wavering determina- tion, crowd support still dwindled to a handful of encouraging parents, girl friends and dedicated basketball fans. A Protecting the ball, while driving past a Needles guard for a lay- N up, is Larry Ballard. p Forward Robert Morales lays the ball in high above a helpless l Needles defender. 559 get we 4 John Ottinger pulls down an offensive rebound before putting the ball in for two points against Needles. A Coach Mike BonTempo forcefully outlines game plans to his exhausted third period forces. Pinning Qpponents MA T-MEN MUSCLE UP TO TOUGH COMPETITION Facing resistant competitors, rigid weight cutting requirements, and arduous after school practices proved at times unbearable for some team members. Several individuals were forced to compete in a heavier weight group to ma e up for lack of wrestlers. Morale and enthusiasm elevated as dual matches brought favored wrestlers and well-deserved victories. Although victories prevailed much of the season, excitement wasn't replaced with monotony since many meet wins were decided in last few matches. Matches were well attended and Coach Rylie McDowell was pleased with the team's league record of four wins, three losses and a tie. Individual wrestlers, Efrain Guti- errez 0081, Baldwin Abrille 11151, and Raul Abrille fl29J, earned rec- ognition as all three placed in the Riverside finals. A Maneuvenng to gain control over his opponent, Jaime Lopez reaches for another hold. L Efrain Gutierrez takes his position at the start of the match. A J aime Lopez shows strength and agility in his impressive pin- ning hold. A Efrain Gutierrez exhibits his form that enabled him to advance to the Riverside County sectionals. D 73 Varsity Basketball: Fermon, B., Pickering, C., Knight, C., Cope- land, C., Sherwood, E., Sutton, T., Reeves, B., Gutierrez, C., Reed, A., Carrow, M. Varsity girls' basketball finished in last place with a record of three wins and 16 losses. J unlor Varsity Basketball: Top Row: McNamara, K., Lopez, V., Garza, V., Mendez, M., Vasquez, B., Tisdel, M., Foster, P., Lewis, L., Carson, S., Peoples, L., Robertson, S., Front Row: Reed, A., Pickering, C. Junior varsity girls' finished fourth place in the Arrowhead League. Their record was eight wins and nine losses. Varslty Basketball: De La Rosa, G., West, A., Sanchez, F., Timo- nen, B., Wodetzki, C., Kain, R., Major, M., McKissic, D., Brake, R., DeLao, P., Bon Tempo, M. Varsity boys' basketball finished fifth in the Arrowhead League. Their overall record was six wins and 14 losses. Junlor Varsity Basketball: Back Row: Nees, M., Evans, L., Bal- lard, L., Stokes, C., Fermon, S., Morales, R., Ottinger, J., Green, L., Evans, M., Smith, B., Front Row: Fermon, E., Fermon, B., McKissic, C. Junior varsity basketball placed eighth in league play with a record of 0 and 14. Wrestling: Top Row: Reynolds, T., Gutierrez, E., Lopez, J., DeLaRosa, G., Garcia, L., Moody, R., Gray, C., Gaines, C., Enri- quez, R., Moroles, D., Abrille, R., Abrille, B., Glenn, M., Front Row: Mat Malds: Meler, S., Luisi, D., Enriquez, A., Ballantine, D., Glenn, L., Underwood, A., Olson, B., McDowell, R. Wres- tling's league record was four wins, three losses, and one tie. The mat men tied for fourth place in the Arrowhead League. it A National Date Festival entry number 78, marching band was led by senior drum major Eamie Colwell. A Various forms of award-winning art were displayed by EM students at the National Date Festival. Mike Meler and Cyndie Knight won ribbons for oil paint- ings. A Expressions of enjoyment on Larry Ballard and Lalo Garcia's faces were just two of many reasons that drew EM students to the carnival grounds of the National Date Festival. ational Date Festival TROPHY, RIBBONS, FUN, AND SUNSHINE E arly February summer sunshine accompanied the com munities' annual exodus to the National Date Festival. Eagle Mountain students invaded the carnival grounds which proved to be an addicting experience. Many individuals had the advantage of being mem- bers of participating organizations, receiving round trip transportation to the festivities. Drill Team won the sweepstakes competition for a second straight year. Students not only visited carnival attractions, but admired 'junior building competition displays consist- ing of award winning art, homemaking and woodshop projects. 1 Phil De Lao prepares to clobber an unsuspecting bumper car driver. A Janet Wallace, Sonja Turk, and Lorena Patrick proudly display projects that won home economic rib- bons at Indio's Date Festival. 77 A Walter Crane keeps a watchful eye on Valentine dancers, while disc jockey Curtis Gausvik prepares to serve another Licorice Pizza. L Slow dancing to You've Lost That Lovin' Feel- ing, is a favorite of couple Fred Sanchez and Tangi Reeves. A John Crane frantically Turns Japanese. Winter Sports court was positioned prior to the mid-evening ceremony. Court rs from left are Raul Abrille Becky Vasquez Ross Kain Sandra Carson embe , , , , Frank Tisdel, Bobbie Reeves, John Ottinger, and Cyndie Knight. A Dances are special occasions that enable many students to get out and socialize. Juniors, Vonda Scanlon and Pablo Sanchez dance to Valentine rock and roll. Gausvik Rocks Valentine ym SENIOR KING AND QUEEN RUMPAMID fufwofe FESTIVITIES C:ombining a multitude of creative ideas, as well as hard work by a few junior class students, the impending collapse of another tradition activity was avoided. Class of '82 leaders salvaged the Winter Sports' Dance. Last minute plans included an overlapping Valentine's night motif. Winter Sports' Court members were selected by the girls' and boys' basketball teams, and the wrestling teams. Court members include: senior, Cyndie Knight, juniors, Sandra Carson, Frank Tisdel, and Raul Abrilleg and sophomores, John Ottinger and Becky Vasquez. Queen Bobbie Reeves and King Ross Kain were 'crowned' by Steve Weitz during a midevening ceremony. Featured disc jockey, Curtis Gausvik, played slow danc- ing and contemporary disco music that were energetic and satisfied most tastes. Ironically, last minute planning and promotion were responsible for the low attendance, but considering the quality of the evening, couples in attend- ance received a well deserved break from the tiring tedium of school life. 82 83, and 84 WORK, ACCOMPLISH, LEARN, GROW H ave you ever wondered what it would be like if you were sud- denly sentenced to live on another planet where daily routines were totally foreign? Strange and unfamiliar situations during the first semester can create alienating experiences. Many younger under- classmen experienced similar situations and felt like aliens this year. Homework's payload had to be continuously juggled with needed time for athletics, cruising, and partying. School related feelings ranged from a sense of accomplishing little socially, to knowing you've aced the algebra final. Each person found, as the year sped by, that he or she was becoming an integral part of the school envi- ronment. By year's end, accomplishment and growth created knowledga- ble, mature people capable of functioning in their world. 80 ' wa, .a . .. Qi? A Georgene hangs out between classes, A l'm supposed to be where? asks Fred Sanchez. A Shelly Robertson breaks out in smiles. TIME-OUT! Bells ring. Lunch time has arrived! Students pile out of class, stomachs growling and ready to absorb quantities of potato chips, candy bars, sandwiches, cokes, and whatever else is available. Lunch munching can take place just about anywhere home school the bowling alley Danny s Cafe R O P and the snack bar How ever lunch is not just for porkmg out' E M H S students make it a time of conversation with friends doing last mght s homework horsing around crulsmg Main or just doing nothing at After a moming of algebra English and history lunch is a welcome break for everyone' A Cheryl Copeland shares a noon-hour drink with a friend 4 Pablo Sanchez rocks out during lunch. A David Escobedo peers into a lunch hour brown bag. ALMQST TO THE TOP 1182 means thinking about your future, what you have accomplished, and what lies ahead. Many juniors take the PSAT exam, and a few start thinking of prospective college selections. During the first two years of high school, few students strive to achieve an A or B average. High marks must be earned in a variety of solid and elective classes. By their junior year, those students who have persevered have usually begun to center their attention on a specific area of study, taking classes in that field, and sometimes serving as an aide in those classes. 5 U.S. History provides a moment of secret enjoyment for junior, Walter Crane. Raul Jim Patricia J eff Keith Abrille Anderson Arellano Baysinger Boleman Robert Matthew Elisa Gerald David Brandon Bryant Burdick Butler Capp Sandra Patricia Cheryl CIICIIICHIC Carson Casillas Copeland DeLaO D1a80 4 Shelby F ermon graciously carves cultural food's Thanksgiving turkey while Tina Evans looks on Y We were supposed to do what for homework? asks Alane Underwood. David Tina Georgene Robert Escobedo Evans Graham Hamm David Jerry Scott Denny Lewis M athes McBride M cKissic Russ J aye Lynne Lance eler Moody Morgan Munson Overson A Exuberant juniors, cheer for the class of '82. P Pete DeLaO concentrates on perfecting his art project. A Junior class officers demonstrate their togetherness. Top: Agatha Palomares, representative, Pablo Sanchez, treasurerg Bottom: Jennifer Meler, secretaryg Vonda Scanlon, presidentg Lynne Munson, vice-president. U-.WNW PLANNING FOR THAT SPECIAL NIGHT Returning from a successful sophomore year, the class of '82' struggled to achieve its goals with the prom as its main objective. Starting early in the year with candy sales, concessions, and car washes, the juniors raised a thousand dollars by January. Several Coachella Valley establishments were contacted and asked to bid for prom. It was diffi- cult to select the prom site. Some were perfect, but bookedg others, too expensive. Eventually, the Lake Tamarisk Recreation Hall was selected as the prom site. The theme It,s A Fantasy was selected and agreed upon, and deco- rations portraying a jungle setting were designed by the Prom Committee. Participation and early profits from pre-sales guaranteed a successful eve- ning. I' I 4 Agatha Palomares ponders over a list of prom location possibilities. Agatha Tangi Roberta Pablo Vonda Palomares Reeves Rose Sanchez Scanlon Emily Brent Andy Frank Alane Sherwood Smith Stanga Tisdel Underwood Kim Janet A112111 Vann Wallace WCSI ,t Y Bill Gigante of Visual Sports Network positions the varsity volleyball members, Kristine J amison, Patty Casillas, and Sandra Carson for Memory Mate Photographs. L Juniors Sandra Carson and Tangi Reeves sepa- rate cookies before delivering. Y Night workers Bobbie Rose, Elisa Burdick, and Vonda Scanlon pause several minutes with the eagle constructed for the junior float. Y Kristine Jamison hurries to beat the eight o'clock bell. WE'VE GOTSPIRIT Hrst signs of J unior-Pride were evident when 82's students participated in the design and cre- ation of a float. Sponsors demonstrated the spirit of Homecoming by sharing unique ideas and donating time, materials, and skills. Sharpened skills, plus determined spirit, were evident as juniors displayed a persevering attitude. Balloon shaving, football pass, and class skit com- petitions, utliizing a majority of the class popula- tion, were won by 82.', Combined efforts of juniors, directed by positive sponsors and student leadership, continued to pave the way for a successful year. A Who's got the big mouth? Scott McBride and Andy Stanga compete for the title. 1 We're number one! juniors shout, as they continue their cruise down Main A David Roaring Rabbit Lewis, Lynne Clara Kent Munson and Jennifer Louis Lane Meler perform during award winning junior class skit. L Keith Hudson ponders a controversial world history question. Y Kathy Underwood and Alice Enriquez pose as Eagles during sophomore Home- coming skit. SOPHS CLIMB THE LADDER Fundraising activities . . . cushion sales and con- cessions, enabled sophomores to prepare for next year's prom. Additional privileges were gained collectively by second year students. School rings were selected by class officers and purchased by wealthier class members. Individually, sophomores were sched- uled into several required classes, such as world history. Arriving at the magical age of sixteen, many sophomores inherited the privilege of Cruising Main, after passing the required semester of driv- er's education. But, after getting that long awaited license, new cars, dating, or simply going places without Mom and Dad meant one step further up the ladder. l t l Baldwin Bonnie Kevin Larry Abfille Aston Baird Ballard l Roger Fred Gina Gary Brake Brandon Cannata Cantral Kenny Phil Alice Sue Cole DeLaO Enriquez Epperson n Lee Evans l Lalo Garica Nancy William Donna Evans Evans Fahey Greg. Vicky Regina Garside Garza Gonzales A Twins Carla and Darla Ragsdale confuse Kim Vann during lunch break. A Sophomore Donna Fahey enters yearbook contest in hopes of winning a new Mustang. A Class of '83 ecstatically does class cheer at pep assembly. 4 Mr.-. . X sw . ,rl A .X , , Q: Eric Carlota Keith A, t Green Gutierrez Hudson A .I t ,Patti A , A3 Jenkins A Sophomore Lorena Patrick wishes she were a foot taller. L Sophomore officers take their duties seriously. Top: Roger Brake, representiveg Phil DeLao, treasurerg Bottom: Lalo Garcia, presidentg Renee Robles, secretaryg Fred Sanchez, vice- president. Matt Debbie Y Brad J0hf1 Major McCormick Olson OUIHSCT Donna Mike Lorena Carla Owens Owens Patrick Ragsdale K ,qs . I 2 i ' if V ,f y A , 1 V, , A L .1 Jfifiy' LQ. ,fx If 4 i lljzgf L27 'ff te' aff' J ' , 521' ,Q ' 'X , p y il our om SHELL fr A. U QA if f .1 5, D . . . , . . ij, kv' X' ffl ,Qv uring Spirit Week s five days, the sophomores tiff. p ff' ,I proved to be a formidalbe challenge to opposing Jfip classes. 83's best outlasted balloon stomp competi- a If X' X tion. Rowdy sophs then shattered safe decible lev- - U C1 CQ! els by winning the yell competition. .Q X ji Float designers offered an eagle hatching from 'Uk K. ' . . . i ' an egg within a nest, supported by branches. Con- A siderable patience and materials were needed to F Lg accomplish this extensive project. Sophomores if V, Sq X, LLL,f if EF provided visual and verbal excitement and punch, 73 . . K ' ' , . all necessary ingredients to a successful Home- 1T J A if re' coming. its fflf i SQ 'tl A k ' fix , 37 A Mike Owens impersonates Coach Rylie McDowell during sophomore class skit. 4 Lorena Patrick and Donna Owens enjoyed a quiet lunch. A Donna Fahey listens attentively to Mrs. Sparkman's world history lec- ture. 91 GETTING BEHIND THE WHEEL The big day had arrived. The day all sophomores either looked forward to or dreaded. When they got behind that steering wheel they found them- selves nervous, with sweaty hands and a slight case of extra alertness. Using knowledge they learned in the classroom, they looked constantly, made decisions, and tried to see if all the other passengers were still with them, fortunately they were. When sophomores passed driver's training, it meant many things, such as a new car, dating and feeling somewhat independent. I P Kathy Underwood glowers ata car blocking her escape to lunch. . Darla M-Clillda Rene Fred Robert 4 Ragsdale R1Ch3fdS0H Robles Sanchez Shorter I l A Johnny Christopher Theresa Eric Kathy Soto' Stokes Sutton Tomlinson Underwood Becky David Vicky Vasquez Yates Yates Y Sophomores Matt Major and Lalo Garcia show contrasting study habits in Spanish II class Y Curtis Gausvik quietly studies in world history. MW me .-.nu L Ecstatic freshman Andy Reed, Michelle Richardson, Katrina Horn, Roberta Carlson, and Linda Peoples react to the freshmen lifesaver pass victory during Homecoming week. 1 Desiree Ballantine and Saul Cantu eagerly approach their next class. Y Freshmen Class Officers: Left to Right: Audra Underwood, treasurerg Tricia Foster, representativeg Mary Tisdel, presidentg John Crane, vice-president. 94 THROUGH FRESH EYES Lockers that refuse to open, seniors who love to harass, being tardy because you couldn't find your classroom . . . these are just a few of the problems freshmen encountered on September second. Adjusting to a new environment requires read- justing one's lifestyle. New rigorous schedules with less freedom of selection, privileges of activity period, and becoming a member of a team or club were new experiences for freshmen. 1 love letter sent to her. Beginning to get along with new teachers and making lasting friendships with fellow upperclass men were all part of the first day of school 1 Shanna Underwood reads a mysterious Colleen Danielle DCSIICC Nathan Marsha Anderson Baker Ballantine Barns B3rf21Ckm21I1 Saul Roberta Eva Kay Mark Cantu Carlson Cieslar Cole Cook A Colleen Anderson and Mike Nees compare lecture notes in Mr. Mon-ison's science class. 5 Tina Garvin, a member of the Drill Team, carefully totals her cash box in the snack bar. A Danielle Baker demonstrates the reinforce coil method on what will be a future hand built pig. l SEXY LEGS N'LlFE SA VERS Initiation into Homecoming festivities for many classes might prove to be a painful experience. Not so for the class of eighty-four, as their spirit and ' determination prevailed. On Monday, Tom Knight's legs were judged as 'most sexy. Utilizing speed and agility, the fresh- man corps later defeated the competition in the peanut roll and lifesaver pass contest. On a more constructive role, the freshman cre- ated a desert scene float. Freshmen proved to be a competitive class who were ready and willing to show their spirit. 4 Erban Fermon demonstrates an award winning orange technique, which brought P the freshmen a victory in this competition John Bridgette Cheryl Mark Erban Crane Cushing Diago Evans FCTIIIOII Trisha Calvin Tina Larry Raymond Foster Gaines GafVi11 GYCC11 Guerra Frankie Greg Katrina Tom Laura Gutierrez Hopkins Horn Knight Lewis FIRSTS FOR FRESHMEN Discovering what high shool is really like was the most exciting lesson learned by the new freshmen. Beginning the year with many new and different experiences taught the freshmen that dating, dances, clothes, and money were important necessities of their new high school lives. First experiences for freshmen included trying out for football and volleyball teams, joining campus clubs, experiencing and participating in their first Homecoming week, and deciding what high school electives to take. ferent activities, proved to be a problem for many of these first year high school students. After a long Homecoming night of danc- ing, Pete DelaO and Mary Tisdel find themselves exhausted from the evening events. Sheffb' Jaime Virginia Debbie David LCWIS Lopez Lopez Luisi McGill , Y l l Chris, I Martha Trent Robert Mike M CK1S51C Mendel Mills Morales Nees Gracie Beverly Glenda Linda Chris Nunez Olson O'Yates Peoples Pickering Finding study time, while involved in so many dif- Andrea Tim Shelley Joey Patsy Reed Reynolds Robertson Sauceda Sauceda J anene Steve Brian M ary Audra Saxton Shives Smith Tisdel Underwood Shanna Brian Kevin Underwood Wodetski Wright 4 Debbie Luisi practices value techniques on one of her still life draw ings. A An unidentified flying hand attacks Cleve Gray. A Dance pastimes also involved gossip, prac- ticed by Donna Fahey and Georgene Graham. L Slow dancing is also a favorite of many, as demonstrated by these students at the yearbook Back to School Dance. L AUTUMNC9 TEENS BUMP F ace it. Aside from athletics, night life for teens in Eagle Mountain is at best, dreary. With few after-school and evening activities, many underclass- men look forward to school sponsored dances. Dances were organized by class, club or commu- nity groups. Talon sponsored early September's Back to School Dance , and the seniors followed shortly with a dance after a football game. Dances were usually not profitable as many stu- dents chose not to attend, yet fofihose who did, these evening activities proved to be fun, Although dancing was the primary reason for attending, dances also provided an occasion to sit back and listen to music, and Just be with friends. X ,..' -N -,, aff' ,f 4 Alumnus Connie Tanner slow dances with her date, David Wick. A As the tempo picks up more people get out onto the floor. JUDGEMENT DAY i A common fear shared by many underclassmen was the arrival of report cards! What will my parents say? was a most often echoed thought. Others looked for- ward to the praise and acknowledgement of their hard work. Some report cards never reached their destination, but eventually, parents always seemed to find out. Junior English teacher, Anne Karns, discusses first semester grades with Gerald Butler Faculty CONCERN, PATIENCE, SUPPORT Todays world demands that a person must have certain qualities in order to be a success. Patience is one of these qual- ities most often exhibited by E.M.H.S. faculty, staff, and administration. Dedicated district employees continually take time to 'assist students with their scheduling of classes, and counseling. Besides preparing lesson plans or lectures, writing or grad- ing tests, and the other work that goes into the classroom side of education, E.M.H.S. faculty still finds time to sponsor, or coach afterschool activities that contribute to the success of outside curriculum. Support and friendship from a teacher can be a valuable tool in the formation of the student's char- acter as well as an essential aid in his growth. Teachers con- tribute a great deal to our lives. They help mold and shape us into a pattern we will carry with us forever. A C.M. Sparkman assists Bev Olson with a math problem. A Physical education athletes are given guidance and support by Mike Bon Tempo. A Anne Karns and Phyllis Lewis discuss the bill of faire at the faculty Christmas luncheon. Iohn Senecal 7930-7980 T he Eagle Mountain community suffered a very real shock, a strong sense of loss, and a painful setback with the death of Jack Senecal. Eagle Mountian High School princi- pal for four years, Jack Senecal represented the school and its young people to the best of his ability. He was sincere and earnest in his efforts to be as fair as possible with stu- dents, and he cared a great deal about their programs and welfare. He was admired and respected by all those who knew and worked with him. He was the most honest and intelligent person I have ever had the privilege of knowing. I was proud to be his friend. He was sincere and earnest in his effort to make E.M. a welcome part of the Arrowhead League. These comments about Mr. Jack Senecal were made by people who wokred for and with him. His dedi- cated administration helped greatly to make the 1980-81 year a success both academically and extracurricularly for the students of E.M.H.S. A John Senecal, Principal. L Students, faculty, and community honored John Senecal at a December 19th Memorial Service. C.M Sparkman and Randy Shum- way, along with local dignitaries and clergy, eloquently expressed their thoughts. 5 Rand Shumway, Athletic Director. 104 5 5 .,.. . . Si Ll 'e-e . : z . ' . -' 2 i l , t ..,. Q rt s ei 2 I Q -Q at S . . 1- . . ski ., . S la t . t E I 4 Michael Bertola, Board of Trustees, Presi dent. 4 Terry Carr, Board Member. Y John Englund, Board Member. Y Kenneth Franks, Board Member. Y Charlotte Jesse, Board Member. Y Mr. M eler welcomes back students to the l980-8l school year. l 5 , Y Joseph Meler, Jr., Superintendent. SENSIBLE SOLUTIONS Educational responsibilities do not end with the hiring of teachersg continuing student welfare and development must still be maintained. Provid- ing a quality education for students in a safe envi- ronment is the major aim of our school district, according to superintendent Joseph Meler, Jr. Mr. Meler had previously served as principal of E.M.H.S. Returning to our community after eleven years absence, Mr. Meler was hired in 1978 1 as superintendent. Following Mr. Senecalis tragic death in December, Mr. Meler became acting high school principal. E 5 as 's A Karen Kirby, Administrative School Sec- retary. A Mrs. Rose and Mrs. Kirby discuss the A.S.B. budget. A Eva RoseQ A.S.B. Clerk. L F.H.A. service projects included baking and distributing Valentine's cookies for teachers. Mrs. Sparkman cheerfully accepts cookies from Patti Jenkins. 106 STRIVING FOR STUDENT SUCCESS rave thoughtful krnd helpful sounds like a scouting motto yet Karen Kirby and Eva Rose exemplify such characteristics Termmally busy they begin two weeks before the school year by sorting a summer s load of mail preparing for returning teachers and gettrng ready to answer Attendance paperwork A S B school budgets coffee making counseling phone receptromst tasks and typing endless reports were some of the many services performed by our diligent secretar B 3 5 - 9 7 I S - 9 . , . . 3 . , . questions from confused students. 7 7 ' ' '9 9 9 7 7 ies. 3355 .311 ' k' ' ' ll? 5 sw . 5 . Z l fsgs A gt as - .ls l s 5 .gigw T it i . ?E . 5 5 5 iii ' 2 gg. TF. . 255 f ss I ' s l is .s. est' iss ..,..,,..,...............,.t......Z....e..m...., ii Ki ,gh , . ff .. J R. tw M.. t ew A Judie Adams, Executive Secretary. I A Karla Kivisto-Taylor, Accounting Clerk, Typist. f A Betty Manley, Accounting Clerk. 'U 1 I Ji A Work progressed slowly this year on portable units at the Vip ,Q W1 .70 Kaiser Middle School site. An already small maintenance 411 ' W M workforce was further depleted at the fall semester's end IJ W , 5 when all student employees were terminated because of , 0 WW 04 LJXV budget cutbacks. 9 A Gaye Peterson, Payroll, Personnel. Qc, - A Leota Kain operates bus five. Two daily round trips to Hayfield and other stops enroute are provided to students under her supervision. In addition students are transported to other outlying Metropolitian Pumping Plants and com- munities. 4 Krystyna Cieslar performing one of many job duties in Mr. Weitz's class. Budget cutbacks also affected the custo- dial crew. Instead of being able to clean school rooms nightly, classes were cleaned on an altemate daily schedule. This schedule was adopted second semester after several custodians were laid off. L Michael Bon Tempo, Physical Education. 5 Glenda Grover- Casillas points out the correct form for the backstroke. 5 Chet Brenneise, Band and Choir. Y Rick Brown, English and Drama. Y Steve Weitz reclines while instructing junior history. 108 PROMOTING MANKIND P romoting an understanding of lifestyles through economics, history, and international rela- tions are several goals of the Social Science depart- ment. Sophomores enrolled in world history learned of ancient world culture's effects on modern society. Juniors applied this knowledge to specific present day situations while learning about American cul- ture. Government and California survival, com- pulsory for seniors, are survival courses that will enable eighty-one's graduates to cope with the out- ' f side world. , Q it ,J Ax F t ' ' if ' V X fi l F A fyfl L L, Iwi, 'J Lim ' fad. l M riff V J ly If rw K, MU f A it .I N if , W5 Q M , lx , N it 1 we A 1- its as , , gf 5 jpg, in ,i tyyfef few 'f Lf -A 141 Q fe L . ' W '5 I, :li fs V 4' 'Y Q' L fy ' 4 xp ,aff ,Q of ,lf , E , V: if-, fi V' t -ia, Aw M :fi 'A , V vi Q: lf- 1 my .r S, fx 1-9? I My am Q, 4 3 M , r N i 'L W I 5 ' J HQ! , , ' Cage , X- t i Q f1al.:.Q ffl F 1 l - , t .V X I I ,iv V 41,-yy, , ,f 3 AQ Zi ' U, t, x -W We Q f Mx - J ' ' el, f Ji , ' G g V, wr I Hts 'J t K Z i Vfii Q: et.. if-:affix J if X . X .M 5 2 X E DROPPING EGGS R egistering for a visual art course gave students the opportunity to express themselves creatively in two and three dimensional areas of design. Art, taught by Lee Samuels, encouraged students to stive for originality while using their imaginations. Autumn's egg and Charger poster projects served as a prime example of students using their inventive nature to create extensions of their personalities. 4 Critique is ofen a valuable tool in reshaping student thinking. Mr. Samuels critiques a students artwork. Y LeRoy Burdick, Special Education. Y Mark Carrow, R.O.P. Auto Shop. Y Suzy Evans, Career Center Aide. s l s 5 109 ., as . A Glenda Grover-Casillas, Physical Education. A Correcting papers is just part of a teachers instructional day. Miss Kams records junior liter- ature grades. D Edith Heath, R.O.P. Restau- rant. P Rand Shumway, Bob Reeves, Sr. and C. M. Spark- man concentrate on a football scrimmage. All three men donated their fall evenings to score-keeping duties. P Anne Karns, English, Span- ish. ll0 TOLKEIN, TWAIN, THACKERY Back to basics became a reality for eighty's students Despite E M H S 's small enrollment students are still offered a variety of Enghsh learn mg experiences that continue to promote English fundamentals Today s world requires the specialized basic art of successful commumcation Enghsh department teachers achieve this Sklll competency by incorpo rating the reading of literature with the study of sentence structure and vocabulary usage Programs tend to be more successful when teachers share personal experience anecdotes or in the case of English department teachers favor ite hterary authors Fantasies such as The Hobbit and literature that gives insights about ourselves and others are favorites of Richard Brown and are used by him in teaching sophomore literature and freshman Eng hsh classes . . . . . , , . . . . , . I 7 7 , - M. 1 1 1 Eli' E s E 5 ON YOUR OWN NN THE EIGHTIES Budgets planned, marriages performed, and students taught how to live on their own are several of the life experiences presented by Kathy MacNamara in home economic's On Your Own in the Eighties. Designed to assist students in determining personal goals that will affect after high school roles is a major objective of such a course. Familiarizing students with insurance forms and personal budgeting practices gives them the experience they need to successfully get along in adulthood. A Susan Lippman, Librarian, English. A Patti Masotti, School Nurse. A Rylie McDowell, Business, Driver Education. 4 Miss Mac discussesgan impending modlgwedding with W . 1 1 -X V, 5 . Pablo Sanchez. . ,Vip , ' L- J V , X W, ,N Q, ll X. ' 5 5 'xl 1 2 1 P s Q ft .X f ,, X . . t. at .N wtf: mg, . . 1 ,,f . . . 5 . 4 , . . 1 v, i tx if yf ,im V. 0 M lj, ., ENN . '91 V A 1. up Q ' , MLM' Iv Y I ,i rfcf' jf' l Vi: f 1. ry' . 1 f 1 f .Wg vi V' LF' ,inf 5' . it ' -ra f J' J if X H. -f Y ft 1 ' k , - 'rv C: yy W ' A Jul' f J ' if . 'W in-'VW VL W fflfa I1 -' F We ,Q f i, Alu 'X L if -J, Q..-'X Q:-at ,img X f ra , 5' 54 gl x Q D, ' . V 2. D -'gw.'i 4.L2 HM Nb wiv 25-My , r 1? if Q -.Ji 'fl' fwfr. firjl 2,3 xx t S MN as yi' ' if mp'-iff' f W, wiv :gh . t L. M V ,X W fi I -lbw ,- cf .wc 3 I' A t li ix. .M Vx Xljfi H i 5 ly ' JH' gi ' M ,-it .. ,af ,f if bla fa ' . Y. 3 ,u, , r i 3 J My ,- 1 r . if Jil, . 1'W.if,i.w fi-ry' .1 . A ' . ttf 5 54324: 4 -Q' .1 if Q l 1, ff 5 K A 4 1 3 N xy J' f Cf H A .fmt W 'y' , K DMM 'v U i M, ' X , ' jg,-1,41 U i gr 1 1 fl .M ' wi Q .V ' 1 if J 'wg , s- g l +' HM yy 5 X-wb F fd iw 'al U- , IJ., pf . pf :H t' lf , vl gf il QV. .W 25' HJ' l l ily 5 vt 55,59 P in G X ' f 35 5. i J -f. f 1 N' ui fxi Kia 1 1 V r v , 4 , 'V 'Wi M - f' , Q 'l fs, - i Q ,i , U S ll Q ,J gl - 347 591 5 2 fm -X A 'MJ ,. tl , VX? 9 't ' iw Tia J' ff J,1La 5 I- ' i r 5 trgyg G, L , wharf ,iM.yu, 5 l ,.y.. . ,f ,ef .i 1 :AWJ ..w,.vF,,uM X 1 W it rv 1- . , te in -t 3 if , .1 I n N 5 nip by 5 vi, V gli: t LN , ivy' A 'M il' Rig' 2-i ' 1 l '5 3 ff 1,2 ii 7' , J M , 4, , I ,gl . ,I V, ,V X, 3.3.9 Q. fi - i if r W' .Q A :N f, Hwy ,il '. -f 1 U V ' f iw ifviiiw fifiihl W X gf J M ., . 2 1. ' ...1 M X ff. . .ol V vii: f if 1 wi 2 ,. , fm .V V... W . frflblf VWLV' f if wigs. , RW 1 .lf ' W lm ,Q sz l N ' A 5' . J V 3 l 4 ' ll, , tx , ml , . X t iw 1 u by my is ' rt . M- 2- 2 -1 ny ' M ,, ,ff 1. :LV M - Nlsxv E J ,J , ,N v JY ., U J A ,XV .wp-y , V QJV lift f . , , I, , 7 lll i M ' t , ,A Wy X ni Lk. sf l A Jim Ramsey, Wood- shop, Leathers. A Mr. Sparkman dem- onstrates using the key- board, which programs the computer. L Lee Samuels, Art, Yearbook. P Faculty and staff also celebrate birthdays. Mrs. Rose's cake was in the form of a ledger. L C. M. Sparkman, Mathematics. X + Y COMPUTER ew add1t1on to the math department a computer' Used by Mr Sparkman to acquaint stu dents with a basic knowledge of computers and their uses it proved to be an exciting and modem new way to learn Students used the computer for practice and remedlal arithmetic problems Seniors studied how to write computer programs Inevltably some stu dents having developed an understanding of baslc computer language will decide to pursue a career in computer science ! , ' 9 9 . 1 4 Phyllis Sparkman, English, Social Science. Y Mr. Sparkman prepares his form for the spring golf season. AFTER THE LAST BELL Promoting school spirit is an impor- tant part of a devoted teacherls labor. Hours are utilized in perfecting the talents of students after most people are enjoying the comforts of home. Grading papers, lesson planning, and student crisis solving are routines that occur daily, all after the last bell. Teachers are able to occasionally relax and recreate. Unwinding includes partici- pating in outdoor recreation and activities that closely parallel subject areas taught. Talon has endeavored to construct the composite Recreational Teacher. That being can be viewed as an individual that enjoys gourmet cooking, freshwater fish- ing, golfing, traveling to exotic far-away places . . . Charger games included . . . listening to unspecified types of music and reading literary classics. Money Matters ADVERTISING AGENTS PA TRONIZE A Q0-copy editors Cyndie Knight and Janice Payne plan strategy for the Indio ad-selling trip. 4 Yearbook advisor, Mr. Samuels, pro- vides ad-sellers with last minute sugges- tive selling tips. A .Kim Vann and Bonnie Aston compare swimwear styles at Indio's Clothesline. Yearbooks cost big bucks, there fore, besides being a type of history book for the school, the yearbook is also an advertising agent. Businesses from Indio, Blythe and Eagle Mountain pledged their support to our school by placing an ad in the Talon. The ads are seen by many who read the book. In this way, businesses can bring knowledge of their products to more people. The money from these ads also helps to make improvements in the book. We ask you to patronize the businesses who have pledged their support to Eagle Mountain. Buying at their stores or using their product will help them as well as our school, because without their support, producing this year- book would not have been possible. CUNGRATULATION S CLASS GF 81 from DR ROY WILKIN DENTIST Al s Famlly Shoe Store Natlonally Advertlsed Brands Two Locations to Serve You ln the Same Bulldlng 82 884 Mules Ave 82 892 Mules Ave lndlo Callf lndlo Callf Mens Boys Ladles Children Downtown ndlo 3ette11 OLD FASHIONED ICE CREAM 227 H 4714! 347 IBIS 92201 75407400 k,,.a,,,,,A Mama Hume lmpruvemenillenler 00 I xl LEF ALLISON INDIO CN ORNIA 9 OI 17141347 91 lvl-al:-147 :aeoe auanaugg E sch COMMERCIAL PRINTING OF ALL KINDS WEDDING INVITATIONS 81 714!345 7316 45 102 SMURR STREET INDIO CALIFORNIA 99201 CIRO S RESTAU RANTE Real Italian Food 81 Pizza Orders To Take Out 81 853 Hlghway 111 at MonroeSt lndlo CA 'l' Closed Tuesday Landmark For Pizza Lovers INDIO Em. Nos BENTON S PAINT, INC. U NIVERSAL BETTER PAINTS WALLPAPER ARTIST S SUPPLIES DICK ll PRESIDENT 45 250 SMURR INDIO 347 0043 ARCADE SHOPS REDLANDS 7921044 INDIO CALIF 92201 C7141 347 oo97 0 IIEIIG aII y QIHSS Umpally WE ESTIMATE ANY Jos STORE FRONTS I GLAZING 0 SHOWER DOORS FURN RE S I IRRORI 6 614 HWY 111 DAVID WEAVER 9 ownln MANAGER , . 1 - 1 - ' ' I F M 52- . III . I . CA -W 7 2.1 fd 'Q. .UmMnrUlwls '- ,Q r Q 5 I-IARDWAPE . LLJNIBEF-I . CONCRETE - ' 9 1 L f LC CONDITIONING AND ELECTRICALCO 'rn 83-7 ' Ii I I '. . LII ' -- +23 ' y I .. V V . R A 9 C HC KIJ E C FFP' deans music citq GOOD PRICEIGOOD SERVICEIGOOD RENTALS - GOOD VIBE! I 62-704 MILES AVENUE CORNER OF' MILES Q OASIS , INDIO. CA 92201 Deaf' F 0 u ' 47141 347-5245 1 IL I, ma, Y'-S . W J? s- ,fly i1 n Q Jfifn 1 ig-N51 ,s 1 . . 5121212275 , : HQ 'Tw-2? if A W1 , . is Q rx 6, ip. if , ,,,, I V mm, ll., we.-1 Wg!-ng., lilfl al ,3iqf 5 . ,M 4 , 3 ie. , eg,-,,.1. E 4,15 gf- ' ' ' F I -'ev' f' 511131, f 'Q' A ' If . 1 ,srl w w ll I gf: ' -i H, 'EIT ' .' J 1 'J 'lf ' Alai' 44 ' li , 1914? W 1 f I- .,-fx' 1 f , J'-, - 3 452 'alia J. ffl of i .egwy 5, 13,124 -gig IMF , -- 1,-P 'Ein -gr 315,12 je, 'f 5915 ' 1 15351531 12112 :wL',2Y P l - Llc: l Will! fi- , : ALL PHONES 347-3531 , , suxvlce 1'-,F MIASIHED -,. KYIY' ' 'L 233,12 I I' me - -- f, 9324 In Your Hour of Need 1 dzciilrnrg glfuneral Hume CORNER OF REQUA AND FARGO 82 975 REQUA AVENUE JAMES H FITZHENRY INDIO CALIFORNIA 92201 IMPERIAL MOTORS DODGE PLYMOUTH CHRYSLER 83-095 Indio Blvd 68-350 Hwy 111 ndlo Cathedral Clty 347 8502 328 3103 Wandh Waller 652 Hzqhway Til H1 Indio Enid 52201 JK Indio Catalog Sales Agency BOB AND PHYLLIS FRANCE Owuina 82 729 MILES AVE INDIO CALIF 92201 17141 3470721 THE AC LUMBER CQ A Duv sion o Ina A C Houston Lumbev Co Lumbermen Since 1884 83 490Indlo Blvd IP O Box GG Indlo Callfornla 92201 117141347 3692 P' r F' F' ff I , . C' , - A A 'l'fffEff1,- , NUNN-BUSH - JARMAN - WOLVERINE - RED WING JUSTIN JUMPING JACKS CHILD LIFE GERBERICH U S KEDS ORTHOPEDIC NATURALIZER LIFE STRIDE MISS AMERICA .9nIIIo Shoe Siare THE FAMILY SHOE STORE PHONE 347 3395 B2 769 NIILE5 AVENUE BII.I. FEHIQANTI MAN can INI:IIo CALIFORNIA FRED KOEHLER 81 SONS FARM Bc GARDEN SUPPLIES 1920 45 234 FARGO STREET PHONE INI:IIo CALIFORNIA 92201 17141 347 1063 17141 3471266 JLNNINGS HARDWARE G SUPPLY CHARLIII fBUDl WILLIAM. 45 185 SMURR ST INDIO CA 92201 EDWARD O JOHNSON JR fzeld sales supervuor 45 480 Commerce UnI'r I lndIo CCIIIIOTHIG 92201 busmess 17141347 3586 resIdence 17141 347 9685 IIIIIIIIII III IIIIINI' I AND SUPPLY CORP CALIFORNIA I1m Hall Mazda Induo 83167 Hwy 111 17141 347 0641 or COACHELLA VALLEY PROPERTIES I LP 'Ili I hi El IIN 11575 IIHIWII ill Pham 17141 342 1541 RAY RUMMONDS I714I 3453845 R,s,d,,,,,e Phan. 81 713 HIGHWAY 111 17141347 3087 1:1146 INDIO CALIFORNIA 92201 alum: PI-IOTO BILL IOHNSON 82 789 Mxles Ave C7147 347 3774 INDIO CA 92201 The Deserts Complete Camera Shop Color Lab on Prem1ses 77 1 m,z,, CAR PETS VINYLS LI NOLEUM FLOOR COVERINGS ll 500 HIGHWAY 111 INDIO CALIFORNIA Phone 347 3871 annum Phono 346-3351 AIT 'UU ESTABLISHED IN I . A . o . F 'I 1 . . I . I ' 1 ' 1 - - . I ' 1 - MANAGER I - ' I ' I . 1 X T S I WI. . K H Q I N . Q I, ns, I xiii' 2 1 'VS 5: ,zi9 11.1111 3 If' .. If f1z11glglI i 114flI5 - . . I ac , - , ' TI E I I 1 - . . 99 O Congratulauons to the Graduates of 1981 Towne Barber Shop Sz Miss Ann,s Coiffure 45-127 Towne Indio, Calif. 92210 Phone 347-2128 All Phases of Barberlng Preolslon Hair Cuttmg Complete Beauty Services -,Av CDN carpet 51IdI Bld Idl C D AL ROSSO Um 347 3434 SUNRISE CHEVROLET-OLDSMOBILE me 33 333 HIGHWAY 111 0 INDIO CALIFORNIA 92201 PHONE 1714I 347 3451 FROM P S 3451059 Barbara Schroeder D a S eehans OFFICE EQUIPMENT SALES 8 99 REPAIRS 45 130 OASIS ST TOM SHEEHAN INDIO CAL 92201 United Artists Beauty Gollege 45 75: IargoStrL t 17141347 0811 Ind: Calltornm 92201 SHIM Rllll A EIA cSA1m .r .zoulzyue ef? gmporl: mono nsmon MALI. azzzv HIGHWAY 111 mono CA ozzor I 17141342 4015 Rl! 17141346 1388 All types of Orlental glfts FRESH From Oven to You MCXICHH Sweet Bread Damsh Donuts Cheese Cake Cakes 81 G00d16S MonSat 730AM 60OPM VALLEY BAKERY 4-5 065 Towne St 347 1361 utr I3-1 no v.,no. 1.2201 I ' e Iar Mlnlglr . SUPPLIES 714 347- Q STATIONERY A . -. . PMON: - ' 1 3 ' 5 ' ' B G AUTO PARTS DON FAULKNER MANAGER 401 W HOBSONWAY BLYTHE CA 92225 UI-11 922 2126 Congratulatmns Class of 81 Carl s Ir Restaurant Carl Karcher Enterpmses Blythe cusrom nsslcu a. STEEL manlcnlou specmunzmc IN FARM MACHINERY ' CORWIN ' WELDING 8a MACHINE SHOP weromc 0 currmo 0 mc:-une wonx 0 STEEL suPP1.1Fs 0 ms N. Asn smear Po. sox 261 1714! 922-2355 BLYTHE, CA. 92225 Like a good E neighbor A Sfate Farm ,M .noun o. cnmu 'S there' 17' fail' ff Agent ai ' 2-4491 A ..I f 'ff 'I 9 E if2!g,,f .aaa L Q . NI' l, r I STATE FARM TNSURANCE COMPANIES 0 ED CES BLOOMINGTDN ILLINOIS 127 East Hobsonway Blythe, California 92225 Phone: 17141 922-7533 EARLE SHACKELFORD OWNER QTE5, E.0UE.'l. INDIAN JEWELRY TURQUOISE SILVER GOLD AND OLD PAWN JEWELRY 191 5 LOVEKIN TELEPHONE LYTHE CALIF 92225 17141 922 9553 PHONE 922 2136 RES 922 3647 GUILIN TIRE SERVICE 420W HoasoNwAY ALEX GUILIN an-me CALIF aaazu uqwcu-mI um er mpanq, nc I27 SOUTH MAIN STREET. P.O. Box 700 BLYTHE. CALIFORNIA BILL WARD BUS. PHONE 922-4891 Mnuozn HOME PHONE 922-2672 Phone' 922-1307 I Kld s Kloset COMPLETE, SELECTION OF CLOTHES FOR INFANTS, BOYS AND GIRLS 731 WEST HOBSONWAY BLYTHE, CALIFORNIA 92225 Custom Ad Page TELEPHONE K77-47922 8127 I7I4l 922 5411 MERCHANTS AND FARMERS STATE BA fU3NEy ,g3UI7lll'y HH!! Cleaners NK 435 W HoasoNwAv 1 1 B1 ne C110 .a 92226 1111 w sl an B'-YTHE CA'-'F 92225 NEW B: USED INTERNATIONAL HARVESTER TR CKS C ORS PALO VERDE EQUIPMENT 11'-35-JOVV I-I E ON E 714 922 B550 GIBSON WEST! NGHOUSE UAW53 PHONE 022-7111 Wiglnts Appliance S' Fmnituxe COMPLETE HOME FURNISHINGS :WA susn 132 L Honoouwlw c L auo Pmrvs P0 BOX 1070 q,,,.,,,, Burma cm! seas R A PITTIR-IN JR CONTR LIC NUMIERI CALIF 368484 ARIZ il!!! Pettersen Electric Inc ELECTRICAL CONTRACTOR BLYTHE CALIFORNIA 413 WEST HOISGNWAY PHONE 922 4361 WARREN G HEMFHILL .Muze 5 HEMFHILL oVmpHzf!4 s H 1: E s IINUI 1911 139 N SPRING IT Pl-IDN! 922 2412 BLYTHE CALIFDRNIA LIYI ITIIDI BUITIR EIUWN FIDWIN FLEIIIHIIM SARAH S HAIR STYLES AND COSMETICS ,ll 423 W Hobsonway Blythe Cahf Phone 922 7201 Wig Service Sz Men's Styling nn up ALWAYS FIRST QUALITY Congratulatlons To The Class of 81 , fnnrlnfwn.-7 . F.O. BOx29- yI,a11111 - e H y - f - - TR , 9 E11 x 'HE' C,x11Fr1PN1A J C WWA, LARRY SKIP BEYNCN Hue 17141922 7171 l u 1. .. , I PANTL, MANAGER F? 1 1 - T - - - . . ., . . I I , . u nl? I . . . 9 n . , Q X . Q : - 9 ,...1.-wg,-:.:'::'.. Qs ir? vfzwtfw Mgsweii CORNER OF REQUA AND SMURR INDIO CALIFORNIA 92201 GOODYEAR TIRE CENTERS 347 4034 81 943 Hwy 111 lndlo 347 0693 83 420 Ind1o Blvd Ind1o 0 ANK of INDIO Your Local Independent Bank Servlng the Coachella Valley Town 8: Country Plaza West Ind1o 347 6156 an 73 301 Hlghway 111 Palm Desert ' 340 1861 Featuring the Innovatwe BANKAMATIC 24 Hour Banklng Member FDIC Ladxes 8: Ch1ldrens Fashlons Gowns 8: Br1dal Shoppe Ph. 17141 347 8658 82 939 Mlles Ave Ind1o, CA 92201 5 I I , Q , I ' n ' -H Q 1 151, 3 - I -. 1 , 11 . K kv A 1 1 - . .- f 1 x ' K I R A X ' .Ii ,- I , ' -I 'I L.: 0 , . ,P K' ' ,A I I , I. .1 .I 9 wil' faq, xv. fl. ' ' '- -' '-'52 ,fit I , ' 4 5 ZTTQEJMY 4. ' ','3gxfr714:3.-f,'l51. m.,,mmL I 5,1 .fhgisfq 07,4255 v 'V Vdg,gg,1.,-.. , , , iJ!3JLmI:'.l J.. .., T - - I , Y - - I, . E azmnras Q it U 1 . . - Ind1o Florlst 347 3391 44 953 Oasls Ave IHd10 CA Sgpacl IZC Palm Desert Florlst 346 1184 74 115 Hwy 111 Palm Desert CA W QQ? L Rancho M1rage F1or1st EAS? 71 321 Hwy 111 lm S A NSENM Rancho Mlrage CA 45 051' ,347 '3 ' wplhx a s Ri AS FTD Florlsts Transworld Dehvery The Wlllard Famlly I Sl-IIPMAN OWNER MATTRESS CITY CUSTOM MATRESS MADE TO ORDER Sm, Pomans Weddmgs WHOLESALE AND RETAIL Sports and much more by 81 600 HWY 111 INDIO, CA 92210 6714, 347 6787 ' RICHARD PENA SUNDAN CE STUDIO OF PHOTOGRAPHY - ., 9 4 ?f.f4mJAy , ' .. 7 , , , E 'L 5, 0 TQQQ L V: A - ' . XM, ,LA Qffxgafsrf A . f 4 .ww w 1 X- Af- 5 L 568-3535 L 'J A . fW:ll:fl.Xe . ' ' xeL,g,,g, . ,, f ' - S 'Eff ll W M 1 , A Pnzslona-r 9 Nl!! ll . 5: A, iv 4 s - - 9 1 r . F . . . . I X 4 DOT JUST --nf at gall, .,-- 5 ff,--, X,1- THE SFTITIE OLD THING. fX : f 1 m-'A fmf 'MEF - A 0 5 ' f A ft ai 1 - i , A J 5,4 K Q Je L,.,.,. , -A.,,,. ,.X. 1 Lee, ,,tw .1A. ,LAA1 ,L,QLf ,..,, 1 - 5, , l Hi J -2. .J 1' 1 1' .'?' i 1 - ,,.,A,-,,, , f - i Aka ,ff l 1 Lll 1, .sf m,b.,. L4,, V 9 5 -H1111 f f 'E , A Q M mt 1 ' f D419 S? A , 1 f2i Q, - h.'5f- kI'-, 'fh' eeieie . sou: Lnnce cu-was Rwnaf Swv I , w 11 1 f 2-AWEEK DELIVERY 21 gifs Qg 5 i iiee A i Ed J it 1 waz 1 gsm 'ty it A 'CMMS mmolgii E-Z MART 210 S. LOVEKIN C7143 922-9153 137 N. Spring Street Bette 8. John A. Teats Blythe, Ca. 92225 YTHE CONGRATULATIONS CLASS OF '81 BLYTHE CHEVRON FREEWA 1 CHEVRO Full Line of Tires and Batteries Availabl the ACCESSORY NEEDS for Your Car. CAR CARE SERVICE WORK DON E QNext to Hobo Joesj 321 So. Lovekin, Blythe 922-9382 e. Plus 11 1 Yamaha of Indio 12 Years of Service to Eagle Mountain Best Wishes to the Class of '81 From McDonald of Blythe CUSTOM T SHIRTS 81 CAPS FOR EVERYONE Over 1 OOO DesIgns DPW 119W Hobsonway Phone 714 922 6060 Blythe CaIIfornIa All Slzes Styles Colors We PGFSORHIIZG COME IN AND READ OUR WALLS EAGLE UN TAI m UNITED CALIFORNIA E tBANIc.,MIC Indio Office: 82-118 Highway W111, Indio, Ca. 92201 0 C7145 347-0951 Eagle MountaIn Pharmacy Open Monday FrIday 9 5 Our ComplIments to Past and Present Students at Eagle MOURTGIR HIgh School CONGRATULATIONS GRADUATES OF 1981 MAKE YELLOW MART YOUR SPORTS CENTER Students know that Yellow Mart is the top spot in the Valley for an amazing selection of sports equipment and sports leisure wear. LOOK TO YELLOW MART FOR . . . Regular and Custom Lettering Letterman Jackets Exercise Equipment Complete Base ball Football Softball and Volleyball Needs Accessories for your entire world of sports The lastest styles and most famous names in clothing for school and leisure wear are at Yel low Mart too LEVI S HANG TEN OCEAN PACIFIC THUNDERBOLT DITTO WRAN GLER LEE LOVE N STUFF KENNINGTON IMPACT LAGUNA and shoes by ADI DAS NIKE OONVERSE PUMA sron: nouns 553' Mo doylh rn 4 II in g ,lb 3 a so e e so p F 'dvr na sqm a y ' so nintguut 5 day 9 ANNEX sToRE OPEN SUNDAY EXPERT RACQUET 3- STRINGING 82 871 MILES AVENUE Dow NTOWN INDIO GMI T M SIIODIIIIIU Bl MIJIIH BBIH B1 743 AVENUE 46 INDIO GALIFURNIA nlvun asm 7,ffKZf'f ' 45 TELL A Fmfnnl Olffifilidsizia ' 0 u ' ' I - I I Y ' ' ' I . I I O O C l - 0 Q I c o o ' I I - O O l 3 o A ' 4? Il ru un ay IW : u.m. o : .m. F ' af o r o r u 1 mm. vo 8 p.m. U0 u.m. fa 5 p.m. iw .J - Y Y - I ,J 3?-:TmI , I tx r' wt I I l lt r I I IEwIst7Il' I' I Q I A Mt f ' X 'l tt. I A tll' 1 I JI illllll WJ ff ly lx Nffl, ' In A gr 1 an if V ' 'VIA ' IWW' Il?7I4 'IwI Ii 212 ' r , t it will el' 1 . ax III' .W I I ,. 1 I IITTITIII 'I 5 f ' EVX II . li t if I it I , I ' I N I I I t. I I I ,V A ' it I , i A I ' it ll Ii U .- YQ G . I . . . , , I I - I All class rings are not created equal. Come by and see us, your local High School Ring Head- quarters, and let us show you what we have to offer. And heres an OFFER that is hard to pass up. Bring this ad in with you and receive a discount on your Valadiumg class ring purchase and get all the extra features at No Charge. So, before you spend any money for a class ring-See the Worlds Finest by R, Iohns l.td. at IVAN MUN SON JEWELERS 82-723 Miles Avenue Indio, California 92210 YOUR P PER CHASE FINALLY P ID OFF! N6 Q' 9 F X? Qt Ye C0 GR TUL TIONS' DelTQCQ f IILPHH BETH SONNY HUNT 967 IIIIIIO SUZUKI 83-500 HWY 111 INDIO CA 92201 I714I 347 6823 JOHN McMANUS Congratulatlons to the Class of 1981 104 dam 51 91. duowem da! 92241 114 392 4614 Db B :JI4 Ewing, Opfome-an ARNE C BELSBY JDJDBA ENTERPRISES INC 17141 746 6670 250 4 S Ora ge Street Escond do CA 92025 Chuckwalla Market Art and Vnrglma Vanderhoef 27625 Race Road Deh Beer Wme Crocerxes Gas 81 O11 Desert Center Cahforma Phone 227 3409 QIZ,- 5 LIZCHAVEZ fx aww' 'Y 0 '09 1 3347-6344 I714I 392 4-660 7lf:Z!tap afatamatwe AMERICAN IMPORT PARTS Sn ACCESSORIES Louxs Froehlmg 48 Park Drlve Lmda P O Box 571 E M CA 9224-1 CW WILLIE TRUITT SOUTHWEST ENERGY COMPANY SUPEPINTENDENT OF OPERATIONS P O BOX 481 EAGLE MOUNTAIN CA 92241 TELEPHONE 392 4623 .X MANAGER . 51-0113 8210 A I - . . .-, . c ' . I 41 92 . - President fa ' , . . - 3 I fa. . . I - . n I . '3 - - I 'N ,fl Qw- 1 O9 . -K: Q .. f if - Oqeo. . . . MHUBQBL 0 0 0 5 0156614 Indio Fnsrmn Mau - O 'I 714 M am B 0 asmau ' ' S C ge ' M P 4 . , II ll . ., JUSBDUL cl'l1I'l8C0 IHC ANTIQUES Established 1933 ART CHIRIACO SUMMIT CALIFORNIA 92201 U7 CURIOsl1'lEs J ROBERT sos CHIRIACO dtae W V! f X A 'UQI ' v wh snowy ow, Vx ,V 6 my 1 Wim! We 4 f J zfsfeelcf ffl Q03 gem 1 Riff ffjf UH A Q Y- 'I 'K i V 4 , ., I - 1 - - 1' l , x ' - , .14 , , . I, k d i N 5 A vt P ' G -IM g sf 'jwvw ff 5-xt Q 5,15 ', I n ,Ig is ,inf 1 1 !' , 15 N aw' f w w, 'V 'L S' 'QQW A F ' , XID? I ,N xx , I N x if 'Y Y Qs 1 I . ' h ' I, I I1 ' vt 1 1 Q 1 N 1 - P I .3 0 f .UAE WK I! 'A' .Ly yi X ' XY X I ' X , xy X N , ,f -mf f Q K A NWMZQ is if ww f f -+ ' X , X W I w ' ' Y k ! J .-Af' ffm! ' ,f f f X W V , NJ ,E 1 Zff- V! We- 'K Wu.: . . . . e cannof efoneaame UJAEIE 'A euewtging i wifzf and Beau if-ufan 511.15 an e wi . o n aim n I Q e snowy owfi a'Le one offge few 4fzeciesflqa.fmalefo1fife . . . Custom Ad Page l Uffafl-5' A KW? K' a vm' f fiff f Lunch hour vusltors Margle Merrrtt Donna Owens Cleve Gray and Diana Vidal take a few mo ents to pose for a Talon photographer fffcqfy, 5 ff fgfffxy 419,195 yfaf an auf ffkife' W76764' ff QW fEj2C'5fQZlfpp'6 5 fT ank you for supportz gyour 7445 6547 fzffj Jc1x77f77 ff' 6106! 6 do cf Ea le Mountazn Hzgh School Qfff 07 YL C jfffdfg, 4,2140 aff, ypff fsffA,f,,7LLbrary pci, 4 jaage LA mf K f 1,506 fl 752447 Compliment of M Cf Mr and Mrs Jayl Llppmannlxj ' I I ' Y Y I I . fl fl ' ,U 4 ', A 7, 4 , I r l 1 Q2 r 1' - I ' . o' ' , f- ' , '5- X f ' - If' f . I A' Q ' f f a 71 , , A 7 ' ' ' .--I . -fa : 2 ,Y t ffl . . I ' . , , Q . ' I , V .1 , Of ,. X V, yjwg c,'1 Z if x Q X' V A ,f q ,A I . JJ. L ' -- .J ' -4 5, ' - 'L 1 ' . e 7 r? f f f 1 'Y ,A 'l 'XIX' A f,4 ,- l ,M XC' q 0 I 4 l xx, Pj, N fVW,1,,,,,,-,,,,.. ,... d!!! f Yfdh ., 'z ff CDNGRATULATIONS' From The men and Women dr Keuser Steel KCUSER ETEE1. EAGLE MOUNTAIN MINE ' . I I' 1 af , 6 L I1 t' ' so 1, C9 f' ,,- u tt A' ' U r V I' ' ,il I K i U I HD ai, , sr Ja 212111 Dari CQAFE HL WF? Y5 BANK OF AMERICA LNT 81 SA S tEglM t ZALES The Dlamond Store PHONE 714!34-7 065 INDIO FASHION MAIL 82 227 HWY 111 INDIO CA 92210 'N 4 C G' A L A W1 I , I ds A Ap Congratulations From the taffa a e ounain indian palms country club 48 - 630 monree, indio, tel. 347-2326 fwhere Eisenhower wrote his memoirsl Open tothe Public CHAMPIONSHIP GOLF COURSE 27 HOLES Membership or Daily Green Fees For Golf Starting Time 327-2326 BEAUTIFUL CLUBHOUSE OPEN DAILY Buffet Luncheon 11:30-2:30 INDIAN PALMS RAQUET CLUB 9 Championship Courts 5 Nightlighted Memberships or Hourly Court Rates For Court Reservations: 347-4054 FAIRWAY COTTAGE 81 CONDO SALES 81 RENTALS Available by Day Week or Month 347 4373 , ii'f neg W ng 1, Mark RESTAURANTS 81-923 Highway 111 D O. Box 1? O, lrvctio, CA 92202 ol-lanes lloypsz Of ,347-7900 81-923 Hight iv 111 P. O. Box 1240, lrl , CA 92202 347 7900 'Daz 5 AIG!! WLC Ei 6415 C7141 fb I y Have You Had Your Dar San Today ? O E ALLAN DANIEL 922 7266 Indio Christian Store Bibles Book Gifts Records Tapes Sunday School Supplies 82 719 Miles Avenue 347 0195 Albensons DENNIS HASKILL Sto e D reclo 17141877 5900 DESERT STEEL 81 INDUSTRIAL SUPPLY CO INC l Siiatcoa pfoffgg Off- V .L an J ' ll ll 44 e Zum ' 1 1 l ' , wx 97 - ' I ., . r I r TED QQRQULX 451 W X M.l.if1X BIND vuisliii-.rx'l HlAl.'I'O. LIA 92376 BLUE LINE TRUCKS ALWAYS DELIVER We Don t Dock It We Deliver It ...ik DUE E 1 Z JZ! OV O O K A RALPH ADAMS , . ,lj Q A - - e ,k g T ug 4 4 J X J X Q P K 'D' ' 1 g X gf A F , HUPPER EAGLE MGUNTAIN SI-ICDPPERS MART CONCRATU LATES TI-IE SENIORS OF '81 LQ ? K W x v? GTE GEITERAL TELEPI-IUFIE . al- I 'Z 'IIIII Security Pacific Natrona! Bank 100 West Hobsonway Blythe Calnforma A FULL SERVICE BANK FOR ALL YOUR BANKING NEEDS fuwuwetgm VILLAGE LAUNDRY EAGLE MOUNTAIN SPEED QUEEN WASHERS 81 DRYERS SHOPPING CENTER COURT STREET AMERICAN PACIFIC COMPANY EAGLE MOUNTAIN OFFERING YOU THE FINEST TV 81 PAY TV WITH HOME BOX OFFICE HBO PEOPLE DON ,T MISS OUT 15 COURT STREET ,F T .:.l.l.l.1.l.l.:.'.'.' I . '.'.:l:ff-' ' ' ' ' '.'. ' . ' R ' 'il' ' ' L :':-:-:-' , ft .-.-:-:-:-:-: A I I :jfjj - - V V , Ag, '.:.:.:.:1 7 3:1:3:5:3:35t ff i , ' '.:.:.j, sv 5:3:5:3:3:5:1:i:?:5. 5:5514 :Ijf:I:f:f:f:f:f:I . I.-212:23 2 ' t-:-:-:-:-:-:-:-:-:-:-.- -:-:-:-:+ T:-:323:3:3:i:1:3:3:i:3:3:3:3. A -:-2-:-:-2-1 ? .DW I , I .1 .-132:23 '15 su: . .-.+:-:-:-:-t fi!! Z.. 0 - jill :.:.:.:.:.:.:.:.:t T. -....... An Equat Opportumty Employer Ill' ' -32 '.'.'.'.'.'.'i .2222-C. A5335531iIIIIifiIIIII...I.' - ----2::gg:5::::::::::::::::::::: - 'v l--'u ni. :::.5jf r- Fir .. I NE, UNITED CALIFORNIA BANK I49 EAST I-IOBSON WAY TELEPHONE 922 4I3I FEATURING EXTENDED BANKING HOURS 4I'I yS W B 4H I GBEARI G INC W3 i W Q dnstrnbutor' Your Communify Orienfed Bank. 2 ours a Da , even Days a eek. Member FDIC Kim Venn and Bonnie Asfon D I I UC 2 T II . o 0 0 0 9 o B22 Open Tuesday to Saturday, Wednesday and Thursday Evening LOOKING GLASS HAIR FASHIONS Expert Styling and Permanent Waving. Featuring La Maur Skin Care Products. Men and Women Hair Styling. LINDA KIYABU Owner-Operator 714-392-4511 EAGLE MOUNTAIN BOWLING LANES Gongratulz-1t1ons to the Class of 81 DR S WARREN GAMEL 92201 347 CONGRATULATIONS TO CLASS OF 87 FROM TOM MORRING DESERTGOLD REALTY 714-327-3240 Desert Center CA 92239 CONGRATULATIONS TO THE GLASS OF 81 FROM Clyde P Crame D D S. M S an IohnT Iacob D D S M S JIM KIMMITT Regional Sales Director TXYLOR PLIBLISIIINC COMPANH 5 RED ROCK IRVINE, CALIFORNIA 92714 1714i 551-5617 if I I 9 . . , . . . . . , . . . . . G P c 1. . . GPTOMETRIBT HO 1 1 ' S O l C P 3 1981 Eagle Mountain Talon BREAKING DOWN THEMI:-MORY olume 17 of the Eagle Mountain High School Talon Eagle Mountain California 92241 was published by the students of Eagle Mountain High School. Following the final deadline on March 2nd Talon was printed by Taylor Publishing Company of Dallas Texas. The first 16 pages of the yearbook were printed on 100 weight enamel paper. The remaining 128 pages were printed on 80 pound enamel paper. Italic Body type is Times Roman and was set in 10 point Cutlines were printed in Times Roman 8 point. Senior credits and index were set in 6 point Times Roman The cover was designed by Lee Samuels. Silk screen and embossing techniques were used to apply color and design to grain and raised surfaces. The mountain diagram year and spine design were embossed. All photographs were shot with Canon AE-1 Argus STL 1000 and Minolta XG-7 single lens reflex or twin lens Yashica Mat 124 G cameras. Color photographs were processed and printed equally by Johnson Photography of Indio and Executive Portraits of Ana- heim. All black and white photographs Cnot counting studio shotsj were taken printed and developed by yearbook staff photographers The total cost of the 1981 Talon was in excess of six thousand dollars. Individual copies cost fifteen dollars. Taylor Publishing Company printed two hundred copies of Talon. I 9 Thirty point Palatino was used to set headlines. Kickers were set in 18 point Optima 3 3 Assisting With Memories TALON STAFF WOULD LIKE TO THANK ithout the cooperation and friendly help of many people production of the 1981 Talon would have been severly impaired Their willingness to bail us out of tight spots during the year helped enormously to make the book a reality We would like to thank Jim and Mary Kimmitt of Taylor Publishing Company for all their help and encour agement Executive Portraits of Anaheim California fThe Zuk Familyj Johnson Photography of Indio California CB1ll J ohnsonj Sundance Studios of Indio California Visual Sports Network of Oceanside California fB1l1 Gigantej Our Advertisers for their financial support The Press Enterprise and County Editor Bob Marshall for supply and A P and U P I wirephotos used on pages 142 and 143 The ever willing and cooperative faculty for tolerating interruptions from staff photog raphers and reporters Steve Weitz for assisting with volleyball pictures at Serrano High School Wayne Copeland for providing photographs of the mine Anne Karns for assisting with proofing copy The students of Eagle Mountain High School for allowing us to publish this book o o o I VV , . . . . . 6, . ,, . ' . . . . . . - . . . . . . . . S , ' . . . . . , . . . . . . , . . . . . . . . , . O . . . . . ' . l n c 1 n . - . . . . . . - . - . . . . . . . . . . . . . . l A Abrille, Baldwin 1103 p. 72, 75,88 Abrille, Raul 11138. 72, 74, 75, 79, 82 Adams, Judie p. 1 7 A lbertsons of Blythe p. 133 Alladin's Florislp. 122 , A lltson's Lumberp. 116 Al'r Family Shoe Storep. 116 A1oha Beta of India p. 126 American Pacmc Corporation ofEng1e Mountain . 136 Anderson,Cgo1leen193p, 18, 22, 95, 96 Anderson, Jim 1113p. 18, 34, 35, 38, 82 Arrellano, Patty11 13p. 82 Arrow Printing Company p. 116 Amocllted Student Body p. 20, 11, 61 Aston, Bonnie 1103 p, 24, 88, 114 B Baird. Kevin 1103p, 88 Baker, Danielle 193 p. 95, 96 Ballantine, Desiree 1938p. 26, 30, 75, 94, 95 Ballard, Jerry 1123 p. 1 , 50 B::ard, D13 gba 18, 61, 70, 75, 76, 88 5 P- 21. . 1 Bank of America of Eagle Mountain p. 132 Bank oflndio p. 122 Barnes, Nathan 193 p. 22, 95 Barrackman, Marsha 193 p. 22, 95 Baaehtlg-pl. 61 laake . Boys' JV p. 75 Basketball. Boys' V xp. 69, 75 I ' p. PM 231 'aifaf' 'S Benton It Paint Incorporated p. 116 Bertola. Michael p. 105 Bette? Old Fashioned Ice Cream p. 116 Bible Book Slorep. 133 Big A Auto Partsp. 120 Blue Line Trucking, Rabll Adams p. 134 Bob Williams Menir Wearp. 126 Bollman, Keith 11 13 82 Bon Tempo. Michae p. 7I,75, 108 Brake, Ro er1l13p. 18. 19.75, 88 Brandon, Red 1103 p. 88 Brandon, Robert1113 . 82 Brenneise, Chester p. 276, 108 Dr. E,M,Brudneyp,128 Brown, Richard p. 108 Dr. B. M. Drudneyp. 128 Bryant. Matt11 13p. 22. 82 Burdick, Elisa 11 13 p. 18, 22, 34, 35.40, 82, 86 Burdick, LeRoy p. 109 Butler. Gerald 11 13p. 82. 102 C Cannata, Gina 1103 p. 26, 28, 37, 88 Cantral, Gary 1103 p. 88, 140 Cantu, Saul 193 p. 94, 95 C aranaugll E leetric p. 116 Capf. David 11 13 p. 18, 82 Car 's Junior Restaurant ?Bgtthep. 120 Carlson, Roben.a193p.Z , 2 , 37, 94, 95 Carr, Terry p. 105 Carrow, Mark p. 65, 75 Carson. Sandra 11 13 .35, 67, 75,79 Casillas, Manuel p. Z7 casiuas, Patty1113p311, ta, 40, 42, ez, sz, ss Cheedeade , X n . 14 Chipp, John 153 p. 22 C hiriaco Summit p 129 Choi' p. 26, 27 C ltuckwalla Market . 125 Cieslar, Eva 193 p. 1522, 36, 95 Cieslar, Krystyna p. 107 L Gary Cantral, along with other hood Ciroir Restaurant p. 34, 116 Clotllesline Gowns d Bridal Shoppe p, 122 Clyde P. Craine D.D.S. M.S. ondlohn If Jacob D.D.S.M.S.p.138 Coachella Valley Glass Company p. 116 Coca Colo Bottling Company ofB1vthep. II5 Cole. Kay 193 p. 26. 95, 141 Cole, Kenny 1103 p. 88 Colwell, Earnie1123g:. 18, 22, 30, 47, 76 Cook, Mark 193 p. 9 Copeland, Cheryl11 13p. 18, 65, 75, 81, 82 C orwin, Welding p. 120 Crane, John 193 p. 22, 79, 94, 95 John Crane Insurance p. 120 Crane, Walter1l 13 p. 78, 82 Cushing, Bridgette 193 p. 97 Cusick 's Bbtthe Chevron Station p. 124 D Dar San Sandwich Company p. 133 Deans Mtuic Cityp. 117 De Annan, Tomrny1123 p. 1, 21, 22, 40, 47, 60, 144 De Lao. Pete1113p. 18, 42, 82, 84. 98 De Lao, Phil 1103 p. 18, 62. 75, 77, 88, 90 De la Rosa, George 1123 p. 18, 47, 75 Del Taco Restaurant aflndio p. 127 Desert Center Cajep, 132 Desert Gold Realty p. 138 Desert Steel and Industrial Company p. 133 Dingo. Cheryl 193 p. 97 Diago, C1emente11 1351. 82 Dostal, Laura1123 p. 1. 26, 35, 60, 98 Drama p. 28, 29 Drlll Team p. 30,31,T1 Duncan, Kelly 11 13 p. 83 E E-Z Martp.124 Eagle Mountaln Acdvltles Dlvislon Page p. 19 Eagle Mountain Bowling Lanes p. 135 Eagle Mountain Pharrnaty p. 125 Eagle Mountain Shoppers Mart p. 135 Earle lr Jewelry p. 120 Eisenhower, Beth p. 34 Englund, John p. 105 Enriquez. Alice 1103 p. 22, 75, 88 Enriquez,Richard1123 . 18. 56, 75 Epperson. Sue 1103 p. 221 26. 27, 88 Escobedo, David 11 13 p. 81, 83 Escobedo, Mo1ly1123 48 Evans. Lee 1 103 p. 75. 9 Evans. Mark 1938. 22. 75. 97 Evans, Nancy 11 3p. 89 Evans, Suzy p. 109 Evans. Teena 11 13 p. 83 Evans, William 1103 p. 28, 32, 89 F Faculty Dlvlslon Page . 103 Fahey, Donna 1103 p. 30, 89, 91, 101 Fahey, Tammy 1123 p. 20, 21, 26, 27, 30, 32, 37, ralo' 49 wrap? 1 Sports . 18 Fermon, Ben p. 7 P Fermon, Erben 193 p. 18, 22, 75, 97 Fremon, Shelby 11 13 p. 18, 22, 41, 75, 83 Fitz Henry Funeral Hornep. 117 Football. Junlor Varsity 16, 17 Football, Varslty 14, lg. Foster, Patricia1 3p. 13, 18, 67, 75,94, 95 Four-H Q32 Franks, enneth p. 102 Future Homemaker! of America p. 33 s dressed up as a '30's style gangster during Spirit Week. Y KPSI disc jockeys staged an impromptu Homecoming Dance contest. Several couples, including Tom Knight and Kim Vann, were judged fit enough forthe grand prize . . . logoed T-shirts. 140 G Gaines Calvin 193 p. 18, 75, 97 Gals and Guys Hair Styling Salon p. 11 7 Garcia, Lalo 1103 p. 18, 76, 89, 90, 93 Garcia, l.eonard1123 p. 49, 75 Garside, Greg 1103 p. 61, 89 Garvin, Tina 193 p. 30, 31, 96, 97 Gam, Vicky 1103 67, 75, 88 Gausvik, Curtis 11 3 p. 78, 93 Gausvlk Rocks 'Valentine' Gym-Wlnter Sports - Valentines Dance p. 79 Glen. Lori 1l037p. 29, 75 Glen, Mark p, 5 Golf p. 61 Gonzales, Regina 1103 p. 30, 89 Goodvear Tire Centers p. 122 Gnmtatea Senior Dlvlsion Page p. 42 Gmgigmafeorgene 1113 p. 26,30, 40, 80, 83, GrBt6CIeve 1123 p, 18, 44, 49, 52, 60, 75, 100, Green, Eric1103 p. 18, 22,90 Green, Larry 193 p. 18, 22, 75,97 Grover-Casillas, Glenda .62, 108, 110 Guerra, Raymond 193 p. 9:7 Gullin Tiresp. 120 Gutierrez, Blanca 1123 p. 22, 24, 25, 50 U1.1llC1'l'Cl. Carlotta 1103 p. 39, 65, 75, 90 Gutierrez. E1rain193p. 18, 72, 75, 89 Hamm, Roben1113p. 83 Hayward Lurnberp. 120 Heath, Edith p.110 Hempllilllt Shoesp. 121 Hilltop Auto Parts p. 128 Homecoming Court p. 45 gomecomlng Euan 11.3 0099919158 1 P- Hopkins, Greg 193p. 22,97 Hom, Katrina 193 p. 22, 94,97 Hosdllty, Relief, Rea11ty:'N and '81 Develop Shared Memories - World News p. 142 A. C. Houston Lumber Campanyp. 117 Hudson, Keith 1103 p. 18, 88, 90 I Imperial Hardware p. 11 7 1mperialMolarsp. 11 7 Indian Palms Country Clubp. 133 Indio Catalog Sales Agency p, 117 Indio Florislp. 123 Indio Pye and Supply, lncarporatedp. 11 7 Indio S oe Storep,118 Indio Suzukip.128 Ivan Munson Jewelersp, 127 J Jamison, Kristine 11 13 p. 7, 18, 86 J.C. Penney C arnpany, lncorporatedp, 121 Jenkins, Patty 1103 p, 28, 33, 90, 106 Jennings Hardware and Supply Companyp. 118 Jesse, Charlotte p, 105 Jesse, Mike1123 p. 34, 35, 50 Jiang Quing p. 142 Jim all Mazdap. 118 Johnson Photo p. 118 Jzyobas p. 128 K Kain, Leota p. 107 Kam. Ross 1123 p. 18. 22. 50.69. 75.79 any Mme p. a, 9 Kaiser Minep. 131 Karnan Bearing and Sigopiy Corporation p. 118 Karns, Anne p. 34. 10 ,110 Kawalkowski. Cary1l03 p. 18 Kidlt Kloselp. 120 Kin Bearirigp. 137 Kirgy, Karen p. 106 Kivisto, Cindy 1123 p. 26, 50 Kivisto, Janice 1123 35, 50, 144 Kivisto-Taylor. Kar a p. 107 Knight. cyndaeqizyp. 1.20. 21. 22.23. 34.40, 41. 44, 45, 48. 50, 55, 58, 75. 76. 79. 114 Knbght, Tom 193 p. 18. 22. 97, 140 Fre Koehler and Sonsp. 118 L Lawson. Dana 1113 p.37. 83 Lee. Gary p. 143 Lennon. John p. 142 Lewis, David 11 13 p. 38. 83. 87 Lewis, Laura 193 p. 18.66, 67, 75, 97 Lewis, Sheryl 193 p. 22. 98 Lipprnann, Suep. 111.130 Loca Shirls p. 128 Looking Glassp. 138 Lopez, Jaime 193 . 18.22. 72, 75. 98 Lopez, Virginia193 p. 22. 75.98 Luisi. Deb ie 192 p. 75, 98. 99 Luisi, Denise 11 3p. 52. 53 M McNamara. Kathy p. 75. 111 Major. Matt 1103 18. 75.90. 93 Manley. Betty p. 07 Masso1ti.Pattip. 111 Mat.hes, Jerfv 11 ll p. 35. 83 Mattice, Coni 112353. 29. 30. 31. 44. 45, 63, 144 Maurer: Ciry p. 12 McBride. Scott11 13p. 6. 18, 40, 83, 87 McCormick. Debbie 1103 p. 26. 62. 90 McDar1ald's Re.r1aurar1lofB1y1hep. 125 McDowell. Rylie p. 72. 75, 111 McGill. David 193 p. 98 Mcliissic. Chris 193 p. 22. 75. 98 McKissiC. Denny 11 Hg. 38. 75.83. 144 Meler. Jennl1er1l 13 p. 1. 22. 28, 35. 83. 84. 87 Meler, Jose h .105 Meler, Miciiael,1123 p. Z2, 28, 29.35, 37, 53, 55, 76 Meler, Sharon p. 75 Mendez, Martha 193 p. 48. 67.75. 98 Merchants and Farmers Slate Bank afB1y1hep. 121 Mmm. Margie 1123 p. 47. ss, 130 Mills, Trent 193 p. 98 Money Matter! - Adverttlng Dlvloaa Page p. 114 Moody. Russ 11139p. 18, 75,83 Morales, Robert1 3p. 18. 70. 75. 98 Morgan, Jaye 11 1369. 83 Morolex. David 11 3p. 74, 75 Munson. Lynne 1113 p. 28. 83. 84. 87 N National Date Festival p. 63, 76, 77 National Honor Sodely p. 34. 35 Nick Naylorp. 118 Nees, Michael 193 p. 75. 96. 98 New Orleans Sugerdomgg. 142 Nunez, Gracie 1 3p. 28. . 31, 98 O Olson. Beverly 193 p. 26. 30. 75.98, 103 , e ie p. . Sim' 81215 H2155 melon gtiiiilger, iohn l81b7g.l7ib7l9. 90 rson. ance p. . . Ouns, Donna1103 P. 37. 90, 91.130 Owens, Michael 1103 p. 21. 90. 91 O'Yates. Glenda 193 p. 30. 98 o'YlltS, Patty 1123 p. 54 Palomares, Agatha 11 13 p. 18, 21, 27, 34, 35, 84, 85 Palo Verde Equipment p. 121 Patrick. Lorena 1103 p. 30, 31, 77. 90, 91 Patty, Martha 1123 p. 49. 54 Payne, Janice 1123 p. 1, 26, 35, 40, 55, 114 Peo 11' Scmlldp. 36, 37,141 Peoples, Lin a193 p. 30. 75, 94. 98 Peterson. Gaye p. 107 Peterson, Timothy 1123 p. 18. 25. 44. 55. 60 Pelerson Electric p. 121 I Pickering, Christ1ne193p, 18, 37, 75,98 Pizza Hur Resrauranr p. 119 Professions p. 38 R Ragsdale. Carla 1103 p. 22, 90. 98 Ragsdale, Darla 1103 p. 22. 89. 92 Ramsey, Jim p. 112 Reagan. Ronald p. 143 Ree .Andre 193 p. 18, 75, 94, 99 Reeves, Bob p. 110 Reeves. Bobbie 1l235p. 18. 20. 21. 22, 23. 34. 35 44. 45. 46. 48. 52. 3. 55.60. 63. 65. 75. 79 Seexsfangi 11 2 p. 22. 24. 25. 73685. 86 eg ecupa on Program . Reynolds. Phil 1103 p. 22, 28, 29 Reynolds, Tim 193dp. 22, 39, 75,99 Richardson. Davi 1123 . 18, 56 Richardson, Melinda 1183 p. 30, 92 Richardson, Michelle 193 30, 92 Robertson. Shelly 193 p. 7 . 80. 99 Robles, Rene 1103 p, 22, 90, 94 ROSC. Bobbie1113p.11,18, 22, 85, 86 Rose. Evap. 106.112 S Samuels. Lee . 109. 112 Sanchez, Fret1J1l03 p. 18, 44, 75, 78, 80, 90, 92 Sanchez. Pablo1l 13p. 40, 41, '19, si, 84, ss Sarah 5' Hair Styles and Cosmetic: p. 121 Sauceda.Diana1123 .56 Saueeda, Joey 193 p. 59 Sauceda. Patsy 193 p. 99 Savon Carpets p. 119 Saxton, Janene 193 p. 99 Sc.3nl?g,g1g3nda1113p.l1,l8, 21, 35, 40. 79, 4. . Security Pa1:Ui1: Bank ofB1y1hep. 136 Senecal. John p. 104 f'.:'1f:f111afS1m- 9. par s ewe ry, ncarporare . Shggwood, Emily 11l3p. ll, 18135, 40, 65, 75, Shirr1'.1' Boulique and lrnporisp. 119 Shives. Steve 193 p. 99 Shorter. Robert 1103 p. 92 Shumway, Rand p. 104, 110 Smith, Bryan 193 p. 18, 22. 75,99 Smith, Charles 11 13p. 21, 28, 29, 33, 37, 62, 85 Soto. Johnny 1103 p. 92 Soulhwesz Enew Corrqpany p. 128 Sparkman, C. .p.6l,l04,110. 112,113 Sparltman. Phyllis . 106, 113 Spencer. Darrell 1123 p. 56 Splrlt Week p. 41, 140,141 Spring Story - Dlvlslon Page p. 61 Stanga. Andy 11 13 p. 18, 85 Stokes. Christopher1103 p. 18, 75, 92 Sundance Studio . 123 P S unri.1e C hevroler - Oldsmobile lncorporaled p. 1 19 Sutton, 'l'11eresa 1 103 p. 22. 65.75. 92 T Table of Contents - Fall Preview p. l Taco Mark p. 133 'rum p 411, 41, 139 Taylor, Mike 1103 p. 18 Taylor Yearbook p. 136 Timonen, Brian1l23 p. 15, 18, 52, 57, 69, 75 Tisdel. Frank 1113 p. 18, 42, 79, 85 Titdel, Mary 193p. 75.94, 98. 99 Todman, John, Magician p,61 Tomlinson. Erie 1103 p. 18, 22,92 rap shapp. 125 Towne Barber Shop d Mis: Ar1n's Coajfure p. 119 Turk, Sonja p. 77 U Uaderel 82,B, and 84 Uodemlaaa Dlvlslon Page p. U Underwood, Alane1113 p. 83. 85 Underwood, AudralS93 p. 75.94. 99 Underwood. Glend e1l23g:1. 31, 57 Underwood. Kathy 1103 p. 8. 92 Underwood, Shanna 19319. 95. 99 Ur1i1edA rrixrs Beaury C lege p. 1 19 Uniled CalU'nrr1m Bank ofB1y1hep. 125 United CaIU'orr1ia Bank of Indio p. 125 V Valley Bakery p. 119 Valley Laundry 4 Cleaners p. 121 Vann, Kim 11 13 p. 22, 40, 85,89, 114, 140 Vasquez, Becky1l03p 18, 66, 67, 75, 79, 93 Vidal. Diana 1123 p. 2, 57, 130 Village Laundry p. 136 Volleyball, Junior Vanity p. 12, 13 Volleyball. Varsity p. 10. 11 W Wallace. Carolyn 1123 p. 26, 27, 28, 30, 44, 45, 46. 58 Wallace, Janet 11 13 p. 26, 27, 30, 77, 85 Weitz, Steve p. 112 West. Alana 1123 p. 58 West, A1ansl13 . 18, 28, 69. 75, 85 Wick. Davi 1123p. 58, 101 Dr. Ray Wilkin. Dentist . 115 Williams. Jessica 193 p. 22, Z3 Williams. Tom 1123 p. 59 Wodetzki. Brian 193 99 Wodetzki. Charles 1 13 . 75 Wrestllag p. 72, 74, 75, '17 Wrigh1'.r Appliance and Furnimre p. 121 Wright, Kevin 193 p. 99 Y Yamaha of Indio p. 124 Yates. David 1103 p. 93 Yates. Jeff 11236. 21, 34, 35, 53, 59 Yatei.Vicky1l 3p. 12, 18, 93 Yellowrnarl p. 126 ' Zales Jewelers p. 132 A Pen and Scro11's Kay Cole sells Homecoming souvenir programs prior to the Friday night Serrano football game and halftime festivities. A After the Eagle's Homecoming game conquest, varsity squads from both teams congratulate each other. The victory over Serrano improved EM's season to three wins and six losses. Hostility, Relief, Reality: '80 and '81 Develop Shared Memories OUTSIDE WORLD INVOL VES STUDENTS Being involved in our own E.M. world during strengthened Pfe3identCafte1',s plan class rings. Gas prices discour- to resume registration for the draft. ,aged many Who had cars ff9m tak' Fear of the draft, as well as the 1113 100 II1a11Y llllflecessafb' WPS find anticipation of first time voting in 111080 all 100 00111111011 late Ulgllt presidential elections, affected many dates- seniors, now old enough to qualify A for both. Inflation climbed to , the year often caused us to temporarily forget the outside world, but it played an important part in shaping our lives, too. The new year was also the dawn of a new erag almost at the very hour an old ordeal ended - Amid pomp and pageantry, Ronald Reagan became the nation's fortieth President, displacing incumbent Jimmy Carter . Upstaging his inaugu- an even higher peak, s 1 ration was the long awaited release of the fifty-two American hostages held by Iran's Ayatolla Kho- meni's regime. Within a mere forty-one minutes, a 1 Presidency began and the 444 day ordeal ended causing gold and gas- oline prices to sky- rocket. As a result, , , , many students were with a nation swept by a sense of shared emotion, p unable to buy their exuberance, and relief. By openly demonstrat- 2 ing their hos- f tility in taking hostages, Iran showed Americans they were not prepared to handle an emergency situation and International turmoil pulled our community closer to the reality of world affairs. Polish unions played Russian roulette as defiant Lenin ship ard employees, in the part city of Gdlansk, rose up . . . in a - - spectacle Marx might not have believed. Their protests, over issues we take foillliranted, included the right to st ' e, establishing trade unions, raising monthly salary to S67 a month, and ending food short- a es Demands for these issues' S - t shook the regime of Edward Gierek, who was eventually displaced, and caused concern among NATO Nations over an impending Soviet intervention. Iraq attacked Iran, and the night- mare of war in the Persian Gulf became a reality. As refineries burned, the world considered the affect on oil supplies and, once again, the strategic interest of the superpowers. We were all waiting to see if they will execute her, echoed the grow- ing curiosity of Chinals millions about the outcome of the show-trial of Mao Tse-tung's widow, Jiang Qing, one of four evildoers known as China's Gang of Four. Crimes by the gang were allegedly committed during the Great Proletarian Cul- tural Revolution, between 1967 and 1976, in which 100 million Chinese were persecuted. New leaders, purged by Qing's quartet, desired to reduce the Gang of Four to absolute powerlessness by presenting nightly, edited clips of trial footage to their nation. Recent surveys showed that Americans sgend more time viewing television t an participating in any other form of leisure recreation. Sus- pense and sex have made shows such as Dallas, television's soap- opera drama, a big success. With a 300 million hardcore, Friday night, frantic audience, early season view- ers queried . . . Who shot J. R.?,' Prior to late season debut, caused by an entertainer's strike, no one was tellingg certainly not Larry Hagman, who was living it up as J. R. the man ou love to hate. Tragedy and violence all too often rocked the American scene. I read the news today, oh boy . . ., John Lennon, 1966. Happiness is a warm gun . . ., John Lennon, 1968. The Beatles orchestrated a gener- ation's highest hopes, and with John Lennon's tragic December assassi- nation at the age of forty, the dream faded. Moreover, Ameri- cans confronted and pondered the latest killings and handgun laws in a wave of violent crime. Bruce Springstein on Lennon's death . . . It's a hard world that asks you to live with a lot of things that are unlivable . . . Even though there were draw- backs to venturing into the outside world, E.M. students still found time to involve themselves in other activi- ties. These few active students took the first step into becoming involved in their immediate world. 4 ECSTASY - An emotional Gary Lee arrived to a big welcome at his home in Falls Church, Va. Lee, one of the 52 freed hostages was greeted by neighbors and friends. IAP LASERPHOTOJ Y The Reagan inaugural motorcade crept down Pennsylvania Avenue CUPIJ. 143 L Friendships formed for lifeg Georgene Graham and Coni Mattice have plenty of time to reflect on the year's events. Both students bus 150 minutes daily from and to Iron Mountain. Y Junior Denny McKissic takes advan- tage of free working time to complete an in-English class assignment. Y Senior English students research life styles including their daily fair. Tom De Arman and Janice Kivisto partake of culi- nary delicacies prepared by fellow-stu- dents, at the annual Medieval dinner. Keeping it Going MEMORIES FCRA LIFETIME Eeshman enter EMHS unaware that high school will teach them more than higher math, typing, or how to overhaul an engine. Some seniors may not fully realize how much they learn about themselves and others or where they got the confidence and self-awareness that can only come by experiencing high school life. Timid freshmen, wanting desper- ately to fit in with everybody else, develop into self-confident seniors doing their own thing and dressing their own way. The lessons they leam about love and friendship will remain with them throughout life, helping them to grow and assume responsibilities not yet realized. Arriving at EMHS with conflict- ing loyalties, students develop a sense of Eagle patriotism as they continuously, yet unconsciously, mature. Under the guidance of teachers, they begin to discover and evaluate personal values while learn- ing the worth of being a part of EMHS. Leaving behind the security of adolescence for the uncertainty of adulthood in a world of changes, members of the Class of 8l proudly join in the tradition of EMHS. Q M541 jf! 4 Q Af 91514 WM if 4 WX X IIA! Q3 df! if l , x . jj J iff fiffff fj fy jf Mdfdffff vi ff A A, ,f fjj X WU LJ 1 M K Lk? Q K X JGXJQEY?-1 J x My , X M MO YF? LW 5323! fffifi 1 PWXA Wigjl S OM 3 by JJ if x'.L 05X t Rm.4lfT ' vxpvjs 'QV glxpvg Him Pjdcxgj Oy . y X! 1 'lx mmm J-J , J W Q fbfivlw pf MV ff, 3qU 'H my AQ, ,PHMMN I Ay. L ki Qfffx v , l AMFNJ N J Q N J I rxljlxf IV WW ,,1c,Q7Nf- ' A,J,1'fVxJ A05 9' QNX XJLU4 ,XV M210 fy Ujxpjf aj ,C+ V Qgq iwy K Q my 7 .JRQJTXJXQJ ug QQ, 4? MU ,-jj gy? 0 AMA j M ffAp5?Nw0EfOUUx ,fgwflay-All X, z K Y W 5 F JL Q? Q J 2,5 if Qyiff Eg Um , 1 ,.,:., 4. Y .. km ,,, . P- 3.ia4-x:,.aEfI.. aaa' 'R - -V 4 - Jim fum aw 1 27,6 ,41,W6eZle.dL 0 ' Q 7 fcfww, QM! ,0f41j!f,,f .X J ' ' J 64v047'laag'k' 671 667201 661442 wwf ' J 3. .zzhc X amd? JZ 5,7091 QQWCA, E! X x ' - 05421 1 MC 'xx 13 'A 'fa GLX 113 xx W 'X O 5 f 'N Q., 1 27 .X X, , , 7 , x .N-V iff X52 'Xi , fa Q 1 QQ, -mu HL, Lai . A f4 , x N .V , 1, . 1 M-W,,,. 41X C4 ,7 fix QJX'-F 1 Q7 . 1 Ki X- 4 in 1 , 1 ,, 5' N ' X X-,. ,- -L JEf,M-X yvjyyjy xl , K1 1-M1 .AX 'X x N Q ,, J . 3 ,Q cj, ' X C-1 fn Q3 ' . Q' ' J X fx K -1 xx rf: fl , Kx, l,, . N KH XJ UV! f 3 Qf 'X N4 'fy w- 'J , ' ,L K fd ff fx X X - 4, -K A. in WP 'fi -V6 xg-X 5 lx 4 ' X-, Q X: lx! NV QD LQ fffx X L1 . QQ 5 'XX ,, f I Dm - ,XV fi Jr, CJ r , -q ,,,,ff 1 J 1-fd MEX 'VH 4. ., C35 X , CJ 5 if xx Jw . , 35 N? YQ- f-Q IR, -43 -FQ, -. W -fx SX fr M5 Z gl, L ,V QD 2 J C- r ?f: 4 - X '-L 2, J? SM L , ,i ,Q if S P' m 11. w' nag 'mph : , , W- aw- , , , - - L 15 ,5 5..' V 't .'.,qs,1- .--- lf . ., .V I- V W: Viz.. A I .. .I I x I Q , vx K . Qk V Q 1 -- , 4, , J h 5 W F O lbx Q C L 'J 5 0 CIN fix rf 0 if W 1 I l I 1 96 sv. a 1 ' as S f M 4 H 1. 6. X ' , :R ' . W ' 1 44 A ' L f ,, Q ,N I V Q .1 ,MJ X A J, Q ' W 3 I C M MP 4 v f f S 0 Y My Mfaigi OQQ N N4559 Q VC xx Q Q NG A GC no JG 0 49 BQ AQ15 g GQ Xng A kb NQEQYRQ 1 XA 5 H 1.1.06


Suggestions in the Eagle Mountain High School - Talon Yearbook (Eagle Mountain, CA) collection:

Eagle Mountain High School - Talon Yearbook (Eagle Mountain, CA) online collection, 1980 Edition, Page 1

1980

Eagle Mountain High School - Talon Yearbook (Eagle Mountain, CA) online collection, 1981 Edition, Page 32

1981, pg 32

Eagle Mountain High School - Talon Yearbook (Eagle Mountain, CA) online collection, 1981 Edition, Page 120

1981, pg 120

Eagle Mountain High School - Talon Yearbook (Eagle Mountain, CA) online collection, 1981 Edition, Page 115

1981, pg 115

Eagle Mountain High School - Talon Yearbook (Eagle Mountain, CA) online collection, 1981 Edition, Page 33

1981, pg 33

Eagle Mountain High School - Talon Yearbook (Eagle Mountain, CA) online collection, 1981 Edition, Page 28

1981, pg 28


Searching for more yearbooks in California?
Try looking in the e-Yearbook.com online California yearbook catalog.



1985 Edition online 1970 Edition online 1972 Edition online 1965 Edition online 1983 Edition online 1983 Edition online
FIND FRIENDS AND CLASMATES GENEALOGY ARCHIVE REUNION PLANNING
Are you trying to find old school friends, old classmates, fellow servicemen or shipmates? Do you want to see past girlfriends or boyfriends? Relive homecoming, prom, graduation, and other moments on campus captured in yearbook pictures. Revisit your fraternity or sorority and see familiar places. See members of old school clubs and relive old times. Start your search today! Looking for old family members and relatives? Do you want to find pictures of parents or grandparents when they were in school? Want to find out what hairstyle was popular in the 1920s? E-Yearbook.com has a wealth of genealogy information spanning over a century for many schools with full text search. Use our online Genealogy Resource to uncover history quickly! Are you planning a reunion and need assistance? E-Yearbook.com can help you with scanning and providing access to yearbook images for promotional materials and activities. We can provide you with an electronic version of your yearbook that can assist you with reunion planning. E-Yearbook.com will also publish the yearbook images online for people to share and enjoy.