Davis High School - Olympian Yearbook (Modesto, CA)

 - Class of 1984

Page 1 of 246

 

Davis High School - Olympian Yearbook (Modesto, CA) online collection, 1984 Edition, Cover
Cover



Page 6, 1984 Edition, Davis High School - Olympian Yearbook (Modesto, CA) online collectionPage 7, 1984 Edition, Davis High School - Olympian Yearbook (Modesto, CA) online collection
Pages 6 - 7

Page 10, 1984 Edition, Davis High School - Olympian Yearbook (Modesto, CA) online collectionPage 11, 1984 Edition, Davis High School - Olympian Yearbook (Modesto, CA) online collection
Pages 10 - 11

Page 14, 1984 Edition, Davis High School - Olympian Yearbook (Modesto, CA) online collectionPage 15, 1984 Edition, Davis High School - Olympian Yearbook (Modesto, CA) online collection
Pages 14 - 15

Page 8, 1984 Edition, Davis High School - Olympian Yearbook (Modesto, CA) online collectionPage 9, 1984 Edition, Davis High School - Olympian Yearbook (Modesto, CA) online collection
Pages 8 - 9
Page 12, 1984 Edition, Davis High School - Olympian Yearbook (Modesto, CA) online collectionPage 13, 1984 Edition, Davis High School - Olympian Yearbook (Modesto, CA) online collection
Pages 12 - 13
Page 16, 1984 Edition, Davis High School - Olympian Yearbook (Modesto, CA) online collectionPage 17, 1984 Edition, Davis High School - Olympian Yearbook (Modesto, CA) online collection
Pages 16 - 17

Text from Pages 1 - 246 of the 1984 volume:

- 1... Qu- . 0 .--g 1 .f.., f. .J -.' 2 .1 gcszx x 'Aw r -V, .V 1Af,5.r v 1 3. rj.: ., ,A--, mf ,X J ,xi l , me in OLYMPIAN 1983-1984 GRACE M. DAVIS HIGH SCHOGL 1200 Rumble, Modesto, California Advisor Gertrude Hogue Editors Michelle Dilkian and Andrea Dixon w Volume 24 ANUFUIIQS fl3lUiIIl!D Clubs And Cbrgonizcfrions v SIDUIQWI WFIIASII-HES Sports WHHIE STIAIIQS Seniors s TIIHIE 'EAST Underclossmen lDlIIl2IE1UIfDilQSf IDIIQIDIDIUCIIEIIQS Fc:1cuITy And Academics A WIDIIQID IFIDIDM 'IDIUIID SIID1UNS'lDIl2 Ads MCDOD ldS DRIVE THRU Wfzlliimilliililliiwir'Wil''i'Ml'ii1'23lFiwmi.will Will'liiiiniflfliwrii' W' lli lilll l ' liwi'l WW' 'i'liii'i ' W ll'liirl i'l?rf Wi rWll ' 'lliiiwfr,rWn will- 7 li ,i ii 1,iw,wn iirwi iii iii' 'M wv ' www ii i ,i i rw imm iw agii iii WF ' ,in-.liai wsi iivw W i- iw' fum xq, ,, wry- ,y WW-- li fiilwiiiililll mi! iii lllirl . -,l 'W ll-lM'.r Wi lzi l .wif P- :will -l l W l 'illll irii,wi11aeiwiflfr1 , iii l ' 'iim:31nlif.+wf'l l lillliiiiln ri iiiiiiiimiWi,i,,',iii lllli, wiiM22::v.gi+illMi.'-f l is wwllllilflfl. iillw lfliilflliiiwiii., ll iilll iw -WW ' illlll lf ' l if f . . 5 F i u i Whal 'ro wear?! Whal To wear'?! This is lhe auesrion many high school slu- denls ask Themselves on any given morning before school. Fashion piays an imporlanl role in The life of a high school sludeni. People can be classlm fied inlo groups by whal They wear. Preppies dress in penny loafers and kilis, while Aggies usually wear jeans, cowboy boofs, and cowboy hols, New were The punk and new wave looks, The coming of high-Tops and cropped hair brouahl a new dimension To Davis fashion. ,vn- Popular Brand Names Polo-Ralph Lauren Calvin Klein Esprit Sperry Top-Siders OP. Briilania Levi's-5O'l's Q Wesl lzod-Lacosle K-Swiss '14 ,,, Q WW AA.1, . iff! f ig J V ,old WJ Q Jfyl E -'i 1 ZW' 4 .5 - wg' MQ:- W v iiie Me.. 'E 9 ., srwilrxfw Y f mm . N M E W V V. - - A 4 Y- -- me N Y 1 -rv -f-- 11...-M..-....-.. .,,,..,-........-.-.1 i ' 2 3 , I f ' i Q . 1. Brightly colored vesfs were lhe new look for fall Denise Padgelr, Jennifer Gregory, and Elie Simi show how a nice vesf can change a plain shirt info some- fhing special. 2. Shoes of every style. color, and size could be seen on campus. Here is jus? a small sample. 3. Good old denim fakes on a new look in vesls and jackets. Sandy David and Chrfsra Gulierrez wear them wilh colorful panfs fa creafe o casual slyle. A. Proving fhe polnf fhaf some sfudenls are dressing up for school, Tobi Palompl and Christine Cook boih wear dresses. 5. Enn Berry and Elafhe Tzagarakis are POBB, Uhafs prepped our beyond belief in preppy ialkj. 6. Some people, ike Greg Smuilen and Shely Adshade, choose To make of unique fashion slafemenf all their own. 7. Many sfudenls have fhal Spartan spirit! Here M55 y Muncrlei Tro y Javahen Lisa Ji- menez. Jon Raifazzl, and Rhys Panera show rhaf the fradillonal green and gold come in many dlffereni farms. . .. . . X 4 was i ss' 5w +2i'is.T'?E 'ii hs fa - ia' M. ., 'sgisvifugggggswss A 3 Nags, L51 Eggzaisosssfagsm., Nssiiitsiw ww: :wi News szwnlgfisssfl.. mx., ,Tis we . www' .nw , T. ,mammal .sw .. Wim .. sf News , JIM Q :MEMS ss lwzs . X r .M My .Wm vfssL2s.w?tis::3feifziffiweezzsalwgisiarfif-vzwlfwszriz.i..w:::,.M ' fii2iwl2?Si:'i:ft.Qifieemiliiiisrilf?'?rf11e2'.?B22:2rr as A 01525,wJgggis43sikyj1.l,Mgfiilggs.-353353.'yflllfsz dwg. 1 . ,q,w. . kf.Y . T5 Mzisfssssi z:.,.Esem ,M .5 ZZ Q. ws A WW Q, :Z 1 E, L mag 5This1sfeszsss3gs2?h.:?gmf2 as A. .4 .Megs Sggsgiwyiiszzsg T f 1523225231253 zgemszufgszisgggggzzazzgmgw lyggifs... Wsfzzzzwi iigggifgiSb?s5Q?g,5W:5?5F5Egbs : ,tziztvgiiia f SZZQFZSHQ Qzzwgggggiisfls-a'S2gg::iaw'q r Imijfciiiss-Q :mini Wtillww 2 EV! Wi? ETS 522122 if 'TYZUSH BTW? s:.,.gsEs2:gs,sz1ssgmi,. . 1Esw.,ss W i 5s'i2sMH3'6 l'39wf- WSC 'Qi' 040333 TL siigasfzszszlfiswzsffiffizfs T msiggszsiigfgi Yisigfiiffiisissf A 1:2 'W T zzziwffi NES: ig -Tiizazszarg if y?iiH1A1g1g'?,il.gm vyyi semis grifhgfsimb a 3 rr. Wg dismal 1, '12 fiw-Fgiillim Sv fig gs if we 11513 Siinziiwass m zszizfzvs M2212 ri' sssr ssszggzzsszgzziiiz aff wggs: if 'Mif::s,.s,s5i'a2Xrlo rnazzmw S Q LEX Wi1'i,f.,sZwviXg'5s:'nssw3:aims ivwwftihi' Siilirsl ifffzmseffeizf EEiygiisgiigissxsssi2253255-Lzse Qisiszsz . 1129222 wif? vis bsnesfzuzazassafigh ' W. xswwrw mf ff MM.. .A 7 me H-gfsim we :iz z.. M mpg mn of :::f:z.:ii+iT2:::x ss 25555 3175 2 fiilf .12 QQQQQ 5 sfi5E?53?3??gEf325iG 25323 1 if: :sz fzisilil was si mia? www, Smal mes 5 2 6 Everyone will remember The fun Times aT lunch: whelher ealing mun- chies from The snack bar, brown bag- ging iT, or dining in The cafeTeria wiTh friends. Some sTudenTs found iT more appealing To leave campus. Common places To find The hungry SparTan were close wiThin walking disTance. Those sTudenTs wilh cars could eaT farlher away from campus during The lunch period. Y K fs V , ..' A . Y '-3 . .1 V isle,-.'L ee.s1eeusf:eL -' ' f 'F -. Tl'1.?m':v W 'l' .HQ MQ T , ' 1 ' K ' H ' 52:5 ' ,Q '+-Hr' 4' 5 27 . .A . , J ' Q ' V i . f .1 V - if T ,wb nf-2 ' W 'Fcuk ' . 6 ... .rf M85 1 xnxx, ..., N '- f fee 16 ' .ff::.:.-, K 1 .eff ' T eg 5 ' e ... T.gi -- an 4. Wendy Cox found The cln've-Through window af face Bell convenienf for bringing her lunch back To school fo ear. 2. For a change of pace, Kenf Gall, Jon Rarfazzl Chris Dearrlclr, Todd Prlesl, Travis Plummer, Jim Hawkrhs, John Lacey, and Dan Gufierrez enjoyed earlng they lunch ln lhe acrlvlry courr. 3. Sludenfs wllh cars somellmes decided To ear farlher away from campus. Here Ramsln Gani is enjoying 0 Pax foasl beef ar l?ax Resfauranf. 4. Mark Sellzlnger, along wlfh olher sfudenls who chose To slay d elecllon of food in The cafele- af school for lunch, found a wi e s rla. 5. Molly McCormick, Kaffe Harmon, and Alix Tuoman found The ' r a ulck freer durzng ihe Yogurl Pump a refreshlng place ro go fo q lunch period. 6. Mary Fuzie, lisa Dobbins, and Vik! McNabb found Taco Bell a l sife fo ear off campus popu ar . ' ' ' ' 'rch ls on from McDonalds fo 7, Nick Pelrulalus IS evidence The swf Burger Krng. l' ri H lilly. .T .if is wr' ' . illllili . TW! i3J1f'5 N' ' 4 i T. vi., il l Q? . -ii' Wi . of 1 . T is T ky I . V T ' ' EF!! Jimi. 3:1-Sim iolggiggfap T , .. E' I . so ik fb 5' ww . iff: f XF:-f'lEAy,ifn, . -.ga-!i.Q:i5.--asf.. fgsim'-K Q , N . 5g.?2?z ' 5 . 1 W A Q - - 1 1.fifs.g.,:1:z:f V .. A f A fgwifq , 1, if . , 1 .12 K fqf.Q4,.Kf'2 k ,L L ' - -4 'b ww : - wtf M ., fgfw - -...V ,gy si Q 1 ...I N- M: fm.f.,1r: . ,A ye fy QSEVL. ' ,isfj EI 1 5' 5 - gh- ff Q x J ,w i . 1a. ' ' Q-1 K x . xp-gi M5533 451'-1 X A- 5' ' ' ' -' .-' gg 2 251 f - A 3295? ,- :sam Q -- ssgsifs N N 5' Q . Q N - ' K I W: . . fx - , iiwr -2 f -' ' . iw - 1' V' is Q H Q 3 f 1 X X 7 fi nl if E 1 ' 2 gi ' 4' rf ' i S Lf 2: - 3 2 fn 21 . I ,, L 9 ...gm -3 2 ' . - .4 .. S . ,zs' , 5 - 1, 1 Nga ' 'six -- M X vwaQs::ss1.u:gj :-mv: mm-fl y 'Ag ., 4QFy,g Mt., ... Q m x . V .V ffgi, gg f5i:VfT',. A f '- K . ' 1 R I .' - . H , - H . - ': . i 'f ' -. wg ZN A ,- wtf W -2 - i 5 U . 5 - H -.2 xr. . Q ff . 1. ' - . U fa 1 .pg W . - Q 5 .. , f Q Ps' .wim fmsiff v M 'w ma .,fii,....m!qii4?::f ,. we? 'Q 4' I if M Elf . . f l,mQ,.Q ' W ,ii , . , W. B A '4 E 53555 Q 7 frgiwf-??5T,'f wwme-14ggs,z::fswgre: ff'w2fF:2 :sfeggf21LLS J f 1 Lfilfufffwz gr:g1.Ef2En-L 1 Xfmli ffiif lifiiiilfilil-I u ffiaizfiifuw ' f f Za: V Www ggvfwmfgwpggeg gg g3yfsf::..:::,.1Mx.,1smzigwfm4im: mfsgxgmqiwiiisswa,. llflifmlgggw W uggmffm Mag me wig Q35-1f:w,,:35yf, gzg-rpzggzgsgwgmffp Qgwzwff - -v va -vw W YV V. ,.l...N..yw W W mmm? RWM WSH mv aww M... iffy Mwww-ffw.mm.s,3'5S,S,mMW. ...Mem W Q WW -K' .. NNN., ,W ma... W..,,.,',, ,. N, J ,M ,B iw F. A X f .,,M,,g..,.,,,.. Nazism- :4.::4:W:m:5 fxi'ww'Sax:f2SwMffffNM 'ww wzwaw ME' 2, M.,g2gwv we g-gmf.wwWm-WMMS .422 . ziggwzgigfl'-3 K ywwsbmfws, Q f f -fmzlgggwgw-M . 'Q - 'Wf'5f rv.ffWx 'Z .1 www? gsfzfgg U im haf Gifllifxf Yi mt' Az, . 1 . 5:2511 , ggi ggi .fimizligg A vigmsfimf u svfliiiziisgi S1 'i'Yze'E??,i:f+L1ff5h? :.,arF.?iEE3l3?53, ffgig, M Q 1 W Q 12.-. ww f ' Q' U- wfvgmfyggv 34505, 1 H3 ' -N W'Q0gM-w' -My me wiv... .img a:,ggf:,5,.: gzewmg P Mfiiii .fg..?ggg, 5 wffggwzyz 4:15553 -img .uw Q ,N f. .pw mzxsszm :wrssasS?s:sa:. gzzzffsgif-Mgfwmm. -.:2i3f15Q?mzZ,:s1:.f.. . 'k QiQ3 ' 'iIiQZ22.T35gQL?.?W -A Mwcilw wwffgzwa zpsszmw y 'S33lASiW'YIs55 gg:HiwNfWrS?S:fM fgisffrizsmfzfzkfsgsQmS2'w+fS ww w-wmbffsgmsszvz' ::,.::2::5.4iW1MwM.1. .fzarizzx --WgmXW.,,., ..,f..p.g:ggg:g.:s Wgmmxmymw .....,.- . wMmm3'wN :----H...-. Nefw-mms gg, WW.-23 QQ. .mmiw sfiasfwf Mgmgwflfa, mm . .,...,,Mgigw2ww , 5,-Nami? W gegyggwy fzmmwwx. A , , mm.. -5.1wwQgm.,,.. , ...MW.,.,... gl ,,gMg..,..,.f ..f5M.f4m wxi w qfgg-Hm.m.3 , - new Mmm., ..,..mf .,,m,ww, wwggi .N W. .Mm Q, Mg m.M,f,, 0. .w.,mWq if ,Mk,,,,. 2mmM,,,,,W..M ...,W,,M SM ,,MmM,W. , .. .,...,..,,,m.,Mv F3331 w:qMl,, m9, . :.:.Qg.: iw,2.wfggjg?55 E,,g-ggwggx w ... gg sw. V- www S, r-,Mggf-vggggg Qggggggg Q 5 wig. .zfwim wqiiqiiiuiiig,-,gggggxggigwfx ,wgg4.x,g:,W YmggVgwg.mh,w.g:M, mggqidugx ,,.5i53qg,3g.,,w3.A ..53mgm,,,.,N,Wx2 ?gfE522255xyshf-slfmgi Ewiviffwmw E2?2e.sW.sf:f:a?:g: 5fgfs'f5'f'b' gfgssszm xmzzmig smiwiw'--Mmaysggmgw, wsgzwkfa wwfma assess. wwwmfezfm f.:,,z:ss:?:::w H sifzzsu ff fF?fSQif?iff' usqfffisg ww .sxwff ,.1:::g5Ef?EQ X T95 Q Swami mm., M-fa. .,,-,,., wyvgg-cg-gwg H ,.,,,,..,.,.,,.,.., ,xgwwgwm 'A' . Minn: Q .-2 -- . L ...mS,g3,b,g M wfgfzm -W. W -ww H-v 'hfvegiw M.. W fqiggqns WW ' ?rKx.?5?'e?.f 1. 5 .W filifffw fill? f1- - - w ww zsgffs-ww wmv: ...M AM. Wg 5.gi.41,,, N ,K wwmmw 3 ....... ..:gig,: , h, Q -. 4.2.25-143 ,--M mm. rlkgfaaw-gp -- .-.N wwggggy, h.,...W X. ,A Q .- , ,g. Q yen ,, - F -1 .V si www... 5, A .. wwww Www, ,, ,. Y, :M 4 M -W mb.. M . Q 5,5 iismf' 2 ,F D. 5:53652 1 Alva. - sw ,Q - fav S: 1 ,4 WN 3 2 ' x 404:21 - A Y SGH! .15 ' ' MEMS if J - mgwrf izfizfw' '- I 'TQV 1 Aww: ' ,, . 3.152 V X gg.. .UW , sgm4g'v:p,. : 5 3:85:22 .sag :' 5q,,2,'g.,. hv'wQ :sry V. f 25 W' bpm.: Q '- 0 ima ,nam wx., vgdliig, .. 4 . mrmmp. , . Jima... was . Q4 ':: F5 Jimi: xy ' :- 5- mm S+ wifi. 2 ' :2---:.-- - Q MM? ' -- 5 3 W H Vw' f J:eI'J-wwf stiff: fwlszfiw: ' www .,: S - ' . U Esegigmsfzsw iz.: 55.4 W K ..:: lg. Q ,...f g i - ,-,2gwfP5Mlg3:g 1. , .5 ..:::E:mQg5m 5 A3532-252:i:. .I-.: wffiabw FW:'- .-.-. .. TNggf,pg4gg3f,M 24 :- . wyw' wlggs f-Eg., ' SLM, . 5:2' ----- -- , ww .5-Y. : .. . 'ggzgggmgwwgg 1 - Qyawwslsiigi, U:,:55Qfssgmf5ff gfygpwmwmsy 'f fy5,bgggf R : H f mzwmw mm. .. -. an vm, :-.... ..... . ww-H :z:':1,f.fi . -wzmmmukgfxiizi J ' L 3??3'S?xT3'MH Wlfmwasf Mfmwsgag. WMS . fmfwffw shim. -an 'fs ixvgf.. ZW, A agqggg Q-553351553351 gmgggstg 4 Q :a?Qvzri 2 i -me ...ZEP 1 A V6 W f 'Q 4 . A . l Sf Q fl 'Q s ..4'p .x N!! Q' , 1 ,,, S t .Q -:a.f.fs,f 5'-1, 1 'Q' , ...fr if M A.. .LM - Ju HE? F1 f v7 if K if N SE! fgnvww 7 M, W AM ,Q rx. hlalfw ,Gy-su-I-i...'f7. A . JW' ' ' f, 2f ' , my, 4. fs, va- A' ,i ' 'Tm , XM '45 X f fig 1 Q llntwf 3.1 2- - 'L 'L .1 :KW qu ,s ,I N, 3 - rf figiilfif ' X Ww- -ww 4 K 'ff q. s 'Q ,, wg. K- ,gX'iNff E g ,,, .,. .kim 14. - g . , . if ms m -K . -., ,diff ' yf iggg,.,,... . K A Q 1. -x if - X 1 Y. :fm , 1 wr , ,M , , , .. X I Mi ' ' l, -' ' M- Y gk A ,uw ,V K 1 . tt. , , ,mfipj-p.L W . w ,, My U M H 'W ,HW .gi . 4. g , 3 Ngfgx A -3559, .-,-L . 1' 'si'-'L' - ' P5 K- 5:- Sr K V ' V - i'9 '5m. , WV, . J 111 .1 . .,11111111111.1.Y.11511 -.11111111111111111 .. ,1-Q 11. 1 1 1111 1 1 1 1 1W111111 ?'11111111 -Hgh.: tpiz' ' 1 - ffl , 'Q X. 4 , 111.11111 11 11 F 11111.11111111 1,.1.1....11. 1 1,.. 1. .11 . 1 ' ,fwma r ' 1,15 1112 W 411 1 1 1' 2 1 1 11? 1111111111. . 1111111111111111.11111:11111 1 1 1 1111111111111111,1dw111-1111111111 f 11111111111 1 1 1 1, 1 1 1 .111 1111 1111.1111w11.e11-11 ---- 1111111111111111111.,1w1.1 1 1 1 1.11.1111.111111 1111g.f11.11111111111, 1' F 1111111111 :w1M111Hw W., 11111 11.111111 ,1111.111.1.1.,,g11111-111 , 1 1. 1 1111. 1 11 -- 121 22 ' - ' ' ' - 1 ., 1 HA.-1 11.1.12 jeff' 1 1 1 'lil 2 F- 1-1111.,,11.11, 1' 1. ' 517135: 11111212 ,11,1 111-111 -1111' 1111111 . 1 1' V 11, 1 111 JW ' ' 1: 11111111 21 11! 11' '11 -'Nw 1 Q11 1' .. 1122 11 1 ,1 Lf' 1 25- 31 1. ' 121 1111 1 VW 111. 1'f1' 1 Ig 11121 r .-1 1 111 111 rr? 1..12121 .U111 . 1 1 M1 ,V 1., .,,,, . ...111 K .1111 W., 1.1, , W11, '1 1 1 11111. 11 . 1 1 1.11111 1 1 ' 1111111111 ' 1 1 111.1 1 111111 .1 . 1 221111 111 1 1 i J 11,512 1 qi ...111 5 71111. 1 111 1 11.311 F' 111 i 1.1 P11 , ' 11111 ywu 11,111.1 1,1 1 1 '11 , 1 1 I 1 1 111' 11 1111' ' 1 11 11 111111 111111-1111.11 .11 .1. ..1 111.111 11 1.11.1 -1 11. 1.1111 -111-11111 1 1 111 1 1111 1 1111 1 1 11,11 11 1 11 maggie 1 1 1 11 111A1f '.1.1F111. 111111111111111C11j17l11.111W1111,11111W1111WW15111.11111111111111116511111:1:11'111..11111F111111111111111M1'11111'1111111111111111111111111111111111111111111ri311?11111111111111111'11m11111fN11111.1.11111111112111l.11.M11'11113.1111111 111 11 11 W 11111111112 '211111111g11111111111 1 111111111 2 111111111111111111111212.1 11 1 111111 111111 11111111111.111111 111121111111W111111 1111121111111111111111111 1111111111111 1111111111111111111111311111.11111 11111111-1111 1111111111111-.1111 '111111 1111111111 1111111112111 1111111 111111111111.11111.1 111' 22 11111111111111111111111111111111111111111 11 11 11,11 11111.11111111111.11111111111111W111,111.11 111111111 1111111111111111111111111111111111111111111 11111111111111111111 ,11, '111 11111 Z 11 l 1 1 , I 11 I1 QI' M 1 gl m 1 l 11 1111 v W '! Q 1 ' l 111 1 11 11715 11 1 1 111 1'1 11 11 1 7 11 1111111 111 W 11 1111'W'11'1111, 111 1 M1 W 1M 1 11 1 1WM111Wl1 !,l1 I1 MW11 11 1 01 ll I NW Wig W nw! 110111 .,-I ,1. .. , . .1111122121 11.11.11 111.1111 -11111111.1111 1 1111.111 1... 111111111 1.11 11111111.1111 11 111.1111 .. .. 1 . 7 New1.N.1,1w111..1!.V,xn,.3x,5.!1..'1!1,1. 11. X 1 1.1 . ,.k ,..,...11,,h V 41: A, .H .X W W .WH W cis.. 11 'f . 11151: 1 111' 1 . 1 . 211 J .111 11 11111 1.1111 ..'111.2.11 L1 .1 .1 :'1.11111..J 21 1. 1 1 1. .. 121 1..11 .11,.1111111.11.,1 111111111. 12221 1111111,1,1.,1H.1,1111,1111.11211111 11111.111l1111.,1111.,.'111111112112141 ,1,1,12111:1-11111, 1,1,1.,, 1.11111111,1,1,11,111f1111111111111111111.111111,,2.,11111111111111111111111.:1211J1g1.1.1 111.11111.121111111111111111112j21.'.1'11111:112111.11111..22:111..11,1.1111.,11:1111I1121'2,11111111112111111112.11111111121111.111'1.11.111111111111121113j111..1:11112'..,1111.11112111111111111111 115' 1111' ..1. 1111111111111.111,,11..1i,211.1121,,11'1,11121'112 1 . . 11111111111111111.11111111111111111111111111111111111Z11111111111111111111111111111.1111111:111111111111111111111111111111111111111111111111111211111.1111111111111.1111111111111111111111111111111111111111111111111111111-1111.111-11111111111111111W11111.11111111111111,111W111111111111111111111111111111111111111,11.111111111.111111111111111111111111111111111111111111111.1111111111111.11111111111111111111.,1111111111111111111111.1111111111111,.11.1111. 11111111.111111111111.111111111 ..11 11111111,111111111111111,1,11.11,.1 ,,,. 2 12. 21 11 ., 11 . 1 1 1 1 1 1 1 ' ' ' ' 1 1F X. 111111W,111,- 11 VC1l11.111g1,111111111211115 1211.1 1111 1. ,,,, 11111w11.1hx,f1W,1111,11311 ,. .111, 11.1.!1V1111'111 11 111 11 11 1 1 ,.,. 111! ,111 1 51 111.1111. 1 1 1!1111.3w111!.1 11 17 1 1, 1.117 1 11 11 1, 1 1.1511111.1111111111111 2 1 .11-1111111111111.1f11L11,1111.1.11111112 11 11 11111141112l121111W1'1111111 .12 115111111111111111,1111 1 1112 11111,1.1111111111111..?111111 11' 111211111111111-.11,1,1'1115111 111 111., .,,. 1. 1 1, .111111111111111111111 11 111 11111, '1111,111:1211111.1:1111.. 111151111 11 1,1 W1111111111111111. 11 12 1'.11WW111111111.1111-1111111111111 11 1 1111111111 111 11 111111111111 11. 11111111 111111111111111 11 111111111111 11.1,11111111 11, 11, 11111111 11,111.1 11 1111.111111.1.11111111 1.1.1, 11 2 2 1 1112 11222 11 1 sw-..-wvqmee,-1f.o.f1-BMJB-fB.wef .rn ,1 ..,.,,-1,, - Y .5 ef, ,- 1 61 4, Afier being crowned fall homecoming Queen. Michele l-lolfon gels a kiss from her fafher. 2. Sfudenls involved in drama spenf many hours preparing for The actual performance. Randy Tarr rehearses for the play, The Enchamed. 3. The Davis defense digs in againsl Modesro, A victory, hke lne one againsr Modesto, makes all the prociikoe worthwhile. 4. Wafer polo siandour Eric Fischer has enjoyed parlicipofing in sporis all four of his years al Da- VlS, 5. Band keeps iis members busy wilh pracfices and performances, Here, fube players Mark Wnghr and Sieve Giddens march in The bands hrsl COfT7D9fI'fl'Ofl of ihe year. 6, Varsliy song leaders Karen Jensen and Ann 'W 1. 12 1 Zwahlen Clown around affer cheering ai a ,111111131'l:1,LL Yi 2 lk A 3 5 4 6 P -.1 1 11101 1 1 17111111111 1111 1111'1111111'11 11 1111 11 11 1 1 W M ' s. . WW Q A Q i's'z's 'gs:'k ' A me WWW- MTE PX? :muy-'sm 2 -: :Me-Wqj 5WW5sgWW5Hi1 'efv3:s:I:X1 Wsgfi fzs:s sc2g3g:gW -MM-1fsgW fss?2if55gg3gwqX:1WW A Wfsfw.::r sxfsfifws 1: away me 1:5 - wig: W W or W W' iirfg . W. eb . 55.-.A - X- .W - WW i gpaekf. Wg N ' :saws g Rss: rfWi.,,.r Wi ' mem, 'f'-MW. W ,. Tx fx' 4 1WWw:.1' '11' WsSW:1z ' 54 L U W bv l -W ' 'lfl fr Hisfff W -R 2 Ki m D ' Q jig ' ' W 1, -1 ww- I 2 A ' 1 . pzr 'W -f ' W- W . :.- .' W- 4 -' .ww 1 N Q - . ef: ' S ' iifiif 'll ' Q Wi f ' ' y ' ' egg e W 1 - ' ' i ' 1: 5 W 2 W ' ' w ' H erve. ' W X ' If WW 5 xiiim W' W. W . f' 5 ' ' 53 .W .W 3255 'Wif i , 1 A ' iK'::Wr . -W .iii 3 A W W e W. 2 f k m I 'if a w .. 4,93 .fs XSS! ,W g 1.251 W wwzwft W.z1..W2 W - Wsgyeg.. .W msgs . W W . -f Mzlsizw W . W 2 -.fgrgfts 2 2- 'ffm k , WW 4 .A . .W mW...,r.W,W W,W,g1..WmWW W Us ...Nm W. s..,Wm M WBW WWWWUWWB .WWW em .. We Q We Wm QM.. .WWMXW .W .www ,W-WWSQSWM -rw-W Wim Wsmwmw K ,W Q 4 s.UW.M,,WW W W, 552:93 '.:z4N..WxW:W5Wsa,WW wggzgg 5.1 WsssWWWWW.ksWQw 5 fgafssgg SWQWQQQQW1? 555222 zwmfrshrfzzwf W::iwWm:w1 5:1229 milwsgg wr5WwW:gQw Liikoit sffxmm - WWSYSS-XE Qi :.a :s:.5::.. 2W??s':',W3L5'Ss5f WW W- Www w mWv,,W AW .W s.ww.s.2xk. W W wsu W, , .M M V r. .. S wasr.w..,w . We my . . , g,.,,a,-N g 1..,.W.mxW We uf ,W ., .YM +1 UJ26 W ,. . W-z . . . K . kg W W Wzs:W:2:: .s..:::2f.W..sgw w.ggwW s.:W.W.s:W22Wgs?WWsggW Wy fsWff1g::WWsQWms::f:W:n.WWWWW Wg,W::.:,em .::w wW.WW. 2:.ggwggWWrWWWr 1rw3f?ssg:i5 g::i:::f .:f . WWWgWgggssWrSfW WWWw:Wfs:fs:E: isssfrirzffsrmz s ,ziia:fR,sW..W,. gWWWW1S:1'2:-MM giimxziis rss: W eggggggzzzmzwifiskWeiss1 Wizziziiasiwiiiiiwi 12:gz1:i31ii2SH::?t4:f2e12 ilwfgggfgffezzsziliif fMgSWggaf2wW5if? GZESSSQQQEQ gzisiilkifssswiziizisz iiikiiesiifgriiih y sawwzswgzffzszaxezsslw :m::s,s2 Eis'2::: WWim::.ggsM35555gg,il 2 W rjisiiksiifafgsggria 'L szzisgzszzgisfssf ,3,,wA,,Qgf,gs:i.i:,s3QstsQgigfgpgggfwgfa WE gmg5gWgWzrW , , ' P ' r K ' N mmf f,:1Wi525'LQW ., V- mfg ' www- fWgfzffm'r:rfg?f.,. 'gfifiwwgg J 'wiEW5':iZW M ixwfigssgffq 'iisiwlai fw:a2:fE'g?ZS.'mWl5 Q 'Wv3S2ii3Z1'w I3Z'3AW Ms Mr .W.szff:::ri2ff5E5? Em.. ..m?f1f2iW 11f21i5fW,w, ' iiWrffW2iEWW , X W, Q ,E .115 ..WfMiWgggW15,: W W A ,, ,.. .. 2-W-fWrWm.Wy....,, A W ...,5ww-gggzzffzg. . 1WeWHwmm,:::zs 1:.ggi2mgggwm3,fifWegrgsmkgsvgmfrggg:.::Qi.g:wEI M wzgrai 2.izzzzagzzwssiisizzziif- 12Yi?s4E?sWW::::22z1L -Wiczzfsziffiiiiiv eiwgit 1: 7-5P?5325'?5?i9?f371H 1Vl?'3Wli?'f5W::z:i5?11:pg: 11ff35W3siQ:s.LQi'. razswiiiiiigisgezzzr. .azigifzsligizggafwigsiza K22zsssssirgsgfiiiflgwgiigssizsggaiisSfiiiiigxf-rfwfgigzgisigig 2?2fsiSiWEa5?1i.1Wmf::.:. fi:Zi::im::gfg2EZ2'k zsi:gSfap,?sSf,:.i:iia:if:f'z WWQHQLEEFSSSESZQQEEQQQZT F s2'1EQiWg?2,SEQW?2g:g?gggW.1:1s'r whxwvwgfrggfwg'5s'22,QZ??Wz?i3s3Wf'WSL noZZBZ'e:m?5Wwzgggs:gV3Lk W 5MWw3fg:3'5s2s3SQS WwwwzvfwiiwwwamWWQWfizsfgigjfgiwiiwwwifsWk siiisxlsmsvafvsgrvgr-gggggjgggvg-YLZPW iwlgrfzirilQZ'32mgi1Q5i, '-233322, wfgwigwr-ww haw' wwgifvskiiiiitiiiglfiigiif Qrszwsiwaw SWMWWQ TZSSQ is Wbvfaewwwwl mwgzW.z:,m.W.:,.W'2WsWSW9ggWgfg5mi.:m WwwgigsW:m.WWsWW,WWsg fW::::SSgwwf1zz,W. 5HQ2as-wearfwfrifrwrrwewvfwxwmsssmear:-Wf:Wfff:WW1smWzzNs52S:eiSW2brWWyssiwksisge frZWik51s:,?WWWsqWi?5ww3 gmssiimmsmliizifiiimsi :.?:M:rWWWwiWgg frggsgwzssgzsfgipsi gggrzigsmgg tgggzfswze:Q:r5faii5gi5Sizszsssfigifkifi 1 ::W:1fs2'gi5iS5?QE::z:1 1m355a5fE'm3ifi?ZESS?fb52lfiiiiffmiiiiiiiwiigfifgzii1555233553235Wi2g?32i235Q2'm1w5.iE55E ss22igma::f.fzzf:2:sg:5W5?s sassisiiiwiiigix sg? W sgmggfggsgwzw ' swgggggggeili Msgggwg Qffiiiizie ggg.,W3.fmm ssW...:.:s5WW www 'M W 22 'i3:5Wfg MM, , rgsiE:12:,Ww: Aw 'K' MEWg5Qys:gg5wggg3'5m: 5 :W ,f1fisZZ??55ZZWWw..' w:M,,3?zs'-.if2,f:gg1:g1,,3,,f,, gW2wWwWWfS?EAm-'?V ' :WW efmiww 4, :2 5 WWW sf' W , ,gggEggg2:eE::2::'W:rr1:szigpzggzzzggeeiziga?:QWZZZQESESQXEEQSWQEQsri:QWwasissggzgzsM55QggmsyggiyiisigigiiiizfezW:sgs.:sgx55EEQ2?rQ5gggsfg3yggqw zagggisixisvsssisgiigeggiv W,W:SsEZ:ig,E??:E:gk gm. gggggfgia1.fezfaszzsassgggigfgzzzsseer 1Wgfi?s:a?::s:a::zWa:5W i55iZ??,Y3iSiZ'?Z3n?3X5QZiiS5. W:agggmzggsazrsfrfifrii''32fiigiiisgiszwsz:azz1aims:1121222222533535:gee'-frzgssrswizxgggfigggggfgggfqggigggigg. QQQEQ2W5Sgem:w5::azM.Wgggf22isgrszffiwigg Qgs52iiiWfif1'5E55xirWQr- 1iiS?12f1112W'Vi21?iEW'??15ff9f:W2f'fW2f2?SP' fsfsszfifwiiiiifi' 'QSZZSZSQSKQSEZHSYQZSSW 1211:wmiiii2W?WQWWQ W zifizfzrsmzfsszezw-W1Wg:ss::ssfs'5lWw:WW:WQfWW-.Wei':siW1Swfs'::W:Q::.s.1fezzs:rs:f:::5?wssSm:WQ '5Q22WWS11fUi2i1yWfSf 53 ZfiS?rEEew s2s?:12s12i2wWWWWW M-MMG.. MM Mag z,,,f.sm . W.W.wZ'iWQWW. .HWWWQWWWMW WwW.wm.mf..wvWWW ffyswzugevsesrv-Q 4-WH Y s LWMHW .W. .MWWSZNAX JWWN Wmwilsamsssgfr- Wk... r.W...W.WWwm wifi. K W 'V HW-MNXXRQWYHNWW5-re HM Wag Qgigsiesfwx s f'W'S Y 2 1f5Wf?f'Y 2155? Yiifikklliiiiffi f7fiiS?s5E?i?lff53?fi ' :EsQ52255fri:2i1i:ze3?'aif.2513'i2???irS W 552555 WW rg:3lSIt3'51gig t..L3Z?Tmg VM' 4 731531.92 XZASTW' 'WEW,gI-3L':,-w55lyg-W,- VZESSZESQEZZTZTSWQ. silfiniiifggggg ziiigiggiggggggggfy jgsfgigggfizgigsfggggfgggg Wwigsqgfzyggsmggfggggiggigifkgkgg fr? kagaziswfgwggmgg W .Lis 1 WW: -gzgszssizzsssswar 'K 2:::g'ig5,pg9g:...:-. fzriaiwggggggfgzzf Qzisgfzsszieszzizszfgssigg215-Wsyiiqgmiggggfegbnm.mafssrgh Wi?51gsg?3iWsE-Wiisgiefs .. ssQQ51gg5:g.:,::.:.,W. sWx::sszQf:s::g:WgW,: ...a::z:5QQ2?'2ii511WWW WWiH?::m:3fif24f1S5f- WfWZ?Qss:3f2gQm:1WfWW in gggzgssw, .32smgggggsgsz:wf5w..i.X..A57, x 4:.z1g,.,,W.W,,55.Wm2 MRW-yfggggggggggggfrgq., mg,ggg,gezgWgg,gggagz:::..W.. ,, swieiwwigggmzfegc --szsiczzszswilliiizf W'i25Qggw:Ws5i::2i1sf. W WLSWMSQW 325355535 W,:f:221?i3iii55Q3'55:ZZi2szzzwmw Kylie -.f:5-.sr:.:5s:: gemzazzzazxszMsyyWe5ggwS2s?Q:zWWgfmszii:ss2::Ei3sW.Wi2WWWS2.rUQWQvg3gg5gggg,55ggm,W3g W WWgpwsgg35325:Qfer1ziziszsisiigiizhsszzglirgf Ziitggfigigpfiiiiillif L:s::E5!1:WxgWf2gmmgiwrrfzzifiliiiigwiiffiwifzizszsggziwiirW2 Siwiirbfzzazfigififi H iszgggzfezwzzgszam Ws. rWSi4gT3??1??Sf25w gS5.2AY3i:::iWQa::sW:::.2,,22WW W '21 z:ix:g,,WsWesmg W Y z2:sg5:zrg,g: g3,mW sssf,,gWsg:Wm xsssis aeigigg 3 Wvgyggggggsengg .25 g.W:,QWss.s:1s,.WWf.mqfQ muff fzmzie ss ..Sis1ws2sWWs5W.MgWWQg ,, S.532',i1g sWsWmE332ggE gg g5 g2gM3ggg,WWW.s,,' A S ---- sr Mszzrzsiw ' rw if: W- 'W -----'- ' '- wr 'We fszzsirwfs :- W 'Wf A fb. f was K :-.1-5 . ...... :':. .:.. W5 ...Wi Q. shew :gaining l. wmmegg .. :. -: 59:35:15 W1 P , 922 ' 8 , soifvkigegs . Q W , :, Eg :' :2 ': E e..a.if5?.W,1 ZQZE - Mug ggi, Mm W lg a g-gwiszgs f 3 ,ggwi - . . '.:::-: ::s:' W pews -' '34Li'?igQSmaWWfv - 4 :. ,:msm1-W Q 'W -3 :':4 ::.: wfifkwwz X ,eswwsm W, Q wmmiyw A2 H 2 5 :qu ,. wr 5325352 er 1 wgWwg,gswggrg, ,.:- 2: ziWWg3s4W - .W Qzwkyw P eg- .: Q Sisvggjivasi We 2:01322 Qfaiiiis 5 H-EW We WSE ' : .. -w:':' L:-2 2.2 -. 2? .w is missin '- s sms will: ' . --1 EVZZZLZAZQ 2 ' I W- Z3 ws SW 1' tzzmivz ' izbgswz 3 :w ail X We Q 1: k iwi if. Nh zrzzwm? :.. --1 Q 52 Q Qffifgfi ,Wy :.:- :s.':'f. . . P 3 5- EWQQQEEES -f Wie.. :. . 0 rf' D' zwisgggw s 1 :QW Q gg ' . -: 25 :3 .W fb Q - - : hy . as WW-1 : egg? rf f Q - MW-W,:.,.,2:,. :-. H 5, W . W gm gs' : -. .: , ' Us E WW W W-W 5. K .6 Q :sf - W Q : ,, 1 E. -. ,W W -5 , .- he P , , Q: J, , W ,. QA Wg + 0 5:-z 1 k: :': gs.'::.:.. - I ?w ,:sggW4 , -::.. Q ,ijgii iggffagbxggf' Ir' W. .5:W35gggg,qW3?E U 1512 ' : : K : 2 Yr 2 f a q W 5 1-W '13 .. :WWWW RQE ifflis iiimzzraf.. .czmzsszip F , ie. 1 Y W 3 Q 5 z::g:.:r.w Q emzzsfz r 5 Q if mWfsWwg:?Mg . 3- , WML! '- : YZ .2 'Z .misfqwfrznf -W Wmggiiisa - . w1MHv:Lgrr 13 W -vs W fwiifiiiy WM-4 HW-s5Wf A 1 s -- lf--erm s 1-iwfw f '-If: Pwr fffvf ir 2: fizstzimzr LW. W ,Y ,. , .W Mzr- same W W ww gf - ,qgsgkzg-iizzsiz .Wmsm sss wwf? QW' 'BBEQFZMB P. for -, :ggi . lik' 2 zimwgcw naw: 2321222 ' Wim ' - - Hgsggsgzgs- ,-,::: ., -- 5:54, 3 SESZZQ' ,::-: 33. 2 1 Y. Esssssfze WQSTFYSUESSF' ,.Q:gi::..,,5srfpfisifgss- MEZZ?Zig-Wfv'Ei3W?iSf'??Ziss ,Seamzzsgcssfqsfgsgszzgss WigiiiiiiifgiiWiiiizsiieiWS1S2?2,E2E'S2iZ:Q :sz E315 iiiwzsv Q iiigiiiiffiilfiggkziz 361 rmsieififflfififgw WQSEMQSWWFQJW. sms 4? -.5231 53' ZIZ3?5332zEgEggi2J-Eiiiibff W-a::::E::s?3sQ2:..::.W1WWWszswN352mi?-mfeefgsixzzzzsezaszraw-WsesssfWfmW:z:zs?2zi:a:zaar.a:W-f.sfsfEWS?ssE:Wza?:Esm .f:::?eEQ:2?E3sfsfWfffW AQwfiziiiisszsfrzaizsfz:finsz2se:32WW??i???E?:::sm:eszszssziixisszsssiiizasisimsxksi iggiiasggg,,iw:.,5,,,,S,5gwg5a,m ygmm gghggsigkvgg M:mmsgmoamgwgggggggggzqssgzgsgsgsgQa5m3ggWyggW,gg,g:g:g.:g: Wzssszigf ggwsebgggggzsgsiitgzgswissagsisils qw H Wm Q- '1:gWg5M53'W5K?WE15227215123LlSSZi3SAiXH5Q53f2I5nWS fi Pzlwhgsiiiw WSi3f9:3r5S3SS3le Q?S QHgS32Ww'Si'igS'iNQQ222'sm .:: s. :: :. M sswswgw- W. em sis. Wfrfgqg,W:s::s:zWwsrsssWssssssexmzfgiimmg :wg ssvsnsszzzzsimzizmzgs W?5M:sfg:geg,.ggggysWMW messsszsz 'fiimiigwwg ggieminggzazgzggrfsz-zsrxxwsszsweg.zsfsszsswgsggigg mgw:.::f::zag.W2W.sxW We WW NQQW ms gififggfggggf iiiiiifiii Ei-21222555 i42E??212wWWfi1WfWfr5s5sEgiES :afar f Wzzissszi mfezzsfgzzfrza :ms . WWWWQWQW-yWsfl2QS?2QE??s2sazz::: Siszzezs :fm yisiw. ,rwir1W2?f?5'.a5. 40 .3423 im ' in-W., W 2 'Ni 53219 l. Parenis broughl fheir children fo fhe parenting class run nursery school af Davis. The children noi only learned basic skills buf also parficipaied in many enrerlarning acilviiies. 2. Co-edifors, Andrea Dixon and MicneUe Drlkian, along with yearbook sfaff members Marlene Voungheim and Khrrs Epperson affended lhe Journalism Educaflon Associaiion of Norihern California Con venfion in Fresno. 3. Kelly Piland, along wlrh many ofner loyal Spar- fan fans, were enlerlained by aliendlng ine varsity fooiball game. 4. Movie fhealres rn Modesfo provided enier- falnmenr for sfudenfs on weekends. 5. Mlschlevous siudenis enlerfained lhemselves by roller papering fellow srudenrs' cars. 6. Becky Bowers and Chris O'Brien picked ,bump- klns and sold ihem in from' of McHenry Village as a band fund raiser. 'I 4 QA ' MW nu W5y3rQ.Af1g'W'.W3 Wi gf' M A ' I f 4 14 ,zlmw ' .Wi e i..:W'V 2455522 A? if ' 'WW -+. 1 I --X --N 0 I I -K I 'K' D M x illlf- -s d '-dvd 'Ni 551355351335 gzxiligiifil TTES T A A T TT all 2' , , , L, A . M? fi' if T T l 'T' T 'E QQTPET f ' Pefess 15 v ...T 'I ry sso 9' -. es , ., 3 , fn , Mk' A .. Q . ke Y ,g,. ., During game Time The ciTy of Mo- desTo is calm and auieT. BUT when The gun sounds signaling The end of The fourTh auarTer, The Town comes alive! Pizza parlors and The BoosTers' over- Time are The firsT hangouTs To fill wiTh The eager Davis crowd. All awaiT di- recTions To The nighT's vicTory celebra- Tion oarTies. Be iT aT a parTy wiTh hun- dreds of people or wiTh only a few good friends, one can always have a good Time in lVlodesTo afTer The game is over. an UMHFDQY 4. Srudenfs gathered Together to form pep band which provided schooi spirit ar various ar:- Tivifies. 2, Key eiub presidem Chris Bradley ied a very active club on campus, 3, The drama ciub was an exceiienr ourlei for students who were looking for a way ro express fhemseives. A. Carol Gidiey along wirh other band members provided enrerrainrnehf ar half-rirne. 5. Chrisfie Dailey and Diana Norcorf were Two of The many Dance Producfion sfudenis who prac- ticed for concerr performances, STudenT Council increases acTiviTies by Elaine Tzagarakrs Increasing sTudenT body acTiviTy as a whole was The main goal of STudenT Body PresidenT ScoTT Weiss. Examples of This were a faculTy brunch, The pur- chase of paTio furniTure for The library, and bow Ties added To band uniforms. STudenT Council also aided in deTer- mining where The budgeT was disTribuT- ed. STudenT Council has been a loT more effecTive Than people Think, re- marked AcTiviTies DirecTor Bill lVlcRi- veTTe. STudenT Council members aTTended meeTings held in The mornings or aT lunch. NoT only were members occu- pied wiTh fundraisers and planning ac- TiviTies, buT Their individual offices kepT Them busy. lvlr. lvlcRiveTTe felT expecTaTion levels of whaT STudenT Council could do were Too high. STudenT Council couldn'T make changes in The lengTh of The school day, The lengTh of The passing period, or The amounT of rallies held. STudenT Council did make im- provemenTs in The school's aTmo- sphere, and This was reflecTed in The aTTiTude of The sTudenT body. The school's general aTmosphere seemed To improve, making iT a beTTer place, commenTed Junior Class secreTaryf Treasurer Erin Barry. 1. Srudenf Council: CFRON T RO WQ freshmen Shar- on Brown and Tami Crews, ISECOND ROWj sophomores Mark Nelson, Janef Goldsmifh, Mi- chelle Lawrence, Chrisfine Tzagarakis, Befh Rose, I THIRD ROWQ juniors Dean Galloway, Seema Shefh, Karla Kopp, Melanie Merchanf, Heidi Vandervorf, Angie Bateman, Regan Miller, Elaine Tzgarakis, Erin Barry, CBACK ROWQ seniors Lynne Manriaue, Connie Chrisfodulis, Michelle D17- kian, Dana Simi, Molly McCormick, Paul Zoodsma, Michelle Carroll Tom Nipper, Scolf Weiss, Randy Strauss, Troy Javaher. 2. Regan Miller, Seema Shelh, and Karla Kopp lisfen allenfively aT The November Sfudenl Council meeting. 3. 1983-84 Sludenf Body ofhcers: CSEA TEDQ Dana Simi, Treasurer: Michelle Carroll, secrefary: fSTANDlNGj Molly McCormick, vice-president' Scoh' Weiss, president' l-leidi Vandervorr, slu- denf direcror of aciivifies. 4, Senior Represen fafive Paul Zoodsma and Sen- ior Class Presidenf Randy Strauss Take parf in a discussion on a school dance. 5. Sfudenl Body Presidenl Scofl Weiss opens dis- cussion on selling padlocks for hall lockers. A A4 ,Q A Sfudenf Council 45 46 Yearbook STudenTs produce enTerTdining book by John Guerrini AfTer overcoming mciny problems The posT year, EdiTors-in-chief IVli- chelle Dilkion and Andreo Dixon ex- pecTed o Top-roTe yearbook. Advisor GerTrude Hogue assisTed The 25 sToff members in producing a quoIiTy yeor- book. PhoTogrophers MaTT Bowers, Rondy Bakker, Lisa Dunker, Julie Mor- Tin, ond Dovid Messinger were on The move oil year geTTing phoTogrophs for The sTaff. One of our firsT prob- lems was finding TypisTs, sold lVli- chelle Dilkion. On The firsT deodline, John Guerrini volunTeered To do mosT of The Typing, buT soon oTher mem- bers helped ouT wiTh The job. The Theme ThoT's EnTerToinmenT wos chosen in hopes ThoT The yeorbook could presenT The fun ospecTs of The school. Much cooperoTion wos necessory for work To be occomplished. Sfoff member Khris Epperson remorked, You're so busy ond pressured when Trying To meeT o deddline, buT when iT's dll over, you're so reIieved. From OcTober TA-lo, Andreo, Mi- chelle, Khris Epperson, lvlorlene Youngheim, and MaTT Bowers oT- Tended cr Fresno journalism conven- Tion. Andreo Dixon eorned on Aword of Excellence in yeorbook loyouT. The Ocfober convenTion was very beneficiol because iT offered experT insTrucTion and new ideos which were used To enhonce The sToff's obiliTy and publicoTion quoliTy, remorked Andrea. The sToff wos busy oil year Trying To consTrucT appealing loyouTs, com- plefing posTe-ups, geTTing odver- Tisers, wriTing effecTive copy, choos- ing good picTures, ond moking every- Thing blend TogeTher To produce o gredT yeorbook. Vo 4. Taking a break from consfrucfing a layouf, Renee Dixon smiles for a phofographer, 2, Advisor Gerfrude l-logue explains funda- menfals of a good layouf fo Sean Byrne, 3. Geoff Sprinkle and Lynne Manriaue decide an which picfure fo choose. A, Ad sales manager, Marlene Youngheim, reads an adyerfising book for Tips on adverfis- ing. 5, Marlene Youngheim, Suzie McGuigan and Laura Gundlach puf finishing Touches on an Ad spread, 6, Olympian sfaff' IFIPONT l?OWj Julie Marfin, Shauna Thurman, Kafie Harmon, CSECOND l?OWj Mah' Bowers, Marlene Youngheim, An- drea Dixon, Michelle Dilkian, Ui-lll?D l?O Wj Elaine Tzagarakis, Erin Barry, Khris Epperson, Debbie Maxwell, fFOUl?TH l?OWj Sean Byrne, John Guerrini, Sharon Graham, Renee Dixon, fFlFTl-l l?O Wj l?andy Bakker, Jamie Noff, Suzie McGui- gan, Lynne Manriaue, Anira Parker, CBACK IPOWQ Lisa Dunker, Geoff Sprinkle, Michelle Ocken, Advisor Gerfrude Hague, Yeorbook 47 Newspdper sTdTf works well TogeTher by Sean Byrne AlThough members of Corinfhion sToff offen worked individuolly, They sTill emerged wiTh on orgonized poper. GerTrude Hogue, odvisor, sToTed, T'The Corinfhion sToff worked well TogeTh- er. Corinfhion musT fulfill severol pur- poses for The sTudenT. FirsT, The news- poper musT enTerToin The reoder. Sec- ond, iT musT inform The reoder os in The cdse of news. An underlying purpose is To promoTe good public reIoTions for The sTudenT body. An eighT poge newspoper cosTs op- proximofely S420 eoch issue for 4000 copies. ln deoling wiTh This sizeoble cosT, The sToff worked in o concession sfond oT one fooTboII gome. The resT of The cosT wos covered by odverTis- ing. When osked whoT The Corinfhio cioss does for eoch sToff member, lvl chelle Corroll, ediTor-in-chief replie The closs brings dll The members Tj gefher for odvice, discussions, ecT. The sToff promoTed o group efforT, o well os on individuol's efforT. The sTo' member olso goined experience on shdrpened his wriTing ond communicd Tion skills. EK Q l 5 V l 5 -, W, f, Wwfig Z 3 1 l, Assistant feature editor Laura Hogan and feature editor Lisa Thomas put the Hnishing touches on their page before delivery to Ceres Media Center. 2. Editor-in-chief Michelle Carroll works on a newspaper layout. 3. Sports editor David Horton writes up a sto- ry. 4 Page editors Elicia D'Accardo and Steve Merchant check over copy for their sections with copy reader Debbi Crane, 5. Dan Dorman seeks advice from Michelle Carroll. 6. Newspaper staff: CFIPONT IPOWQ Christine Cook, Lisa Thomas, Debbi Crane, Laura Ho- gan, Laura Du Amarell, Brenna Newman, CSECOND POWQ Cathy Sannes, Barbara Wil- liams, Elicia D'Accardo, Shawn Posey, Mark Pun yon, Robin Grayson, Holly Merchant, Gina Vega, TBA CK IPO Wj David Horton, Peter Fal- letta, Kirk McCall, Dan Dorman, Matt Peter- son, Steve Merchant, Michelle Carroll, Lisa Vi- las, Poberta Dirks. 7. Quill and Scroll: TFIPONT ROWQ Michelle Carroll, Marlene Youngheim, Julie Martin, Su- zie McGuigan, Laura Gundlach, CSECOND IPOWQ Elaine Tzagarakis, Andrea Dixon, Khris Epperson, Michelle Ocken, Laura Hogan, Lisa Thomas, CBA CK IPOWQ Matt Bowers, Erin Barry, Michelle Dilkian, Lisa Dunker, Lynne Manriaue, Debbi Crane. Newspaper 49 Dedicaiion, hardwork lead To speech SUCCESS by Khris Epperson Led by club Presidenf Nick Pefrulakis and advisor Ken Adair The 4984 Speech Team was an oufsfanding one. Dedicafed and hardworking, The members puf many hours inTo Their speeches. During Augusf The Team sTarTed organizing ideas and facTs info speeches. Once school sTarTed mem- bers spenf hours before and affer school preparing and pracficing Their speeches. One could see The dedicafion in each speech member by The many Team awards won. Doing well in league TournamenTs held aT Davis, Beyer, and Downey enabled sTudenTs To advance To invifafional Tourna- menTs such as UOP, Fullerfon, and USF. These TournamenTs were a sfepping sTone To The naTionals. Veferans su as Nick Pefrulakis, Randy STrauss a Julie Hufcheson were found compe- ing aT The naTionals. Having To finance Their own Tourn menT expenses, The Team held ma fundraisers including a volleyball mar Thon, a rummage sale, and a c wash. l 5 ri 1 l za 52 215. 'I 3 . in sl l, 'fwf 4 AEK T i 7. Speech feam veferan Tracy Warden leads a discussion abouf upcoming fournamenfs 2. Hisforian Healher Beall prepares her speech for a league loumamen l. 3. Firsl year sfudenf Blaine Crismon relaxes before giving a speech. rl. Speech Team officers are Vice-presidenf Robin Ghio, Recorder Carol Gidle y, Secre fary-freasurer Dana Simi and l-ilsforian Healher Beall, nof piclured Presidenf Nick Pe frula- kis 5. Speech Team: CFIPONT ROWQ Blaine Crisrnon, Meri Wy- aff, Sfephanie Howleff, Krisfi Erler, Marci Laughlin, John Anglim, I SECOND RO Wj Kelley Murphy, Julie Hulcheson, Jill Edy, Connie Chrisfodulis, Molly McCormick, Seema Shefh, Krisfi Laughlin, Sharon Brown, Nellie Nazmi, fTHll?D i?OWj Advisor Ken Adair, Dean Galloway, Carol Gidley, Robin Ghio, Dana Slrnl, Heafher Beall, Tracy Warden, Melissa Eng, Holly Skeen, Chris Hanson, Cindy Klein, Amy Warden. P I Speech 21 AFS promofes undersfanding: CSF holds many fundraisers by Sean Byrne American Field Service goT off To a greaf sTarT. AFS was led by advisors Jann Jenkinson and Marion Zoodsma, PresidenT Connie Chrisfodulis, Vice- presideni Janel Blounf, Secrefary Jill Edy, and Treasurer Paul Zoodsma. AFS's main goal was To promoTe inTer- nafional understanding by allowing foreign exchange sTudenTs To live wifh families in America, and vice versa. According To Miss Jenkinson, club en- rollmenf was 45, slighTly higher Than lasf year. The club planned several fun- draisers which enabled fhem To go To food fesTivals and culTural exhibifions. The amounT of money Thaf is involved varies wifh The number of exchange sTudenTs. Money also goes Toward helping American sfudenfs pay for Their way To foreign counTries. Miss Jenkinson said, AFS is for everyone because world peace can only come Through undersTanding. California Scholarship FederaTion, under supervision of Roberf Sfuarf, also had a fine year. Mr. STuarT said ThaT membership in CSF helps To qualify sTudenT for college. Of four courses, member musT have aT leasT 3 A's an one B To aualify. CSF planned To Tak field Trips To places such as UC Berks ley, STanford, Livermore Lab, and Th Lawrence Hall of Science. Fundraise conTribuTing To The acTiviTy fund wer selling valenfines, hof chocolafe, a balloons, and holding a car wash. graduafion, sfudenfs Thaf have bee in CSF for four semesTers or more vv receive life membership pins, cerTi1 cafes, and neck cords. lA 2v 22 Arsfcsr Z ,fu W K X 'V ll! xv 49 , ,g 4 T l 'Z ,,z: , 6:5 A3 V4 Ski club hiTs The slopes by Sean Byrne Ski Club, under The supervision of MargareT Hodge, sTarTed off smooThly. Because a Trip planned for lasT year was noT Taken, The club began wiTh S400 in Their accounl. Led by presidenT Angie BaTeman, sTudenTs meT in The acTiviTy courT monThly and planned Trips To places such as Bear Valley and Kirkwood. Many fundraisers were planned in which members would sell candy and other iTems. Officers hoped To manage acTiviTies so ThaT Those who conTribuTed The mosT money would geT a discounT on The price of Their lifT TickeTs. Through The fun- draisers, Ski Club hoped To Take more Trips Than lasT year. 1. The 4983-84 American Field Service Club. 2, The 498.3-84 California Scholarship Federafion Club. 3. Angle Bateman, Ski Club President talks with friend, Kirn Alonzo. 4. The 1983-84 Ski Club. Actors entertain by Elaine Tzagarakis Hard work, determination, striving towards perfection, and the feeling of accomplishment at the end of a per- formance were all a part of drama. The Enchanted, written by .lean Gi- raudoux and adapted by Maurice Va- lency was performed in November. Hil- lary Spector, playing the lead, was supported by a cast of talented ac- tors. Two actors from Ashland, Oregon, of the world reknown Shakespearean Festival worked with drama student November 22, as well as performing ii an assembly. See's suckers were sold as a fun draiser to attend the lnternationc Thespian Conference in lvluncy, Cali fornia. Thespians are students whc worked 'IOO hours of extra-curricula activities pertaining to drama. Vice president of Thespians, Julie Hutche son, remarked, l'Theatre gives you thi opportunity to literally put yourself i someone else's shoes. lt teaches y to be compassionate. 4. Thespians: CFRONT l?O Wj Lisa Ciraolo, Sharon Drap- er, Tracie Warden, Hillary Spector, Tina Harter, Aimee Shepherd, Da wna Norflee t, TBA CK l?O Wj Shane Wrigh t, Julie Hutcheson, Tom Nipper, Clint Dunbar. 2. The doctor ofThe Enchanted, played by Randy Tarr, sits in a forest, 3. Kevin Graves as the ghost, and Hillary Spector as lssabbel at their last meeting. 4. Todd Cohen. a Shakespearian actor, gives drama students tips on improving their performance. 5. Bobby Roberts and Tracie Warden watch arehears- al of The Enchanted. 6. Kevin Graves reads through his lines before audi- tions. 7. Lisa Bucyen as a little girl. 24 Drama 44 A it w Q FQ '? , miwfxvqikflk, Q5 if wg 5? L Pig Qi Lf? ZLV5 L1 Q , J My 5 ak L Q 4. Dancers raise money: improveTechnicalIy by Erin Barry The dancers became sTronger Tech- nically as well as more aware of Their choreography, remarked Lori Bryhni, dance insTrucTor. CreaTiviTy and dedi- caTion were seen ThroughouT The dancers' work. Along wiTh The annual spring concerT held April 6 and 7, members also puT on Two informal concerTs November lo and January 34. The ChrisTmas program and selling of calendars were fundraisers used To buy a dance floor in April cosTing 84300. The porTable pIasTic floor will be used for The dancers' performances. Professionals in The dance field Paul Taylor, Tami STark, Lar LuboviTch, and , WW. ,, MM Shalleen Bosch held scheduled masTe classes aT lviodesTo Junior College anc in The Davis High gym which man' dance members looked forward To Dance has been very challenging a well as a good opporTuniTy To mee new peopIe, remarked dancer Me lanie MerchanT. F .... i Q 1. Dance PrOduCTiOn.' IFIPONT l?OWj JuUeffe King, Jennifer Broumas, Claudia King, Karla Kopp, Krisi Burk, Julie Hager, CSECOND ROWQ Carle Housew- righf, Diana Norovff, fTHll?D l?OWj Karen Jensen, Regan Miller, Kelly Smifh, Shelly Austin, Ann Z wahlen, Janel Blounf, CFOURTH l?OWj Jenifer Quesenberry, CFIF TH l?OWj Christie Dailey, Jamie Brooks, Jenifer King, Melanie Merchan f, Melissa Ausfin, CSIX TH i?O Wj Heidi Scheuber, IBACK IPO Wj Lori Loveday, Kelh Pi- land, CNOT PiCTUl?EDj Krisfi Erler, Tony Marcum, Kim Turner, 4. Julie Hager and Kelly Smiih skip across The Hoof. 26 Modern Dance 1A :en frafion is crucial for Clauda King and 9 un f. Mora sfrefches while Margaref Sfarck f . A . . arms during their lnfermedlafe dance rnlhg dancers work on a sequence. 'e insfrucfor Lori Bryhni demonsfrafes a fhe production dance class, A3 SpiriT boosTers by Laura Gundlach Looking back in The corners of our minds, we as sTudenTs can almosT hear The vicTory chanTs, counT downs, and The Pep Band. The crowd's voices bouncing off The walls of The gym, and The Pep Band's beaT drilling Through your skull were all parT of proving To ourselves ThaT Davis High was number one. Even Though Pep Band goT a laTe sTarT, They came Towards The end boldly playing The school hymn and fighT song as rewriTTen by DirecTor Gary lvleegan. ln addiTion, rallies were filled wiTh en- Thusiasm. The commissioners, Sarah Goodwin and JuIieTTe King, led The school in numerous cheers, while The cheerleaders enTerTained wiTh humor- ous skiTs and songs. 1 l v5 A2 1. And hhally The masferplece ls Hnlshed! 2. Mike Cassell, second frumpel player from fhe rlghf, seems fo be sayrhg. Lef's see whafs on the other page. 3. Ah enfhuslasflc crowd ls a familiar slghf af all the rallys. 4. Michele Holfoh leads fhe crowd ln a cheer for Davis Hlgh. 5. To increase the sllze and rmpro ve the qualify, pep bend added a flufe secflon. Pep Band And Rally 29 Bond Told: if you believe. by Laura Gundlach lf you've ever been inside The Davis bond room you couldn'T hdve missed The green and gold sign ThaT says l'Da- vis bond has pride. ThroughouT The year aT compeTiTions There have been pride signs To boosT spiriT. My main goal was To geT The dTTiTude and spiriT going again, said direcfor Gary Mee- gan. I wanTed Them To be proud of whaT They were. And They've goT y someThing To be proud of. Never in The h isTory of The band hos The score gone up 43 poinTs in six weeks. Band sTdrTed as The underdog buT wenT on To beaT many of Their main compeTiTors. ul Think The mosT impor- TanT Thing To remember is To never give up. lf you don'T believe in yourself, why should anyone else. Mr. lvleegan never leT band forgeT where They sTarTed, and his lecfures always wenT on To say you've come a long way, buT you're noT There yeT. Everyone in bond ogreed ThaT They wdnTed To be good, buT They learned 5 P ThaT being good wosn'T jusT a firsT place Trophy. Winning has To sTarT wiThin yourself. IT has To be a Team ef- forT, and if you don'T Try you'll never geT There. Band's Theme song was lf You Believe. The words go like This: Believe in yourself righT from The sTarT, believe in The magic ThaT's inside your hedrT, believe in yourself noT because I Told you To, buT believe in yourself jusT believe in yourself, believe in yourself as I believe in you. This is whaT Mr. lvleegan hos ToughT band. 4. Brian Curl and Stephanie l-landley, drum rna- jors, walk off The field proudly after their perfor- mance. 2. During senior half time Gail Goldsmith, Lori Watson, and Anna Martin dress up to be recog- - T nized. 3, By the expressions on their faces you can see that Mike Cantwell, Dan Doyle, and Ken Gotts- . chalk really get into their music. 4. Joanne Wood, Anna Martin and The rest of The Hag girls at right arms. 5. Tamrny Slaven, Debbie Butterheld and Dana Yard get down during concert. 6. During concert, Hill Where The Lord Hides, John Nichols, Steve Giddens, and Brian Curl go wild. 7. Spartan Marching Band: fFl?ONT l?O Wj Cindy Nix, Sherri Mueller, Tammy Slaven, Becky Bowers, Laura Gundlach, Dana Yard Wendy Johns, De- anna Pamprrn, Debbie Leathers, Stephanie Handley, Anna Martin, CSECOND IPOWQ Melanie Hajek, Lyn Cheary, Trisha Slaven, Nichelle Sirnp- son, Wendy Lane, Lisa Richmond Kim Blue, Tena Allen, Shelly Nielsen, Romeo Mejia, Danielle Short, Ui-lll?D l?OWj Joanne Wood, Janet Goldsmith, Cindy Biagini, John Nichols, Dan Doyle, Serena Bales, l?oy Austin, Jeff Brewer, Mark Wright, Brian Perry, Keith Butz, Craig Gundlach, CBACK l?O Wj Shauna Thurman, Tracy Stiles, Gail Goldsmith, Nancy Scott, Karen Santos, Janice Carpenter, Mike Grove, Anthony Blevins, Ken Gottschalk, Phillip Martinez, Frank l?esso, Christian O'Brien, Jim Juhan, Steve Giddens, Denny Jones, Doug Udell, Carol Gidley, Jeff Stone, Lope Jones, l?ick Nunes, Bill Laude, and Brian Curl. Marching BandfFlag 34 24 3' E I I 7v 32 Choir Choir and Orchestra really get moving by Shauna Thurman Orchestra and Choir had all that it took to become even better during the year. Orchestra consisted of ap- proximately 30 students, many of them interesting and promising new fresh- men. Then, too, Nancy Watling said she had some students return who had left her the year before, like Hillary Spector, and Heather Beall. These stu- dents were glad to be back and were excited about being part of something they enjoyed. Orchestra instructor, Mrs. Watling, with Davis 45 years and chairman of music five years, was thrilled about her students. Their main goals during the year were a Christmas performance and CMEA spring com- petition. Something Mrs. Watling would like to see in the future is to get the music department together and plan an activity as a whole group. Choir again was able to have a scheduled period for practice. Direc- 1U tor John Carter's main goal was to really teach how to sing and read notes. He said next year they will work more on the performance and the way they present themselves. Mr. Carter put a lot of stress on individual growth. He said, lt is most important that they enjoy it and have a good experience with it. Singing in front of people wasn't easy, so Mr. Carter gave them a wide variety of music so that they felt comfortable. l. Now where did l put my music , is what Xi- mena Delgado seems to be saying. 2. Choir looks over their music before they begin their number. 3. Hi Folks! 4. The numerous violins in Orchestra. 5. Lope Jones is careful to play the right part. 6. Mr. Carter tickling the ivories. 7. Laura Maclellan watchs Mr. Carter for the cue to sing. 8. Heather Beoll displays her talents. Orchestra 33 al' V I P sibdaq r XMB! S Club serves by Khris Epperson WiTh The new poinT sysTem, S club members were moTivoTed To become more involved wiTh Their communiTy, sToTed enThusiosTic vice-presidenT Debbie lvloxwell. By becoming more in- volved wiTh Their communiTy, members received poinTs which enobled Them To oTTend The yeorly Asilomor confer- ence held in April. WiTh more members Thon ever, US club worked TogeTher To occomplish more communiTy ser- vices. These services were Thdnksgiv- ing boskeTs for The needy, core pock- oges for The elderly ond resT homes visiTs. YW A iikgygypvz 3 F 1. S Club members discuss ideas about Asilomar before making a flrlCJl decision. 2. Key Club President Chris Bradley leads a dis- cussion about Ke y Club 's successful Masquerade Ball. 3. S Club Ofl7C9fS.' fFl?ONT IPO Wj Vice-president Debbie Maxwell president Katrina Van Waltrop, Secretary- treasurer Melanie Merchant, C SEC - OND POWQ Asilomar advisors Elaine Tzagarakis and Erin Berry. 4. S Club members discuss selling Nachos at the November 14 game against Downey. 5. Key Club officers are Betsy Goodrow, Presi- dent Chris Bradley, Vice-president Paul Zoodsma. Not pictured Secretary- treasurer Heather Beall. 6. S Club! CFRONT RO WQ Dana Simi, Khris Epper- son, Holly Merchant, Melissa Eng, Marci Laughlin, Kristi Laughlin, Becki Howes, Christine Tzagarakis, Marci Bakker, Mary Cassie, Barb Howes, Yoko Kabashi Misook Kim. CSECOND IPO Wj Debbie Maxwell, Michelle Ocken, Katrina Van Walterop, Margaret Stark, Dawn Pratt, Laura Stal Nellie Nazmi, Lisa Goldberg, Regan Miller, Karla Kopp, Stacy Hanway, Devon Orland, Julie Hutcheson, fTHll?D l?O Wj Annette Ledoux, Stefanie Han way, Pam Graves, Michelle Dllkian, Amber Smith, Me- lanie Merchant, Merrin Orland, Marie Prasch, Leigh Loeffler, Michelle Blue, Sylvia Ciccolo, Joy Flannery, Elaine Tzagarakis, Erin Barry, Chris Han- son and advisor Chella Gonsalves. 7. Key Club: CFIPONT POWQ Troy Javaher, Sherry Stearns, Bev Brewer, Kelli Piland Claudia King, Julie Hager, l?ene Anderson, CSECOND PO W1 Amy Salter, Holly Skeen, l?ich Howell, Paula Carter, Todd Priest, Paul Zoodsma, Chris Bradley, Shannon Haub, Amy Halley, Leigh Loeffler, CTHIPD IPO Wj Serena Bales, Cindy Klein, Dawn Edwards, Billie Ripley, Gina Corgiat, Carmen Stevenson, Jennifer Quesenberry, Betsy Goodrow, fFOUl?TH POWQ Marie Prasch, Lisa Thomas, Molly McCor- mick, Janel Bloun t, Corie House wright, Lisa David, Linda Paradis, Scott Weiss, Seema Sheth, Dan- ielle Lamkin, Jill Hagopian, Noelle Lane. Sandra Scholten, Debbi Crane, Sonal Sheth, l?ich McNabb, and Kelli Smith. mm? Members unite by Khris Epperson organization. With such successful school activities as the Hawaiian Bash and Masquerade Ball, Key Club members were able to contribute time and service to local charities. Members were also busy pre paring for the annual Finance District Convention held in Anaheim. Key Club President Chris Bradley, Vice-president Paul Zoodsma, and Secretaryftrea surer Heather Beall spent time prepar ing for convention. Club membership was around A5-50 students, slightly higher than last year. Besides their own charity service, Key Clubbers were also affiliated with the local Kiwanis Club, and took an active part in that Preparing Tor The TuTure by Lynne Manriaue VICA members began preparing early for The annual VICA Skill Olym- pics, a compeTiTion of indusTrial skills. Candy bars were sold To reduce The, cosT of sending members To The re- gional compeTiTion in Redding. Led by PresidenT John Cahill, Vice-presidenT Kris Puccinelli, Treasurer Brian STiIes, SecreTary Mary Dufion, ReporTer Dave Thompson, Parliameniarian Kelli ShuTT, SergeanT Rayme Gardner, Chaplain KrisTina HinTon, and advised by Tom Weber, VICA provided sTudenTs op- porTuniTy To improve vocaTional and leadership skills. Advised by Rick and Debbie Herr- mann, DECA also goT off To a fine sTarT. Various meThods of fund-raising, such as selling candy, Taking invenTories aT local sTores, and working aT The Deli were used To allow members To ai Tend DECA conferences. CompeTiTion in apparel and accessories, financi and crediT, general merchandising adveriising, food markeTing, food ser vice, peTroleum and resTauranT man agemenT were held aT The regionc level in lvlodesTo, aT The sTaTe level ii Los Angeles, and aT The naTional leve in Kansas CiTy. L 1. Maggie Denson cheerfully news a customer af The Deli, where DECA members are working To earn money for conferences. 2. DECA officers: Sociai commifiee chairperson Barbara Baker, Treasurer Joe Wong, Secretary Maggie Denson. 3. VICA: CFRONT RO WQ Tom Weber, John Cahiii Mike Siockdaie, Laura Gundiach, Sonya Spencer, Suzie McGui- gan, Lisa Dunker, IBA CK i?O Wj Mari Hansen, David Kumar, Chris Skeen, Keiii Shufi, Kris Hinton. 4. VICA advisor Tom Weber fakes nofes ar a December VICA meefrng. so vicAfDEcA FFA acTive by Lynne Manriaue Members of FuTure Farmers of Amer- ica expecTed To be kepT very busy wiTh acTiviTies. Besides The annual FFA chicken dinner, members prepared To aTTend compeTiTions. Their firsT was in OcTober, wiTh a second following in med-December. In These conTesTs, FFA members compeTed againsT oTher schools in areas such as public speak- ing and creed reciTaTion. OThers were on Three sTudenT Teams which judged livesTock, horses, vegeTables, poulTry, and handling of farm machinery. On The school farm, FFA members puT much efforT inTo raising and breeding hogs, sTeer, and sheep. HorTiculTure was also an imporTanT parT of FFA ac- TiviTies, wiTh members raising pumpkins for Halloween and caring for planTs in The greenhouse. A1 2V v3 . - ,,,, ,ri I Z , 5 l l. FFA: rFl?ON7' ROWQ Danielle Shari, Chris Bus- se y, Ellen Sanders, Tim Fitzgerald, Spencer Sand- ers, rSECOND l?OWj Greg Doorneward, Gene Allemandi, Debbie Barner, Slefani Abernalhy, Denise Bello, Sfacy Hall, KBACK l?O Wj Sieve Le- couve, Nickle l-lay, Jeff Reed, Dino Welch, Sian Cook, 2, S Te ve Lecouve and K un' Moeller lend The bar- beque af The FFA chicken dinner while Nickle l-lay, his fafher, and Roger Dickson wafch in The background. 3. FFA Ofncers: Secretary Brian Aguirre, Vice- presidenf Danielle Shari, Reporier Ellen Sanders, Presidenf Chris Bussey, Chaplain Wall McClesA key, Treasurer Jeff Wilson. Nor pictured: Senfinel Suffon Price. FFA 37 Chess moving along: French begins greaT by John Guerrini Chess is less Than life: buT, menTally speaking, iT's much more Than life. ThaT's exacTly whaT Chess Club mem- bers and advisor RoberT Raingruber felT abouT The game of chess. Because of The members' inTeresT, The club meT as ofTen as once every week. 'll love The game, and I like To Teach iT To The sTu- denTs. The sTudenTs seem To enjoy iT, remarked lvlr. Raingruber. Chess Club planned To play againsT ModesTo High School Chess Club, and The l?oosevelT and La Loma clubs. There exisTed a possibiliTy of compeTing in a sTaTewide TournamenT. There are no elecTed of- l 'IA 1. Aaron Budgen decides if he should move his queen to checkmate his opponent. 2. Part of the Chess Club watching an ongoing game between Rob Surber and Eric Vaughn includes Advisor Robert Raingruber, Rob Surber, Mike Johnson, Paul Cadrett, Bill Harter, Eric Vaughn. 3. French Club: fFl?ONT ROWQ Gregg Sprinkle, Dianna Bloom, Jeff Overlie, Michele Moura, Sandy Fields, Jangt Goldsmith, Tonja Lee, Muriel Rameho, Kavita olanki, Jill Hagopian, Julie l?o- senthal, C SECOND l?O Wj Denise Padgett, Brenda Cox, Judy Ciccarelli, Bina Solanki, Jean James, Stacey Dossey, Jule Hutcheson, Aimee Shep- herd Robert Short, Ximena Delgado, Victoria Flores, LelghAnn Loefller, Beckie Hiatt, Martha l?amer7o, Eicia D'Accardo, Becky Bowers, Tai Lam, CBACK IPOWQ Shannon Bayard, Robin Campbell, Paul Chin, Tami Blanchard, Sherry Rice, Manjeet Singh, Susan Chastain, Candice Catarino, Joy Flanery, Kim Edwards, Mike Gil- more, Cherlse Brunswick, advisor Jenise Javaher. 38 Chess fFrench ficers. The sTudenTs don'T need offi- cers, They jusT wanT To play, said lvlr. Raingruber. He also felT ThaT There should be more sTudenTs geTTing in- volved in The club. French Club was a new club on The rise. The club's firsT meeTing was aT- Tended by an amazing 60 people. The presenT enrollmenT is 54. For The firsT year of a club, There was overwhelm- ing inTeresT - which surprised me! said Julie HuTcheson. The club was headed by PresidenT Julie HuTcheson, Vice- presidenT Tina HarTer, SecreTary Sherry visor Jenise Javaher and a few sTu denTs because They ThoughT ThaT i would be inTeresTing. The sTudenT learn abouT The French language ani France, and iT's inTeresTing, said Joy Problems This year included no enough money, and no previous ex perience. They planned To go on 1 culTural Trip To San Francisco, whicl would include food and special exhibi Tions. Also planned were a ChrisTma parTy and dinnerfdance, and forma Tion of a special senior scholarship func To benefiT members of The club wc Rice, and Treasurer Joy Flanery. Offi- cial TiTle of The club is The French Con- necTion. The club was creaTed by ad- discussed. v5 vb g nv '. A year at accomplishments for Art Club by John Guerrlni Art Club was the result of the hard work of a small group of individuals, said advisor Henrietta Sparkman. Art Club did many things this year. The club got along fine despite an enroll- ment of approximately '15 members. But, what we lacked in numbers. we made up for with talent! Art Club was a very diverse group of individuals, remarked lvlrs. Sparkman. Art Club was run by joint president and vice-presidents Scott MacDonald and Shannon Crace, Secretary Cruz Alvidres, and Treasurer Eddie Garcia. Art Club went to San Francisco to see the Vatican art exhibit, and they went on many trips to local art galler- ies and artist's studios. They planned to publish a calendar for the 4984 year. They also silkscreened shirts and paint- ed Christmas scenes on windows as fundraisers. Most of the money re- quired was supplied by members, but what money they made, they used. The major problem was getting enough members to attend meetings and participate in club projects. A club is only as strong as its members are, said Scott. Art Club usually met before school at least twice a month. Cruz felt that, Overall, Art Club was successful due to a lot of good ideas from members! 4. Art Club: Kelli Shutt, Tino Horter, Steven Orl- que, Cruz Alvldres, Eddie Garcia, Scott MacDon- old, 5. Steven Orlque checks some notes on the col- endor mode by Art Club. 6, Adviser Henrietta Sporkmon keeps Art Club tiles orderly and up-to-date. Art 39 40 515 UIQ Wh' 4 4. Tools of The lracle, 2. Sporfon vorslry offensive line. 3. Wafer polo goalie Rob Larsen blocks o shot A. Cross country runner Joni Williams breezes fnrougn lnree mlles, ' Uswanna 5. Sp orlon D GMES T l r rfr -A parians Take ' To The semis againsT 'racy by Jamie Noff The 83 SparTan varsiTy fooTball Team was going afTer a fourTh sTraighT CenTral Cali- fornia Conference TiTle, buf came up Two wins shy of The crown. When asked how he feIT abouT The season, head coach Don Lanphear said iT was 'Ta very good learning experience for boTh sTaff and players. In non-league play SparTans posfed a 41- 4 record wiTh wins againsf PiTTsburgh, Cen- Tral, ModesTo, and Oakdale: The only loss came againsf Lincoln in The season opener aT Downey. The firsT league game wiTh ATwaTer was supposed To weigh heavily in The deciding of a new champion. BoTh offense and de- fense showed flashes of excellence, buT soon died ouT Tp posT a 26-0 loss and whaT seemed To be The end of The Sparfans. Things looked dim, coming off a big loss. The auesfion was could Davis regroup and make a comeback To salvage whaT ap- peared To be a disasTrous season. The an- swer was yes. Regrouped The Team Took on Beyer and ripped Them 28-0. Coach Lanphear was pleased wiTh The way his Team performed and said, IT would have been easy To fold up, buT we came ouT here and had an ouTsTanding perfor- mance. IT appeared The Sparfans were sTarTing To geT going once again and ThaT They jusT mighT have a chance for The TiTle, buT The nexf week proved Them wrong. Merced came in wiTh a deceiving 3-3 record To play Davis. Bofh Teams unleashed Their of- fensive fireworks To combine close To 600 yards and 52 poinTs. WiTh less Than Two minufes lefT, The Sparfan offensive uniT rambled for 80 yards Trying desperafely To puT iT in for six and Take The vicTory home. The Sparfans were held back wiTh an en- croachmenf penalTy and had To seTTle for a score of 28-241 in favor of Merced. Affer a hard foughf win agoinsf Turlock, The game many players had waiTed for was To come. The opposiTion, Downey, had beafen The SparTans The previous sea- son knocking Them ouT of The playoffs. For The Sparfans This meanf gaining Downey's respecf and geTTing revenge. Downey, headed by ex-Davis assisTanT coach Nick Chip Cipponerri, came inTo The game sporTing a 'l-8 record, buf once again Their record was very deceiving. The Knighfs jumped To a 6-0 lead on a screen pass ThaT wenT for 415 yards. Davis answered righT back wiTh a 77 yard drive ThaT led To a Two yard plunge for six. The PAT was successful and ThaT puT The SparTans up 7-6. Downey Took The ball To The Davis five yard line only To be Turned back wiTh a defermined goal lined sfand, and had To go for Three buT The aTTempT was blocked. Quarferback Dan STarck's Two Touchdown passes To Jeff Luna and George C-reen made iT 24-6. Lafe in The half, kicker Todd Tuggle puT one Through The uprighTs for Three and ThaT made iT 211-6, Davis. The Davis Sparfans received a berTh in The playoffs afTer a coin flip ThaT decided a Three way Tie for second. The Sparfan flip resulTed in a game wiTh Tracy, played aT Tracy's own Pefer B. Kyne field. The game ThaT so many people had waiTed for had finally come. lT was The very firsT meefing befween The Two Teams and. hopefully. noT The lasT. Tracy scored in The firsT auarfe by capping off a 59 yard drive for 6 an The conversion was good which made iT 7 0 Tracy. Midway Through The second auar Ter a blocked punT was Turned inTo Touchdown ThaT made iT 'lA-0. An inTer cepfed screen pass ThaT was run back 6 yards for a Touchdown in The Third auarfe puT The game ouT of reach for The Spar Tons. Despife a 24-0 loss The SparTan played one of Their besT games offensivel and defensively. Defensively The Sparfan held Tracy To more Than 'l00 yards unde Their usual performance, and offensivel had many plays called back ThaT woul have made The game closer or mighT hav even changed The oufcome. Compared To oTher offenses, The Spar Tans as a whole came ouT average, sTaTis QConTinued on page 41 1, Junior receiver Doug Tackeff in mofion. 2, Tariback Ray Lankford is on fhe run againsr Downey, 3. Doug Tackeff makes fhe caich no maifer whaf. 4. The Sparfan Hawgs in the trenches. 5. Quarferback Dan Sfarck Leis one go, 6. Varsifyx KFRONT ROWQ manager Roy Contreras, Curr David, John Ca- dreff, Brian Jarman, Scofi Jackson, Bre if Waii, Greg Baroni, Gabriel Suarez, Sian Siiverra, Mark Yosf, manager Sie ve Rash, CSECOND RO Wj Pau! Alves, Richard Sfepanovich, Chris Bunch, Todd Tuggie, Darrin Abby, Louie Trio, Mike Hussey, Kenny Newman, Scoff Thomsen, Raymond Lankford, John Whaia, Mike Schnieder, CTHLRD RO Wj coach Harry Guaico, Randy King, Jon Raffazzi, Mark Cordre y, Louie Padriia, Mike Pifcock, Frank S rice, Larry Baker. Bob Pickeff, Troy Javaher, Jose Pinto, George Green, Troy Boufeiie, Gar- neff Founfarn, coach Larry Johnson, CBACK ROWQ coach Dan Gonsaives, Rob Taro, Roberr Price, Dan Starck, John Lacey, Jeff Luna, Craig Lyons, Scoff Weiss, Jerry Saunders, Jamie Noir, Chris Cariilo, Dan Souza, Pepe Becerra, Doug Tackeif, Mike Lawson. head coach Don Lanphear, Varsify Football 413 QConTinued from page -4125 Tics wise, buT had players who led The con ference and even The disTricT. ln The rushing area Davis' Raymond Lankford had 483 aT TempTs and Q08 yards. Passing for The Spar- Tans was Dan STarck who Threw for 4,545 yards and 'lo Touchdowns. His favoriTe re- ceiver, junior Doug TackeTT, caughT AQ passes for 7112 yards To lead The disTricT ir receiving. Linemen who gave STarck The Time To Throw and helped Lankford geT his 908 yards were Jamie NoTT, Pepe Becerra, Larry Baker, John Lacey, ScoTT Thomsen, Mark Cordrey, Rob Taro, and Craig Lyons. OTher Top receivers who had recepTions were Jeff Luna, Darrin Abby, George Green, and STan Silverra. Richard STepano- vich, Mike Schneider, Jose PinTo, and Mark YosT came in and goT some Tough yards when The SparTans needed Them. Troy Ja- vaher did a good job backing up Dan STarck during The course of The season, and junior Todd Tuggle was second in dis- TrlcT kicking field goals. The Sparfan defense held opposing Teams To an average of 4417 yards rushing and 403 yards in The air. Sfand ouT linemen for Davis were ScoTT Weiss, Jerry Saunders, Mike Hussey, Jamie NOTT, Pepe Becerra, ScoTT Thomsen, Mike PiTcock, and Floyd SlaughTer. The Iinebacking corp was excel- lenT This season wiTh players like GarneTT Founfaln, Jose PinTo, John Lacey, CurT Da- vid, BreTT Wall, and Darrin Abby. Defensive backs ThaT were around The ball a loT were Jeff Luna, Louie Padilla, and Doug TackeTT. Two major sTaff changes This season were due To Cipponeri going To Downey. Coach Larry Johnson was moved up from The sophomore Team To coach running backs and corner backs, and Dan Gon- salves came ouT of reTiremenT To coach auarTerbacks and linebackers. Coach Lynn Zwahlen coached receivers and deep backs in his spare Time, and regular varsiTy coach Harry Gualco Took The receivers and deep backs when he could. Head Coach Don Lanphear coached boTh offen- sive and defensive lines. Coach Lanphear sTaTed, We finished The season wiTh a much improved Team. This group Turned ouT To be much more dedicaTed Than I anTicipaTed. When asked abouT playoffs he commenTed, I Thoughf we made a posiTive showing in playoffs. 'Q' I 1, The Sparfan defense in action. 2. A vrew from afop. lnsef- Varsify head coach Don Lanphear. 3. Coach Harry Gualco informs Breff Wall. 4. CurfDav1dl1Sfensinfenfly fo Coach Dan Gon- salves on the sidelfne. 5. Some of Davis' Hawgs, Larry Baker, Jamie Noff, Pepe Becerra. Sophomores have difficulT season by Suzie McGuigan I feel disappoinTed in The facT ThaT The Team didn'T have a peTTer win-loss record, puT considering all circum- sfances from week To week I feel ThaT There was a IoT of improvemenT made in bofh aTTiTude and abilify was The reply from head coach Jerry Houser when asked how he felT apouT The season overall. DespiTe a grim I-7-2 record, The 83 sophomore SparTans were proud of The facT ThaT when Their pride was on The line They pulled TogeTher To give The lasT place finish in The CCC To Tur- lock. Offensively The Sparfans ac- auired poTh Their firsT win and pesT game againsT Turlock. NoT only did auarTerback Mike Lawson have his besT day passing againsT The Bulldogs, puT The Davis ground aTTack moved The pall well, The offensive uniT scored four Touchdowns buT Two were called back due To minor infracTions for a final score 'Ill-I2 Sparfans. Coach I-louser sTaTed, T'Our pesT defensive game of f W I T ,, , , , piiiiss , , w in an WW! I , , ' Wfmmww K' The season came againsT Merced where we shuT down HerscheI. The mosT disappoinTing loss of The year came in a game where The Spar- Tans were piTTed againsT cross Town rival Beyer. AT halfTime Davis led 7-O, buT by The fourTh auarfer Beyer had scored 'II unanswered poinTs To posT a hearTbreaking II-7 loss ThaT wenT righT down To The wire. Players like Mike Lawson, Mike Nar- anjo, Bill Devore, Mark Bargas, PeTer Adamakis, and Kevin Brisco made Things happen offensively when They were on The field. Defensively Kevin Kelly led The Team in Tackles and Greg BenneTT headed The defensive pack- field. Team capTains were CurTis Colvin and Naranjo. Summing up The season Houser said, I had a real good feeling apouT The season. I Think The players had fun and a loT of players goT To parTicipaTe in each game. I was pleased wiTh Their aTTiTude and desire, and as a coach you can'T ask for much more. . , ,,,,, , ,,, Sophomore Foofball: KFRONT l?OWj Ron Gunn, John Saras, Lopez, Greg Benneff, Jeff l?ile y, Brian Krigbaum, James Hayes, Cooper, Paul l?avelli, Sian Cook, CSECOND IPO VVQ Coach Jerry Danny Bispo, S fe ve Schneider, Jim Sproff, Jeff Overlie, Mike u u Curfis Colvin, Todd Sleeman, Poberf Barnes, Sean Buchanan, Bi don Presfridge, Ui-lll?D RO Wj Kevin Gunn, Kevin Pellefier, Mark gas, Kevin Brisco, Kevin Kelly, Mark Henson, Scarf Sherman, Adamakis, Eric Clark, Bill Devore, Ted Nicolls. P4 Greg Benneii carries five boil down ihe field. Mike Noronjo is our of reach. Coach Pick Ebsfer gives o defensive signal, Robeff Eames goes for fhe iockle. We 're offer you! wwf, Sophomore Foofboll 117 , : , Q5 1 JZ N , ff ,Y A W! 'SH yi E 2 W llfff A 1' W W 5 1 f ff 2 s 2 , 1 X 4 ff ff f W 1 Mi ,,,,,.. fi f W V,,, M ,,,,, ,,,, . ' Q ,, ,, X , , U,, E 2 f 4 A -41 V V 125' wf,,,,',-2? sf f Z ie sffs fy 9 WW BW ,Q H 2 QW 5 waz! . 5 ,p,,f,,,yWf ? :' WZ W K ggg, 552 ,,,,A EQ 4 E Ez 1 KM? . 457' 2 5 if is K M ,,, 2 ,f .K Z Hx .SW H SV ,ag - X, ,.. X ff 4,5221 f if 5, gm Z K Aww A UZ . iz ,ff , 5, , ww ,Z X , X, 'WWW ? A Frosh 1. Running back Benny Postley makes yardage. 2. The freshman unit huddles up. 3. Spartans celebrate their victory. 4. Words of wisdom from head coach Dwayne Westphal and assistant Jerry Shuman. 5. Benny Postley is hebed to his feet by his line. 6. Chico Robles displays his moves. 7. A look down the line. 8. Freshmen: rFl?ONT l?OWj Wade Carper. l?hys Panera. Brian Shockiey, Craig Gundlach, Brian Beck with. Chris Marckese. Vanseng Prom. Billy l-larris. Tim Robinson, Stacy Courtroul. KSECOND l?O Wj Coach Scott Hardman, Steve Lindsey, Mark Williams. Chico Robles, Jeremy Fallauist. John Chituras. Jody Atkinson, Mark Holmes, Eric Dixon. l?ich Prasch. Brian Howe, rTHll?D l?O Wj head coach Dwayne Westphal. coach Bruce Emerson, Brad Z wah- len, Brian Ferguson, T.J. Wiggs. Sean Pickett. Mitch Zak. Phillip Martinez. Ste ve Giddens. Mike Barnes, Miguel Tapis. Jim Brown, IFOURTH l?O Wj Mark Nelson. Aaron Hamilton. Craig Klopatek. Charles James. David Epps, l?ich Telford. Mike Gergiamnakis. James Denino. Chance Williams. Eric Sharar. KFIFTH RO Wj Brian Hobbs. l?on Owens, Brian Cody. Benny Postley, Preston Kraft. Allan Hodge, Allan Davis. Corey Bayless. Pay Johnson. Nathaniel Lambert. gain title with 5-2-4 by Jamie Nott The key to our conference champion- ship this season was team unity, said head coach Dwayne Westphal while summing up the season. The Spartan freshman team came away with a 5-2-4 record and a .625 winning percentage to share the CCC crown with Merced. During the season the Spartans found that when they were men- tally ready they had no problem in crushing their opponents, but when they weren't, things went wrong. We weren't mentally prepared against Merced. and it cost us the outright championship, were the words of coach Westphal talking about his costly loss to Merced. Once into the season the Spartans found that running the ball was the key to making the offense go. This was proven in a 34-49 victory over Downey which included 220 yards gained on the ground alone. In the same game Davis' first defensive unit held the Knights to only seven points. The Spar- tans probably had the best pass defense ID the league having forced 46 interceptions in the eight game season. Offensive standouts were linemen John Wheeler, Eric Sharar. Ron Owens, Brian Cody, and Aaron Hamilton. Responsible for the ground attack were running backs Benny Postley, Darrin Horne. Tai Lam, Andy Carvahlo, and quarterback Mark Nelson. Receivers who also gained honors were Brad Zwahlen. Chance Williams, and Chico Robles. Defensively the Spartans were led by linebackers Cody. and Carvahlo, line- men Owens and Terry Wiggs. and defen- sive backs Vanseng Prom, Zwahlen, Nel- son. and Robles. Freshman this year were coached by head coach Dwayne Westphal. assistants Bruce Emerson. Jerry Shuman. and Scott Hardman. Westphal was pleased with his assistants and said that they did a great job and put in lots of work to help the team reach their goal of gaining a conference championship. Freshman Football AQ Girls Tennis remains smashing by Kaffe Harmon Davis High girls Tennis Team had a 42- 3 league record losing only To Beyer High. During The CCC championships Davis l-iigh's number one player, CiCi Barbe advanced To The secTionals by beaTing Beyer High's Beih Conmy in a Tough Three seT maTch. Doubles Team KaTie Harmon and Stephanie Brolz also advanced, Topping Beyer's BeTh Conmy and Tracy Veniurini, 6-2, O-6, 6-4. Even Though Davis losT Three Top var- siTy players lasT year, They sTiil re- mained hopeful ana were expecTed To do well in secTionals. Seciionals were held in November aT Wesi Lane RacaueT Club in STockTon, where The l if il Top Two singles and doubles Teams from each division compeied. Cross counTry Takes league championship by Sean Byrne AlThough a large number of runners Turned ouT for The cross counTry Team, The SparTans had a promising season. The varsiiy boy's Team had seven runners led by sTandouTs Craig Sawyer and Frank CasTro. They finished ouT The season wiTh an ouTsTandlng second place, A-'l record in CCC. The junior boy's Team of Troy Gray. lvlarTin Paularena, Wade Cox, RoperT Reynolds, Dean Bowen, and Sean Byrne Took a Tri-championship in The CCC wiTh a record of A-T. The sopho- more Team mainTalned Their repuTa- Tion lay Taking a league championship. ConTribuTing To The Team were ouT- V5 vo v7 sTanding runners VihcenT and Vicior Vieyra. Freshmen finished in a Tie for Third place. VarsiTy girls finished wiTh a 3-2 re- cord. Leading Them To a Third place sTandlng were runners Alix Tubman and Chrisiie Earle. Frosh-soph indivi- duals ThaT finished impressively were Tammy Weiss and Vicki VisTe. l. Davis High 's number Three player Stephanie Bralz shows good form. 2, Freshman Beisy Harmon hlrs an aggressive forehand shof. 3. Girls' Tennis: Sfephanie Bratz, Kalie Harmon, Befh Pose, Clci Barbe, Coach Darryl Torre, Jenni- fer Gregory, Jennifer Masciorlni, Laura Filbph Mrs- ook Kim, Betsy Harmon. 4. Cross Country: CFIPONT l?O Wj Doug Jusi, Mike Barnes, Tim Ogden, Dwyane Canrwel, Jeff Bakker, Jamie Gelsimino, Les Robbins, Blaine Cris- rnan, Vincent Vieyra, CSECOND ROWQ Vicfor Vie yra, Jim Lane, Tro y Gray, Dale Rinehart, Larry Elam, Brenf King, Paul Wilson, Dean Bowen, UHIIPD IPO Wg Vicki Vlsfe, Angela James, Michelle Naranjo, Alix Tubman, Karen Ransome, Frank Caslro, Tammy Weiss, Jonle Williams, Mariin Pau- larena, Chrisfie Earle, Randy Bakker, rBACK l?OWj Craig Sawyer, Jim Wall, Rick Jennings, Marshall lngels Ton, Jesse Bashar, Kirk McCall, Leo Gallagher, Mark Nelson, Robe-rl Reynolds, Sean Byrne. Wade Cox. 5 Davis cross couniry runners sian' The sprint. 6. Aix Tubman, Christie Earle, and Joni Vwlliams Take Their warm-up jog. 7. Jeff Bakker slriales our To The Hnish. A , ,, k VW ,511 -I . ,f gs, f, T, fs ff 4 V, sq fig 'f s TK ,fs Cross CounTry 54 ,VW l, ln an aflempl lo keep The ball from going oul of bounds, Tina Jiminez runs fo nil fhe ball, 2, Monica Hellon blocks fhe ball la wrap up an- alher ,ooini againsl Downey 3, After selling the ball Michelle Hollon recovers from a fall. 4. ln a lime auf, varsii y coach Bernie Finley offers suggeslions aboul improving communicafions on The courl, 5. JV Volleyball: lFl?ONT RO Wj Serena Galeazzi, KSECOND IPO Wj Kim Hume, Lisa Vilas, K arry Cami- leo, CTHIRD RO Wg Racauel Cruz, Monica Hellon, Tina Jiminez, Trina Jiminez, KBACK l?OWj Karen Moore, Anila Parker, Marilyn De w, Melissa Leiiner, Margaref l-lodge. 6, Varsily Volleyball: CFRONT ROWQ Paula Ealon, Pam Ealon, Dlonn Marlin, lwchele Holion, Licla K K' i c? ,,,,, I f , ' if . ,, , ML ' 'fjilqfi , 'ZH' iqlilfi WWWEL-,yy ff ' 5 , 2 'iii TE 'LEVi f'f: 'I' W - 'f' ff' f i f f f E' :YW -ww' W ' I -V .. H V? , I , ' :JW ' M- ' , f - fig ,Simi HH ' ' , . ' ' -'rw mf K ---' fi Qfaiiif'.:w:,i.L,i,if'1f,i,g'ip W ' ff,.,-,Q ,wC,ueWw 'i Pope, KBACK l?OVVj Pam Kenyon, Jackie Krall, Amy Salier, Bernie Fmley, 7. Paula Eafon prepares for a serve againsl Tur- lock, ,ft ,ii WW c iiii il f?? Wi' I S1 x ' rl. E W 7 Q2 J ' --Q ' ...W s - S ,'k' , T 1 iw m 3 Af . 6 ,, f 4 9 fa g E24 r E5 sg V J r f -, rr . wi f,,-,ff M, f ., . W,y,,.,,,, .. ,. k,. .. ,,,, ,f .1 ' if M A V . 7 ,,, W.. gf' . www- . My Volleyballers bump, seT, spike by Anifa Parker Even Though varsiTy volleyball Team had six wins ouT of 45 games, accord- ing To Coach Bernie Finley The girls were a close Team and played well TogeTher. Overall They came in fourTh place in The league and were ciTy champions. Alfhough all were fine players, The Team elecTed Michele HolTon MosT Valuable Player for her excellenT seTs and spikes. Jackie KrafT was named OuTsTanding Spikerg Licia Pope was named OuTsTanding Server and Paula EaTon was OuTsTanding Defensive Player. JV Team also placed faurTh in league. They had eighT wins ouT of 45, beaTing The second and Third place Teams, Merced and Turlock. Coach MargareT Hodge sTaTed The sTrong poinT on The Team was serving. JV was also ciTy champion. The Team chose Monica HelTon MosT Valuable Player because of her accu- racy and aggressive play on courT. Melissa LeiTner earned MosT InspiraTion- al: AniTa Parker, MosT Improved: Tina Jiminez, BesT Offensive Player, and Marilyn Dew, BesT Defensive Player. Volleyball 53 K., 11 3 3 L -,f. Q 3 f i M 5 I ,Mm K ig 5 6' ,. 5? ,,. V L, , ., ww' ' ,WW V All v6 v Vofsify Wdfer Polo 55 Frosh-Soph flooT, Girls reign by Geoff Sprinkle The boy's frosh-soph woTer polo Teom hcid o disoppoinTing yeor, end- ing The seoson wiTh o record of 11-'l6. Mony sophomores, including field ploy- ers Poul NorquisT, RoberT Lynch, Croig Peorson, Mike Woodward, ond goolie Poul Nelson will oTTempT To eorn vorsiTy posiTions nexT yeor. Sophomore sion- douT Norquisf sold, l'Our cooch, Tim Holley, on All-Americon pick who ployed for Dovis High School, wos o greoT inspirclTion. AlThough mony sophomores ore moving up nexT yeor, There were o few ouTsTonding fresh- men who will leocl The Teom in The foil. VorsiTy girls wofer polo Teom hod o very good seoson This yeor, wiTh on overoll record of 'IA-7 ond second ploce in The CCC. The Teom did peTTer Thon expecTed ond ended The seoson wiTh The second besT record ever. Seniors Michelle Corroll, Jonell Niemi ond goolie Jennifer Doy led The Teom. Two seniors enTered Dovis' record books This yeor. Michelle, firsT Teom CCC ond MVP, become oil Time leod- ing scorer for girls woTer polo wiTh 68 gools, ond Jonell firsT Teom CCC, be- come Third oil-Time leoding scorer wiTh 39 gools. Cooch BrenT Bohlender wos very pleosed wiTh The girls perfor- monce ond opTimisTic obouT nexT yeor's Teom, 56 Girls WoTer Polo Jennifer Day fhrows the ball fo a teammate. The frosh-sopn wafer polo fe-am, Goalie Jennifer Day blocks an opponenfs shof, Girls Wafer Polo team: Michelle Carroll, Angie vfeman, Janell Niemil Amy Halley, Hanna Sk yaffa, ura Hogan, Cindy Klein, Suzie Torre, Karen Miller, nnifer Day, Susan Peferson, Shannon Hendricks, ydcey Friedman, Melissa Bradley, Jamie Hume, vrisfie Olinares, Laura Lamberl, Sophomore Mike Woodward grimaces while an aponenf blocks the ball. Sophomore sfandoul Paul Norauisf makes a shof the goal, Sophomore Amy Halley baffles an opponenf for e ball. VV , , ,,,.,,, y , ,,,, V J,, leaf H , :,.,, ,,1...n may , ., 'V VV5'-i4EiVzJuV VL -if-' -WJ V, .au W. www 1 , A2 5 4 .2 V V, is if 5 V --A -N T' 'Www .J 5KZi'iHkfNfQQIiV my M 27 V V, - S tif. tw V W'fwV lf' i WW-V,rf rr V 1 ' .V '- Vs MVVMW n2,affIa1T 'Mf V 'l ,,,, , if V Mk Vw VV ' V ,,:,eV ,s,V,,, V ,,,, ,V ,V ,s,,, , , ' , J lim' ,, 'Emir Jfiri' V, i,iZflW1?' I' ,- , 4- V' rw ' .,f V mere, S -f , WJ-fr V. f 'V - A ., ,, ' is 4, V ' I wifi, VV:yf r:fifwmV-,4M-- a f ,L W WEMVV f-f mfs , ' i ' -4' AN' ..,. ,,,...,,V,V V ' 'V ' WWW '7'f'f,'7 WAf' L:f?Vlif 'Wf4- k ' f V 24? ifrmi? Vw' - V Vw. V ,M V, 'wi My ni, f W W ,V 4-W ,,V'VV'VV aff' ,mf ,VV ,V A sz QQ? VV ' ., ' V I MMM .M.,.,,, -Vkrww M f : ,, , S Q, S , ,W 6, Zia Q 3 , f f if 3, 4 Q' ff 4' y W S -40 . J' V ,,,,VV Za! , Vik' FroshfSoph Wafer Polo 57 Varsiiy siairii leaders full of enihusiasm and pride is ii i 2V 1. Fall Varsiiy Yell Leaders: CFRONT l?OWj Julie l-lager, Julie Bur- keff, Paula Carier, CBACK IQOWQ Michele l-loiion, Chrisfie Dailey, Kafhy Olvera, Noi picfured: Colleen Faughn. 2, Fall Varsiiy Song Leaders' CFPONT l?OWj Tiffany Lee, Melissa Wilson, Viki McNabb, IBACK RO Wj Ellen Sanders, Karen Jensen, Robin Walls, Ann Zwahlen, Cici Barbe. 3, Yell Leaders Karhy Olvera, Cnrisiie Dailey, and Paula Carier snow fheir perfecf form. -4, Song Leader Viki McNabb gives the ieam a spirited cheer while Michele l-lolron looks on, 58 Fall Varsiiy Spirii Leaders iw 'WZ LF-33,1 MW 'F '54 , 4 f Z S 42 ' V, 2 I FCI! ROVOITV 59 ,. W Q J ,, 'Mm WK H93 'W ww A 3 h .1 U V A W V ww awp gh., . MW f ,,,,, Wa aw, ,wwMW4Qy+QwM,W,,,, . A,,, , ' K' W 5 W mmwmrwf ,W My ' y www, 1. nw ma Q .af ,ma 'R a iprwnv , I I ,, -A A VV , ,,.. . ..,, vs, . , ,, A M W ,, .,,,f 5 fr Vb l H ,V ,,m:5 Q ' ,VT 5 ,.E , ,. , .m 4,, , , 3 3 ,ii r Galhe y Ellie Srrhr Tamr Harvey Tracy Sfefahr Aberhafhy Lrssa Hayes aha' Jehrfer Garhey share a hug a game, lley Commfssroher Julieffe King shows her Ill Sophomore Ye!! Leaders: KFPOIW POVVQ Q 1 VGTOD Draper smrles for fhe camera, Sophomore Spirit Leaders 64 I 1,1 i 3 WMM Af m Q ? r W1 4 H Y' rr , r h' 1. Forworo'!?oberf Price goes up for on outside jumper. 2, Sophomore Crofg Oroho Joys ohe up. 3, Juhfor Doug Tockeh' pufs G move OD o Merced defender. 4 The vorsffy feom gathers for G frme our. 4A A I 1'.'.ZS' VarsiTy jusT misses making playoffs b y Jamie Noff and David Horfon Affer a disappoinfing 4982-83 season, varsify baskeTball Team rebounded To a successful 4983-841 season, They finished a respecfable second place in The Tough CCC wiTh an 8-7 record, and were 4-41-42 for The enfire season. Davis losT Their opening game of The season buf came back To reach The finals of The ivio- desfo Cify TournamenT. There, They meT highly ranked lvlodesfo High and were sTopped To gain a second place finish. According To head coach Denis France, The game againsT Cenfral in The MCT was a key one. The overTime vicTory over Cenfral gof us inTo The finals of The ciTy Tourna- menT. Junior guard Tom Hauser played The key role in ThaT game by sinking a shoT wiTh only seconds remaining in overTime To give The vicTo- ry To Davis, The nexf big sTep for The SparTans was The Oakdale TournamenT. Davis wenT inTo The Tour- namenf feeling confidenT and considered iT To be a sTepping sTone To sTarTing off league play in winning form. Led by senior playmaker Jerry Jackson and junior forward Doug Tackeff, The Sparfans dominafed. Winning The Oakdale Tournamenf jusf before league play really gave us a big lifT, sTaTed Coach France. When league play sTarTed, Davis came ouf sizzling, winning Their firsf Two games decisively However, afTer The firsT Two games, vicfories over Downey and Beyer, The Sparfans spuTTered and losT Their nexT Three in a row To Merced, ATwaTer, and Turlock. Geffing back on Track, Davis won five of Their nexf seven games To Tie for second place wiTh Afwafer and wiTh a possi- ble playoff berTh on The line, Affer a loss To Merced, The showdown arrived, IT was Davis vs, ATwaTer in The Falcon gym. Davis had To win To keep Their playoff hopes alive, Affer being down by 43 poinfs aT one poinf, Davis came back To win in overTime 70-611, BeaTing ATwaTer in overTime was our besf win, iT was a greaf comeback due To super Team play, IT was beaufiful To waTch The unselfishness and hard work pay off wiTh a very big win, commenfed Coach France. Afferwards came a hearTbreaking loss To Tur- lock Thai ruined Davis' hopes of going To The playoffs. Playing key roles in The Sparfans' successful season were sophomore Craig Orona, The leagues leading scorer, Jackson, Tackeff, Rich Howell, and Jeff Luna. Also conTribuTing for Davis were l-louser, Roberf Price, Jeff Sfone, and Leo Gallagher. Varsify Baskefball 63 2 4 : , y , .. , My - f T? .L if '51 1:-,fy o f ,,, W, ' ' 'WM mf. V ri , 3 , , , 641 Sophomore BoskeTpoiI Sophomores dominoTe by Seon Byrne Sophomore boskeTboiI dominoTed Their opponenTs, Cooch Fred Lo Queso soid, i'There were hdrd workers ond They were willing To ieorn. Some of The Ieoding ployers on The Teom were ScoTT GupTiil, Mike Lowson, Mork Nei- son, Ronnie Dovid, ond Moro HoobleTT. GupTiii overoged 42 poinTs per gome in The firsT seven gomes of The seosoy Dovis' ToughesT opponenTs, in TF mind of Lo Queso, were Merced on STGQQ. Hoving iosT To poTh of Ther Dovis only hod o ohonoe To QeT bor oT Merced. The pesT gome of TT sophomore seoson wos in The Ookdo TournomenT Chompionship when Doi beoT Beyer 60-32. f ,wwfs 5 jg A ,,QmZ,,, AQV .V , W W M i MW 1 v 1 W Wa '. xffif anx'rANQ QE f vw lg, f K i ff: n as 4-4 , f 'Wk if We f 1-v fwfr' , M f 2 a f M so se? i ,yr fer- MY, my is faq W wawmfw-.fkw 1, Marc Haobieff guides the bali up io ine noop. 2. Marc Habbiefi blocks an op,oonenf's pass. 3. Mark Neison geis ready io make a pass, 4, Mark Nelson shoois a free fnrow in ine Afwafer game. 5. Pony David passes fo a feammaie. 6, Sophomore Baskeibali: IFPONT ROWQ Coach Fred La Quesa, Doug Jeffers, Mark Nelson, Mike Lawson, Soofi Gupfiii, Kevin Carter, Craig Orona, 1SECOND l?OWj i?ony David, Jimmy Lane, Shane Harmon, Bref Tidrick, Marc Habbieff. 66 Freshman Baskefbail 7. Freshmen baskefball players wail anxiously for their furn fo play, 2. Key player Alan Davis goes for a baslcel. 3, Todd Hammefi jumps for ine ball in a game against Be yer, 4 Freshman Baskefball: CFPONT l?O Wj Jacob Smiih, Eric Dixon, Aaron Hamilion, Brad Z wanlen, ISECOND IPO Wj Allen Hodge, Allen Davis, Mifch Zak, Vanseng Prom, CBACK ROWQ Craig Klopa- reif, Todd l-lammefi, Ben Posiley, Paul Nelson, Nafe Lamberi, Coacn Jerry Houser, 5, Being pursued by a Merced player, Vanseng Prom dribbies fne bali. 6, Team members discuss game slralegy, 7, Brad Z wanlen goes for a lay-up. Freshmen build foundaTion by Elaine Tzagarakis ana' Erin Barry Winning is nice, buT our main objecTive is To build a solid foundaTion for The varsiTy Team, sTaTed freshman baskeTball coach Jerry Houser. While Brad Zwahlen, Alan Davis, and Paul Nel- son were The key players of The season, said Coach Houser, playing TogeTher as a Team is very imporTanT if a win is To occur. Team mem- bers enjoy working TogeTher Towards a win. AlThough 35 Tried ouT for The Team, only 'I5 made The final cuT. These 45 players consTanTly drilled, play afTer play, on developing Their game skills and sTraTegies. This Took many hours of prac- Tice afTer school as well as Time spenT playing games. Coach Houser noTed, The main concern wiTh baskeTball is The lack of publiciTy iT receives com- pared To fooTball. Coach Houser feels ThaT al- Though baskeTball doesn'T bring in as much mon- ey as fooTball, iT is sTill a very exciTing specTaTor sporT. 7 P sz L l 1 I SQ Q si! 'Ill I 'l C' -...h-W, , ,yy W MM. ,.,,,, M y W,w,W, o....,,,...,, .sf l. Sophomore Pam Ealon pushes her way fhrough a Beyer play- er. 2, Paula Eafon goes up for a jumppall againsf a Beyer opponenl. 3. Varsily Baskerpall: Angie James, Denise Price, Marcy Durkin, Jennifer Day, Colleen Faughn, Anne Penfziperis, Palri James, Chrislie Earle, Jean James and Gina Heppner, 4. ln a crowd of Beyer defenders senior Gina Heppner shoofs a side shof fo score lwo poinfs. 5 Wifh no pressure, Monica Hellon dribbles down lhe courf ser- fing up a play, 6, Having infercepled a pass, Pall! James drives down courl, 7, Junior Varsify Baslcefball: CFPONT POVVQ Dionn Marlin, Pam Ealon, Monica l-lelfon, Karh y Jiminez, KSECOND PO Wj Laura Lam- perl, Licia Pope, Paula Ealon, Anila Parker, Michelle Whifford, Dannelle Mcl?eynolds, Ui-lll?D PO Wj Assisfanr Coach Tom Nip- per, Kelley Murphy, Sheila Sieferer, Kelli Wealcle y, Marilyn Dew, Befsy l-larmon, Sally Poperfs and Coach Bernie Finley, 68 Frosh Soph BaskeTbaII f 3 4 AVIS X N, 1' Mk AHW www rrsr is - T A ,. ,Q ev ,. ,, , my V 2' ,,f Aff , y .H 7' 57? X 1: by , 1 E f ,zu 'V G, if Zfz,gfYf?I tm A , y E, 'hrough The hoop by Anffo Parker lVViTh Two leogue wins ond one loss Merced, The vorsiTy girls pdskeTpoll om were off To d good sTorT. MAH of e girls worked exoepfiondlly hord in doTioe ond ployed wiTh o greof deol inTensiTy during The gdmes sToTed oooh Dwoyne VVesTfoll. By oTTending dll proofices, working Ed ond dediooTing Themselves To Teornj ChrisTie Eorle, PoTTi Jornes ond Anne l?enTziperis were sold To be The mosT inspiroTiondl ledders. Colleen Fdughn wos d very serious ployer ond The leoder in dll gomes. Two of The pesT gomes of The seo- son were ogoinsT Ripon ChrisTion ond Beyer. Beoouse of The exoiTernenT To- words The gornes poTh defense ond offense ployed exTremeIy well. FroshfSoph pegon wiTh Two leogue wins ogdinsT Downey ond Beyer ond one loss, Coooh Bernie Finley noTed ThdT The Teom wos srnoll puT very quick. She olso sold ThoT dll of The girls pldyed hord ond more os o Teorn. As The of- fense improved, The scoring become more evenly spreod ThroughouT The Tedrn. The rnosT exoiTing gdrne pldyed wos ogoinsT Trooy in o TourndmenT. Al- Though They losT by only o few poinTs, Their shooTlng ond rebounding wos ex- oepTionoI ThroughouT The gorne, Girls VorslTy Bosl4eTpoll of? we-pk ,,,L ,. MQQQQ5 ' .VVV W 1 . ,gay , f , Z A A Q fr f J f al' qw f f f 5, W . ? 1 Q :gif ' ' ff-1 , , 'fa L X Q, 4, L..'i Q i ' im if 'ar 4:- 3 Erigik 1 V 11 U if A MX VW f ' i,t E! 3, A at , TV., I yi ,QW up xx M , ' L' ,Www , ' wa x Q 7 n P 4 V U 'S El . ' W ,.,L ' , ,,,iVV Vx 11,1 'Q if? vw' ee 5 i k : gi! .. - . A Y S lk i f - g 2. Mgikf W A ,A f im- x . 5 -k,,,.,,. nk 1 f if sf' K ' i- 1. 1 K Q, Q fffmf? in ,gg Qi ? qu J- - , v f . .4 ,, 1 5 'W , ,f 'I , 2, ! W, ff VL, I 'Ze Y., K , 345 , A ., wfdkfw, 'Q yi, 5, ,M Y ,vw 1 Q 4, , . , 'w ' ' . , fu ,, V' ,' fm? , WZ, ,y , WMM.-pg., a,,,,m,W ff, , ,, A Q, 1 + My wi. . , 4. f, ,V , K ,L V A , I ffgifl iff W,gZ,Z41,:-if, 4' H lf4 452,,w,L, 5 .1 f V ,Q ,K V , :,f56,,, ,, U it lf ,Jr I ,, A ' f Y'H 'i-o . 9, , ,wwf Y ,V K1 45 JV sTrives for peifeciioh by John Guerrini FroshfSoph soccer coach Johh Welch expecTed a winning year. The Team pracficed offeh for Two hours or more. According To coach Welch, Team sTahdouTs OD offense were Robby Vossoughi, Bobby Crossman, STeve Kehhedy, and Kehhy lVlanzohi. Ch defense were Jeff Riley, Oke Rah- some, and Darrin Himes. Two excep- Tional goalies were Gary Jones and David LeoneTTi. Affer some of The Team's sopho- more players advanced To varsiTy, JV soccer was lefT wiTh only six sopho- mores. BuT, The Team looked preTTy promising, added The firsT year soc- cer coach. As Welch sTaTed, The boys Try To be meh: and The skill level of some of The boys is very high. I help Them improve on whaT They can. Coaching as a volunTeer, Welch said ThaT he likes The game so much ThaT iT was worTh iT. 7. Trying To se T-up The ball, Greg Hoagland does some fancy foof- work. 2. JV Soccer: CFRON T RO Wj Gary Jones, Reggie Powell, K arl Philipo vifch, Oke Ransome, Jeff Riley, Dave Leoneffi, Mike Billingfon, CBACK ROWQ Pinder Basi, Ken Manzoni, Robbie Vossoughl, Bob- by Crossman, Sie ve Kennedy, Tim Ogden, Greg Hoagland, Jeremy Yunr, Darrin Himes, Coach John Welch. 3. ln hopes of scoring a goal, Darrin Himes Tries To oufmaneuver a Beyer opponenf. 4. Greg Hoagland sfruggles fo keep The ball in Davis' possession. 5. Precise passing was The key fo The Davis of- fense in Their vicfory over Merced. 6. Girls Soccer: TFRONT ROWQ Coach Marsha Hoagland, Sfephanie Brafz, Debbie Bufferfield, Chrisfine Samuel, Sfacey Friedman, Ami War- den, Tracy Davis, Rachel Bufferlield, Julie Cald- well, Karen Christensen, TBACK ROWQ Shauna Hargrove, Tobi Palombl Tiffany Lee, Krisfen Hoagland, Wendy Cox, Kim Alonzo. Linda Para- dis. 72 JV Soccer J' Girls coniinue reign by Khrfs Epperson Wiin a new coacn, new aififudes and sfrenuous workoufs girls soccer fearn was once again exbecfed To fake ine CCC. Since ine beginning of fne league in 4980 Davis nas yef fo give up fneir league crown and nas also never losf a league game. Alfnougn Coach Marsha Hoagland credifs The enfire fearn for fneir suc- cess, fnere nave been a few ouf- sfanding players. Six all conference re- furnees are Tobi Palornbi, Julie Cald- well, Tiffany Lee, Linda Paradis, Krisfen Hoagland and Cnrisfine Sarnuel. ln ad- difion, Tobi and Julie were named To fne California sfafe soccer learn. Wnen asked fo forecasf ine soccer season, Mrs. Hoagland replied, Davis nas dorninafed fne league by winning all league compefifions. l arn sure fnaf we will win ine CCC once again. Girls Soccer 73 si, , - WMM Ummm VllresTling dynasTy Torseen by Kenefick VVe're noT as maTure mainly be- cause This is a basic rebuilding year for us, were The words of coach Tom Kenefick when he was asked how The '84 Davis varsiTy wresTling Team was doing compared To ones in The pasT year. Kenefick had To counT on former JV wresTlers and incoming freshman To fill The varsiTy spoTs. They're young buT very physical kids and They've done a good job, coach Kenefick said abouT The facT he has a young buT noT an inexperienced Team. Leading The young SparTans were veTerans Tony Majors who had a 25-2- 4 record, Shane Cohea 24-4, and heavyweighT Pepe Becerra wiTh a 25- 2-4. All were ranked in The Top Three for our disTricT during The firsT parT of The season and were expecTed To Coach Kenefick and head cod Don Lanphear were glad To see sT denTs going ouT for The Team and sai This was probably The mosT enioyab Team so far inTo The season, an They're good kids To work wiTh. lf keep geTTing a TurnouT like This, Day High could be a dynasTy in The sporT c wresTling in years To come. show well aT secTions. ' c L ' 'c ' I w T W A3 Vicfor Vieyra fakes a shoi on his Turlock opporwervf, Tony Major uses a ieg sweep on yer arzofher vicfirn Varsity Wresiiirvg: CFRONT i?O VVQ Craig Gunaiach, Vicfor Vieyra, Vince yra, Tony Major, Shane Cohea, Mike Canfweii, KSECOND i?O VVQ i?ooerf fnoids, Brian Cody, Mike Hussey, Curiis Coivirv, Scoff Weiss, Pepe Be- ra, epe Becerra pins his adversary, enior Scoff Weiss fakes confroi, Dnce again Pepe Becerra has his arm raised. Varsity Wrestling 75 Team Tough and hardworking b y Laura Gundlach The 1983-841 JV wresTling Team was hardworking and Tough, said coach Dah Lanphear. STandouTs were heavyweighTs Brian Ferguson, Ron Owens, and Eric Sharar. ln middle weighT iT was Duane CanTwell, and lVlarTin Paularena. LighT weighT sTan- douTs were Erik lVliTchell and Phil Mar- if dj 3A A A Tinez. Coach Lanphear also commenT ed ThaT The boys learned auickly ana worked well as a Team, lVlaTmaids are moral supporT for The wresTlers as well as physical supporT Supplying oranges and liquids is jusT c small parT of The maTmaids' lop. The' also keep score and Time aT The maTches. P Q i V r 7 Tim noninson fakes a break from pracfice. 2. Wrestlers don 'f depend only on muscles for a good march buf also on auick fl7ll'7klT7Q fo gel our of messes like fhese. 3. Jackie Krall, Joni Williams, and Amy Murdock help or a march. 4. Joni Williams keeps score. 5 Wreslling is a sporf of individual compelifive- ness. 6 Wresrlers work hard during praclice. 7. Malmaid Joni Williams prepares oranges. 8 Mafmaids rl-'l?OlVT l?O Wj Am y Murdock, Shelf ly Karam, Sreglrnde Anshullz, C SEC OND l?O Wj Tina Dekelaifa, Melissa Wilson, Joni Williams, Jackie Kraff, Barbara Baker. Q. JV Wrestlers' rFl?OlVT l?O Wj Joey Dominguez, Blaine Crismon, Tim Robinson, Tochina l-lampron, Erik Mirchell, Phil Marfinez, Duane Canfwell, Dale l?ineharf, I SECOND PO Wj John Saras, Eric Sharar, Doug Jusl, Marlin Paularena, Jim Delvino, Brian Ferguson, l?on Owens, John Delvino, and Chris Carrrllo. Jah-fgmv SpiriT and pride are VarsiTy's mofivdrion klkp- 4. Carre Hoasewrlghf, Shari Evers, Sandre John- son, Becky Shrum, Debbie Canevaro, and Sandi Lambert keep rn srep af a game agarnsf Ma- desfo, 2, Brllle Jo f?rp!e y and Grna Cargfar cheer on fhe Team, 3, Spring Varsfry Sprrrr Leaders: fFl?ONT l?OWj Gina Carglaf, Debbie Canevaro, Corfe Housewe righf, Sandie Johnson, IBACK PO VVQ Becky Shrum, Shari Evers, Sand! Lamberf. Nor pfcfured: Brrlfe Jo Prpley. 4. Sandie Johnson and Becky Shrum show fherr sprrff durrng The game againsf Lincoln, 78 Sprung Spirii Leaders fm Q ff :QiiQ?fQ,ffjf' faq! , , FEM ,. K L ' H V fryh f , ui . A ,Z 75 .. ,. ,, ,.:. , , M y , 3 3 fl z+si iU'i U 9 H .H , , Y ,,,gi Q Q 1 A Mfff in ,:' S 5 L,:h,,,:' iirimf 1 i X '--, , W' mf 0 M, tm, ill H LQID fl! ' 0 M ,, I H f, Sf 'Mm fn,-,4z:'wf I M 'f V f . 2 ' -,,,4.., f F, ,.,fv,Mk...,,f,r 4WfnHy,,,,fg,,,,f v--fgw, ,, 5-N f M l 3 'fn ,,.. , 2 ff 1-giysq A .s wh If-K, .5 , NN Ham, - 1 71 Spring Royohy 79 Sophorhores and freshmen ow Their sruff I 1A 31 WW 24 Av 80 Freshman Cheerleaders l. Freshmen Spring Cheer Leaders: IFRONT l?O VVQ Judy Ciccarelli, Melissa Eng, CBA CK IPO VVQ Siephonre Acker, Kelly Trio. 2. Kelly Trio cheers her learn on. 3. Stephanie Aoker, Kelly Trio, Judy Ciocarelli, and Melissa Eng perform fneir routine. 4. Melissa Eng and Judy Ciccarelli show rneir spire if. A4 v2 V3 L LL.. ll' ' 1 N1 reissue umm .L. LM :cz til B315 was .ijrj na,um alumna llfx 1:05 lst ,ng an iw' Fqx X5 rm 1. Sophomore Spring Cheer Leaders: CFLQONT IPOWQ Debbie Smith, CSECOND POWQ Anallso Mohr, Michele Crist, Leigh Suffer, KBACK l?OWj Krislie Emens, 2. Michele Crisl smiles for lhe comero. 3. Leigh Suffer and Michele Crisf display lheir style, msxm ,W Sophomore Spring Cheerleaders i QA Tennis: Tougner Tnon ever by Geoff Sprinkle Tne 49841 boys vorsiTy Tennis Teom was looking forworo To winning on- oTner CCC TiTIe under new coocn Dor- ryi Torre. AITnouQn The Sponons IosT rnony seniors IosT yeor, Tney've recruiT- ec! freshmen sTonciouTs RoberT Lyncn 82 Boys Tennis onci Tom Gordoli, wno ore expecTeci To noici vorsiTy posiTions. Gordoii ond Lyncn, os well os Teorn Ieocier BreTT BorTon onci senior PeTe FoIIeTo, wouici oTTenTpT To Ieod Tne SporTons To Tneir sevenTn CCC TiTie in eiQnT yeors. V Track: going for The gold? by Geoff Sprinkle WiTh a iiTTIe more Than a monih pe- fore The league opener, Track pre- pared for a compeTiTive season. Coach Harry Gualco believed ThaT wiTh a few surprises, The Team could Topple rivals Merced, Aiwaier, and Turlock. Davis Team leaders included sprinTer Jim Wall, long disTance runners David Layne and Craig Sawyer, James NoTT in shoT puT, i?ooerT Reynolds in pole vauIT, and ScoTT Weiss in discus. 5 . . V . , f . I mul k. v7 l. Senior Brefr Barfon demonsiraies his awe- some serve for The camera man. 2. The boys Tennis Team climbed over many of their opponents. 3. Junior Tom l-louser leaps over The high jump bar. 4. Boys Tennis Team: fFl?ONT IPO Wj l?oberT Lynch, Paul Norquisi, Tom Gardalr, Chris McPher- son, KBACK TPOWQ Breif Borion, Geoff Sprinkle, Peie Fallefra, Rich Mclvabb, Shane l-larmon, Tro y Javaher. 5. Floyd Slaughrer explodes our of The starring block. 6. Freshman sfandouf Tom Gardali sho ws excel- leni form while hifiing a forehand. 7, Varsiiy Track learn. 77740 T adidas 84 Girls Track Frosh-Soph, girls Track Takes off on The righT fooT 1. Kari Gualco displays her skill in high jumping. 2. Tina Ciraolo prepares for The meefs ahead. 4984 Girls Track Team: CFRONT l?O VVQ Befsy Crawford Tina Clraolo, Viki Visfe. Lisa Townsend Mina Neigel. Lisa Rigney, Lori Cunning- ham. Slefani Abernafh y. 5 BA CK l?O VVQ Shauna l-largrave. Rob- in Walfs. Kelly Smifh. Joni Hansen, Tina Allen. Shannon L yons, Leigh Loeffler, Jenifer Gregory, Rene Anderson. Joni Williams. Karen l?ansome, Kelly Cadwell. Coach Harry Gualco. CNOT PlCTUl?EDj Monica l-lelfon. Chrislie Earl. Wendy Cox. Tobi Pa- lombi, Alix Tubman. Sally Roberts, by K alle Harmon During The early sTages of The season Davis High girls Track Team was very hopeful and confidenT ThaT They would do well for The 4984 season. Senior sTandouT Alix Tubman, who was injured in a pre-season race. was expecTed back in full force To help her Team- maTes aT The beginning of The season. OTher sTandouTs were, Tina Ciraolo. KrisTi Earl, Shauna Hargrove, Karen Ran- sen, and Tobi Palombi, The jumper on The Team. All members of The Team were sTrong compeTiTors and worked TogeTher To achieve Their goal of be- ing CCC champions. edit 5 516' iff' . f rr ' iir he 4? 3.-'TerrM.,v1'k I 4' v I 45. I 3 4. Todd Sleeman Throws The discus. 2. The Team warms up before pracrfce, 3, Frosh-Soph frack Team: CFIPONT ROWQ Tal Lam, Les Robbins, Paul Cadreff, Blaine Crisrnon, Jeff Bakker, CBACK ROWQ Dana Leafherwood, Todd Sleeman, Vince Vieyra, John Beacorn, Ke- vin Brrsco, John Wheeler, Jamie C-Jelsfmfno, Bran- don Presfridge, Coach Harry Gualco. , T T 4' 1 vw 1 A T T ' ' ff A a 1, if in WV ' .431 fs W N . 1 inf? af 'V Vw- 4 G .Ml 3 . , W F . , h , , ilu 1 1 ,N 2' by Kaffe Harmon Soph-Frosh Track Took off on The righT fooT. The Team consisTed of few members. Among Them were TaIenTed and upcoming aThIeTes. ShoT-puTTer Kevin Brisco and discus Thrower Todd Sleeman boTh conTribuTed To The Team's high prospecTs. VarsiTy shoT- puTTer Jamie NoTT commenTed, 'TThe Soph-Frosh Team is noT very large, buT They are Tough and have a IoT of de- sire To ao well. JV Track 85 STrong swimmers dnd divers I H . WW! , .yr 3, ,K by Micheiie Ocken Imagine . . . jumping inTo a cold ouTdoor swimming pool aT 6 on a dark and chilly spring morning. The only Thing on your mind is keeping The blood flowing so you swim. You do noThing buT swim back and forTh, and The coach is happy. Of course you're more Thon willing To do This for The sake of The Team: The swim Team. The Typical swimmer works ouT for Two To Three hours a day. There is a one hour morning pracTice and a Two hour pracTice afTer school. These pracTices consisT of plain ond simple freesTyle laps. They also make use of hand paddles and kickboards To 86 Boys Swimming sTrengThen various parTs of The body. This workouT may seem quiTe simple buT iT helps in building The sTomina and developing The Technique necessory To WIN. Coach BrenT Bohlender wenT inTo The season wiTh high hopes and TrusT in sTandouT swimmers ScoTT George, Dave Thompson, Eric Fischer, and Dale Wissman on The boys Team, and lvli- chelle Carroll, and Angie BaTeman on The girls Team. Janell Niemi, recovering from a shoulder injury, was also ex- pecTed To do well. Diving Team was expecTed To Take The CCC championship due To sTrong reTurning divers, such as John Lacey. 1. Boys Varsiiy swimming: rFi?ONT i?OVVj Scc George, Eric Landers, Mike Casseii, John Delvin IBACK i?OWj Jon Boafman, Eric Sharar, Eric scher, Greg King, David Johnsfon, Doug Dc i?ob Dadaso vich. 2, Long hours of simpiy swimming back and for were required of swimmers during pracfice. 3. Diving Team: Suzanne Johnson, Serena Baie Larry Eiam, Cheryi DeSignori, Sfan Cook, Jennii Lowe, John Lacey. 4. Boys Frosh-Soph swimming: CFPONT i?Ol John Saras, Jim Sproff, Sfeve Schneider, Crc Pearson, Jm Blackshear, Mike Biiiihgron, CSET OND i?O Wj i?ob Osborn, Maff Hansen, Tim Ga sei, Scoh' Thompson, Mike Woodward, E Krefschmer, Eric McGraTh, CTL-ili?D i?O Wj Spenc Sanders, Sieve Wafis, Greg Hoagland, Je Overiie, Tim Ogden, CBA CK i?O Wj Michael Nier 5. These four sophomore swimmers Take break afier swimming many laps. 6. Janeii Niemi demonsfrafes The bufferfiy. amy, ' J to K 4 Wi 4 4' M f,.,,J,, ,f K fi we ,N , - ,, 1 ii., W, ,, WH gym, ,,, . ,,, J V -if ir- yi- is 19 ,Avi www ng- ,, Q Q W' s.. ,ww ,mx , , ,W 'F 6 m Girls swimming: CFPONT l?O Wj Karen Miller, Jamie Hume, Stacey Friedman, Janell Niemi, Suzy Torre, Cindy Klein, Jennifer Day, Diane Munc y, Ximena Delgado, Dina Davidson, Melissa Bradley, Karen Englebart, CSECOND l?OWj Kris lmfeld, Ann No- taro, Corrin Wakeman, Jill lvlarasovicn, Laura Lambert, Hanna Slcytta, Heather Beall, Michelle Wnittord, Kristy Olinares, Serena Galeazzi, Mari- lyn Guiry, Kristin Boer, KBACK IPOWQ Angie Batef man, Michelle Carroll, Susan Peterson, Molly McCormick, Teri O'Brien, Patty Roberts, Autumn Zamora. Girls Swimming, Diving 87 N ' Uff,,f'f Q 4 5 Vw! . i l Bdsebdll looked oombeTiTive b y Suzie McGuigon According To VorsiTy bdseboll cooch Lorry Johnson, The Tedm wds very cornpeTiTive. AT The beginning of The sedson, Codch Johnson hod This To soy dbouT The Tedrn: 'lPiTching will be o big dues- Tion mork. STrong defense ond good hiTTing will be o conTender if The piTch- ing cornes Through. According To Johnson The Tedms To beoT were Merced, ATwoTer, on Beyer. They were dll sTrong Teon wiTh good piTching dnd severol reTuri ing leTTerrnen. Junior Roymond Ldnkford wds promising new fdce bloying firsT bds ond The ouTfield, sdid Cooch Johnso STondouTs were Jon RoTTozzi-ob fielder ond piTcher, Jerry Jdckson-ser ond bose, BreTT Woll-cdTcher, Jose Pi To-shorTsTob ond biTcher, ond Howdi STice-biTcher ond infielder. .ff ax ,, V,,, QW 'llli l. A Dayrs base runner slrdes lnlo home. 2. Howard Slice concenfrares on the pllch. 3, Davrs players congrafulale each ofher on a vlcfory, 4. Brelf Wall gives Howard Sflce some advice. 5, Dan Sfark swrngs for lhe bleachers, 0, Darrrn Abby and Curr Dayld fry fo fag an opponenr our. 7. Coach Larry Johnson discusses fhe game wllh fhe umpire, Varslfy Baseball learn: fFl?OlVTl?O Wj Darrin Abby, Gayland Forsberg, Jerry Demrdes, Raymond Lankford, Brell Wall, Scoff Jackson, Curl Dayld, K SECOND PO VVQ Howard Sfrce, Mrlce Pllcock, Todd Tuggle, Greg Reeves, Jon Par- fazzrl Davrd Silva, Jose Prnro, Coach Larry John- son, CBACK POVVQ Dan Sfarck, Chrrs Deafrlck, l?r'ch Howell, John Andrews, Brad Anderson, George Green. Varsity Baseball 89 M-4' h A' WT Wagyu' f W W ,, 3M,Y,f 4, ,, ,ff ,W ' OO Freshman Baseball M 1 f 0 I W9 '-v- W 'f ffizf- y ,, A Q dw W If f. ,. W ff Z W ,W , ' if fli ' G 'iff ,M ,M 'V 0 W -+ -,,,,5f, ff -. ,W M327 .MM J nwnuws. ' K . , A 9 .W r. s l-liTs make by Anita Parker iAs a new coach Dan Boer had high xpecTaTions for The season. WiTh Two yames inTo The season againsT Lincoln Ind Sonora, Coach Boer sTaTed he 'as pleased wiTh The chemisTry and -ommiTmenT of The Team. He also said ThaT based on past his- ry, ScoTT GupTill, Cunis Colvin and Davis should do well in piiching. To auoTe Boer, I expecT our Team play smarT, have fun, and be very mpeTiTive. iT happen Freshman baseball Team sTarTed The '84 season with a league win againsT Downey. Head Coach Jerry Houser sTaTed ThaT he was expecTing a cham- pionship year. Houser expecied ouTsTanding ploy- ers of The season would be Todd Ham- miT, Ron Owen, Mark Nelson, Victor CasTro, Kenny lvlanzoni, and Brian Cody. Asked whaT To expect of The firsT couple of games, Coach Houser said, l'LoTs of mistakes, plenty of hustle and an abundance of enthusiasm. 1. l?on Owens sprints toward Hrst base after hit- ting the bail to the shortstop. 2. Todd i-lammitt runs into home as Downey's catcher straddles to get the ball. 3. Jeff Brewer warms up while on deck. 4 Jim Davis hurls a fastball. 5. Freshman baseball teamf KFIPONT l?O Wj Mike Welsh, Brad Z wahlen, Jeremy Fallauist, Jon Chi- turas, Ken Manzoni, KSECOND l?O Wj Duane Cantwell, Victor Castro, David Epps, Mitch Zak, Brian Cody, Eugene l?egne, KBACK l?OWj Mark Nelson, l?on Owens, Aaron Hamilton, Craig Klo- patek, Dm Walsh, Todd l-lammitt. 6. Sophomore baseball CFRON T l?O Wj Jeff Brew- er, Mike Cantwell, Jeff l?iley, Steve Rowe, Brad Pridemore, Pat Walker, IBA CK l?O Wj Coach Dan Boer, George Padilla, Dan lvtacl ellan, Scott Sher- man, Matt Luna, Kevin Kelly, Craig Orona, Scott Guptill, Jim Davis, Curtis Colvin. 7. Victor Castro sends the bali to left field to make a double. Sophomore Baseball Qi Q , Y Q We N ,, ,.f,,,Ay ,V ,W , , ,, ,X ,M Wulf . grainy, V. - V L ,, 4 L , -, sl' 5 fl ,7 fl W , r is ,fir , 4 1 filly, wt ,E f ggfj6rQ,qf,' ' TK3,5'3 if 3' 1fTf,7Q 2,', f'Zr qgfyyggfyia ,, . f 'r ,K K ,- J J A .,,' ,if 'I' ,' ,g, 1' t if W ,rv M V 'ww H I-f -'f ' ,Z la 5 it ,AM - ,vgl ,gb JM, f?,i?a,.X5w,5 J., M 7 V ,, WUI' , wg' . W N A 5536.3 ,At W, ,3if7'3.mW,2 ,.fr 'lihf'1!24'. .f 93' ,2J,z,..' . ', 'aww i?1'W'.'iffl rw, f , ' ' J rf 'W' f 'w M f ' . News , X QMYV' M. l i il, 4 , 4 3, il 4- l th v ,1 , ' , r 4, 'CA f' ! .1 fy, ,W , v. H ,lf We 3 at wk 'wk , '.s ' tm' ,, 4 if L' i-M 'L ' , J f' ,Q YMQZLWJ -W. . -1 ' ' f' ,W A714-.x2f?,g ',.,j,m ,-Km Ui ' f l. One reason for the successful year was tough offensive play at the plate. 2, JV Softball team: fFl?OlVT l?O Wj Marilyn De w, Kathy Jiminez, Karry Camileo, Pam Eaton, Kelli Weakley, Kathy Weakley, Paula Eaton, Dionn Martin, CBACK l?O Wj Coach Dick Erler, Trina Ji- minez, Karen Moore, Stacy Burks, Tracy Davis, Debbie Butterheld, Licia Pope, Melinda Buckmas- ter, 3. Varsity Softball: rFl?OlVT l?O VVQ Jennifer Wyatt, Julie Caldwell, Kristi Bettencourt, Ellen Sanders, Una Jiminez, CBA CK l?OWj Allison Weaver, Dawna Norneet, Gina Heppner, Laurie Ludwick, Jennifer Nutson, Patti James, Shelley McCance, Kathy McCabe, Shelia Sieferer, 92 Girls Varsity And JV Softball Title in reach for softball by Khris Epperson For the first time in recent years, Da- vis had a softball team that was ex- pected to take the CCC. Offensively and defensively the Spartans had standouts. Offensively there were hit- ters that came through when it was needed. Hard hitters Kristi Bettencourt, Allison Weaver and Julie Caldwell proved themselves at the plate. On the field Bettencourt, Caldwell, Sheila Seiferer and Gina Heppner had tough defensive play. Said to be one of the best teams that ever played for Davis, the team proved themselves against the bes After beating teams like Tracy, stag and Modesto, the players gained r spect and determination. When aske to predict the outcome of the seaso Coach Bruce Emerson replied, Th 49811 softball team is one of the be ever. I expect us to win the CCC, Under Coach Dick Erler, JV sau had an equally good year. Tough pl by the offense and defense allow the team to do well in league pla Offensively, team leaders were Sta Burks, Pam Eaton and Paula Eaton. defense, Marilyn Dew and Debbie Bu terfield played well. sf... 77311 'wha g W, df.. , -lar riff wwf' ,..nj'f r V V M:-iw V ' ' M V l viii' . rw l 'U'f-Lf: , or mr will may 'kk Duflook good for golfers by Khris Epperson liViTh The loss of CJ few key golfers, This ns o rebuilding yeor for The Sporfons. p golfers Keri Arnold, Dove Bofes ld Greg Bysfrom repeoTedly did well moTches. Rookies Tom Weofherly ld Chris Doll olso hod sTrong perfor- nces. lThough The Teorn wos rnosfly de up of undercldssmen, The ouT- look for The Teom wos good. When osked To forecosT The ouTcome of The seoson, Cooch Sfdfford replied, 'We hdve o good chonce of rndking sub- secTions. The individuol TolenT of our Top ployers will Toke Them To The sec- Tions ond Norfhern Cdlifornio finols. Dovis' Toughesf cornpeTiTion wos To be Merced. However, Codch STofford felT Thof wiTh good perforrnonces by dll of The golfers Dovis would prevoil. 1. Junior sfondouf Dovid Bofes anxiously dwdifs rhe outcome of The shoi. 2. Chris Doll foiiows fhrough wifh his shof in d rndfch dgoinsf Downey. 3. Golf: KFPONT IPO VVQ Poui Cox, Greg Bysfrorn, Mike Schneider, Keri Arnold, Tom Wedfheriy, rBA CK RO Wj Cooch Dick Stafford, Chris Doii, Kirk McCoii Liso Viios, GOFV Jones. Golf 93 Hill' lu' 24 5' ffl? Look behind The scenes by Julie Morffn We oll know ThoT sToTisTicions, rnon- ogers, videoTopers, ond onnouncers exisT, buT do we reolisTicdlly ocknowl- edge The hord work These dedicoTed people give freely? SToTisTicions ore required To oTTend gomes To record The nurnber of boskeTs rnode or how rnony yords were goined by eoch indi- viduol Teorn rnernber. Thonks To These people cooches con onolyze The Teom's sToTisTics. lvlonogers ore re- sponsible for o lorge porTion of The mo TivoTion ThoT sends o Teorn To o ccd TiTle. lvlonogers ore presenT oT dll proc- Tices, meeTings, ond gomes To held wiTh eduipmenT ond erronds. The viJ deoTopers provide Tdpes which ollow Dovis' cooches To observe The error ond correcT Thern. The onnouncers or Those fornilior voices oT gornes Tho give us o ploy by ploy descripTion WiThouT These young rnen There woul be mony people confused during Th gomes. 1 -4 41 l. Annouhcers are Geoffrey Dy for varsity boys basketball and Dean Galloway for football, 62. Soccer SfOflSfl'ClGf7S are Paula Carter and 4 Sherry Stearns, 3. Varsity basketball statisticians: CFRONT l?O Wg Erin Flake, Heather Beall, CBACK l?OVVj Kim McCleskey, Jahel Blount, 4 Freshmen softball statistician is Annette Barnes, 5. Boys sophomore basketball statisticians are l?enee Anderson and leigh Ann Loefner. 6, Footballstatistician is Marylfuzie. Also heloing but not pictured are spotters for the football announcer PODIY7 Ghio, Mark l?unyon, and l?andy Strauss. Also not pictured are Tina Ciraolo, Tobi Palombrl Shauna l-largrave, Jackie Kraft, Steve Dash, Shannon Hendricks, and Susan Peterson. Statisticlans 95 P I 96 I A atty James participates in one of the more r classes offered at Davis. students Molly 4. P popular compute during a routine lecture, ay Rich Howell, Jim Haw- tollsten, 2. Even Mc Cormick, Jennifer D , kins. and Alix Tubman find their own way 3. Boosters lent their support to the class of '8A in many ways during the year. A. Senior ROP student Roberta Dirks snarpens her skills at Adrian's Beauty College. 5. Dedicated Spartan fans, Lisa Thomas and Jennifer Haugen, snare an umbrella at a wet football game, he I l Christina Adcox Bryan Aguirre John Alameda Sherri Alves Cruz Alvidres Brad Anderson Karen Anderson The road ahead is long and hard, but l'm gonna cruz on down, Liz Arnold Paul Assad Steve Atwood Melissa Austin Z HSVZJD lm glad for all the good times l lm VOUDQ, l'm wild, and had becuase all my friends were lm free. - Triumph pretty rad, but as long as they didn't call me sad. Shelly Austin Mike Bacich Janet Baker Larry Baker Greg Bakker Randy Bakker Cynthia Barbe Kelsle Barker Scott Barnett Greg BCII'0hi Brett Barton Jesse Bashor Karol Basset Pam Bassett Hello, I must be going, - This is my escape. l'rn young ond Phil Collins need to be free. 'Un 'ihf as-'V f ! 'M ,gil fy ' V' ' V. W - f L , Heather Beall Kim Becker Kenny Beeler Melissa Bench Steve Bettencourt If you obide in me, osk whatever you wish, ond it sholl be done for you. - John 15.7 Ben Bettenhausen Sheri Biron Natalie Blevins Janel Blount Clancie Bordoll If you wont to be hoppy. be. - Tolsfol 99 Qin 'F Margaret Bowden Chris Bradley Greg Bremer Beverly Brewer Don Brewer Diana Brill Jason Brooks Mom l made il Kevin Brundage When you slide down The ler of life Think of me as a e is 'Nb Cherise Brunswick Robert Bumgardner Jr. Chris Bunch The pariy is NEVER over as long as you've go? your friends, Julie Burkell Jill Burton Chris Bussey Good Times may come and go, but memories lasl a lifetime, B15 Diana Burckhardl Our strength as humans is Tha we can laugh al ourselves for be ing ridiculous. Our weakness i Thai we have lo do il so oflen. 1-quuvngnv' John Cahill :uf if you're skinny, you'd beTTer ru John Campbell Phil Carlson Tonya Carney Michelle Carroll Paula Carfer lT's like a jungle somefimes, IT makes me wonder how I keep from going under ivy rf' Frank Casiro Alan Chang all else fails, hug your friends, g Twice. -Me Dale Chaplin Debbie Chalfield Dan Chichesier Paul Chin Remember yesferday, dream obouT Tomorrow, buf live for To- day. Focus on. . .l-Mary Specfar b y Marlene Youngnerm The performing abiIiTies of Hillary SpecTor are infiniTe. Her inTeresTs range from The violin, To singing, To many Types of dance. However, HiIIary's main focus in The performing arTs is Theaireg her goal is To be an acTress. She has been in many Davis High producTions under The direcfion of Bobby Roberfs for Three years. CommenTed lvlrs. Rob- erfs, 'lWhen Hillary finds her focus and commiTs herself ToTally To iT, she will be able To do anyThing. Hillary's favorife plays are The Glass Menagerie and And Miss Reardon Drinks a Lfffle. She has aTTended acTing workshops including UCDavis, The YouTh ConservaTory of ACT in San Francisco, and a producfion seminar aT The Ashland, Oregon Shakespeare FesTival. On sTage she said ThaT she would raTher work in a scene as opposed To a monologue because when There is give and Take iT is easier To develop an effecfive and real characTer. Maybe someday we will see Hillary's name in lighTs on Broadway. 404 is Tom Choppe The job is done ond I go out onolher boring cloy. I leave it all behind me now, so mony worlds owoy. - Connie Chrislodulis Tina Ciroolo Jerald Collins Korrine Collins -- Betsy Crawford Elicio D'Accardo NEHG' Shawn Cooper Mdfk C0l'dI'eY Kim Crossman Bfidh Curl Kierslen Dahlin Christie Dailey Todd Daily Two men look out Through The some bors: One sees mud, ond one sees The stars. .S '? 3 1525, Curt David Lisa David Sandy David Chris Davis Michelle Davis To all my friends, thanx for the l can do all things through Christ memories! Now l'm free' who strengthens me - Phlllipians 11143 T Jennifer Day Michelle Day Sherry Dean Chris Deafrick Mike DeCicco Most women would rather cud- dle a baby than a typewriter or a machine. - Phyllis Schlafly l Robert Deafhrage Michelle Dilklan Andrea Dixon Keith Dixon Roberta Dirks KILLER!! lt's not what you say, or what Student Govt 4-3 I can do all things through Him people think of you, it's what you Speech Team 1-3 who strengthens me - Phil A 13 do that counts Yearbook Co-editor '55 'Nun K X, . F Joey Dominguez Bonnie Doub Lisa Dunker Geoffrey Dy Kristie Erler lf I am not for myself who will be? lf I am only for myself what am l? And if not now when? 403 104 Senior Be-sT s BEST PM, PXRCUND Knew skiwixng pevsonowes Qxch SX e- ' ' Home were voked Besi ossmokes Becouse oi pooovxch ond C0 NX Mound by 'mek ievow cX CA Tn MDUS ese ,K CLOVV Ns MCU Clow ' Hsu UT VFUZIS Gnd X m0sf,CO fe T,-,Of WT,-no nly km Om Use f hSff ho OW DQ Orsuwr, nd s eniors T SVXRWED eoXX ond T om Nxppe: to root on Mos ' othex B ' cvowd Xi W s we one Xhxng X-Xe 's siond out xn o s. do WQXX, XX ' Spoxion xv ieXXow 'Wo 3 T Nyc AC deffjgefrufok EMIC M O 1. ' blllfy livigd L yn e rv pfo -S MQ 'nrfqu e ying TICNTO Sh C- OW S foe' fheir O Co Q - x News Sieve Edwards Jill Edy Brian Elfing Pam Embry Treosure forever ihoi which mokes you unique. - Beiie Midler Siephennie Emerson Khristine Epperson Noel Esiubrook Teresa Everett I om simply Trying io struggle Deoih must firsi be understood Through life. - George Lucos before ii con be occepied. r r E r o o xy-if 9-Wu Timothy 0. Evers Colleen Faughn Scott Ferrell Jlm Ferrera Sherry Fields High school is like o winter snow- Those crazy nights I do remem- when the snow melts o new life ber in my youth, the best times begins. - Adoniiah most of all, im ix Eric Fischer Tim Fitzgerald Lisa Fliehr Stacy Flores Gayland Forsberg Water Polo IAA After four years I still say Swimming lea LEFT is reieiirii Kurt Franzman Michael Friscia Jonathan Frye Mary Fuzie Christina Galindez Nobody knows the dreams I see and nobody really knows the in- ner side of me. - Billv Sauire I ,Rm S Leo Paul Gallagher Kent Galli Joelle Gallop Ramsin Ganji Eddie Garcia There are only two types of peo- Whoever the woman was that ple: those who are Irish and those drove me to drink, remind me to who wish they were, - My Dad thank her - W.C Fields Karen Gardner Susan Garrett ' Scott George Robin Ghio You people are all mental midg ets, - K,A. Michelle Goddard Gail Goldsmith Anthony Gonsalves Marty Gonzales Some men see thin s as they are The moose is loose Q and say why? l dream things that never were and say, why not? Micke Gonzalez Y Good luck to all the class of '84 and special thanks to my boy- friend who helped me through this year, Mary Gray Don't let your dreams take you away from reality, but don't let reality take you away from your dreams. George Green Teach me to fly, wanna stay high. l've got to live it up before l die. Bryan Grindstatt Michael A. Grove Jodi Grundy Can you picture what we'll be? So limitless and free. - James D, Morrison Georgette Green The memories and dreams on, and my Endless Love will forever, Karl Gualco Ni' CTS! N.. IXINIMI I I ll M Bob Guerrera Laura Gundlach Bruce Guthrie Patrick B. Guthrie Julie Hager Don't put something off until tO. Life is for too important o thing to morrow when you con put it off ever TCW SGNOUSIV ODOUT- untii the doy ofter. -OSCGV Wilde :LI ss, Stephanie Handley Christine Hansen Shauna Hargrove Katie Harmon Ron Hartman A doy is wasted without Iougnter - Nicholas Chonfort tvs sf. .ift ii- T Jlm Hawkins Laurie Hawkins Rusty Hedges Gina Heppner Kevin Hewitt R-.fs 'ST21 X Kent Hills Kristina Hinton Urs Hlrschberg Laura Hogan Coral Holien Destination Unknown - Missing Persons Michelle Holton Carol Hopper Melissa Horman Geoff Horsley Never fear, l am here. Pull up a chair and have a beer. Corie Housewright Do not follow where the path leads. Rather go where there is no path and leave a trail. Rich Howell Don't give the offensive rnan the baseline. - hoop 22 Stephanie Howlett Only one thing is certain-that is, nothing is certain. If this state- ment is true. it is also false. , ibm.. Holly Jacobson Patti James Bryan Jarman Kim Jenkins Karen Jensen Scott Jertberg Greg Johnson HSVLIQ Procrastination: Why ao today what you can put oft until tomor- 0 YOW . 'R Wm.. Walfer W. Johnson Manuel Juarez Tamra K. Karabinis Mike Keener Eric F. Knaak The only hell my momma eyer AT The end of The game bofh The l?ealiTy . . . whaT a concepT raised. king ana The pawn reTurn To The - l?Obin Williams some box. TVN ,rw L , E I . 5 s- - l 1 s. , v ' Yoko Kobayashi Jackie Kraff John Thomas Lacey Tocln Lam Eric Landers School wasn'T all ThaT bad, whenl FooTball 1-A look back on The fun l've may Diving 1-4 if-rx--r Jeannine Lane Randy Lane John Lanphear Rob Larsen Bill Laude know, Lawrence how much you've goT To D . re you know how llllle 'TSN fr Q K? Q , y , L Dana Leafherwood George Ledbeffer Robin Lee Tiffany Lee 444 fx fi 5? X ik arf Tracy Lee Kurt Lewis Jett Luna Jill MacDannaId Laura MacLelIan 7 .mite Q, . . 3' Louis Madrigal Joseph W. Mann Lynne Manrique Shawn MClpeS Cinderella man, hang on to your plan. Try as they might, they can- not still your dreams. - Rush Tami Marchese Anthony Marcum Julie Martin I wanna go home, take off this What I am meant to be uniform, and leave this show. - becoming. Pink Floyd, The Wall Anna-Marie Martin Learn from yesterday, live for to- day, look to tomorrow and rest this afternoon! Albert Martinez Steven Martinez Scott Masellis Always remember and never for- get, the more you party the bet- ter il gels. Debbie Maxwell Ken Mayne Vllhai lies behind us and what lies before us are small maliers com- pared To wnaT lies wilhin us Kalhy McCabe lT's hard To praclice whai you believe in, bui iT's worih The ef- forl. Karri Mayo Wall McCleskey Molly McCormick Focus on. . . Dale lfwlssman D y Debbie Maxwell Does swimming 2 V2 miles, bicycling 48 miles, and running 6 miles sound like fun To you? This doesn'T appeal To mosi people, buT To senior Dale Wissman This has greai meaning. A Typical TriaThlon consisTs of Three evenTs, swimming firsT, bicycling, Then running. AT The local level a TriaThlon is only abouT Three To four hours, whereas The Iron Man compeiiiion lasTs up To six hours. Training for a TriaThlon includes a sTricT dieT and exercise pro- gram, according To Dale. So far Dale has Taken Three firsT place and one second place awards. He has received various pieces of sporTs equipmeni as prizes. Dale said, UA TriaThlon can be besT described as OOM Training and TOCZ, compeTiTion. ' Wfdhhfif i' ,i i f ..., Tammy McCormick George MacDonald Suzanne McGuigan Vicki McNabb Romeo Meiid Where do you come from and 'VS The Dflme Of your life goTTa TO knowls FWOTVWWQ OVGUT TOWYTGQ where are you going? - La make il last. - Loverboy 'lie is GVGVVTVWWQ- K AfiC1TOl9 France Reine Rouge T T l :': E rig T T rr- fr ,eff lg lil ? T5 5255 3 if i ij? :IZEE ir 555 2 is VE ,E ,,,, T Z' fi' l 2 I nall: 2 A l, is T T T 5 3 X 'K T Mgr gg 5 T T 1 5 2 5 5 1 Q ' E 5 ill ll? -5, 5 3 1 z , ,,:21 El X T 3 ENE is ll, i l 2 l T :L T 31:51 Zig! 'g55.:5 I TEIQEEQI' 5 1 T l ' ::. :nj E Fai FX M 5 5 li? 2 ! T T' 5 TT l is il X l :?'5 ix lag ll :.,: :.?:.,,. fr T l' Q X ENE , lgmi 5 l : : ..:,.. : , .::, T T ,E' A:.. , rl ll E 1 rl T l : T T 5 I eu, E li 1 Randy Mills Laura MiTchell Charles Monloya Jeff Moran N-m...,. Paul Morris David Moser Missy Muncriel Robin Myer Sandra Nale Michelle Naranjo Nellie Nazmi Mirja Neigel Men show Their charaoTers in Wir sind die, vor aenen uns r nOThirTQ rTlOre CleC1rly Tl'1Gr'n in whaT ehem immer gewqrm hqbenl They Think is laughable. Janell Niemi Thomas Nipper Diana Norcoll Donna Norfleel There is no pleasure in hflving I've finally realized . ,, The lmpor- Q0 pleeidly amid The mgise nolhing To do: The fun is in having fence Of Being Earnest. - Ear- hasTe, remember whaT pe loTs To do and noT doing iT. nest, Spring '82 There ls ln Siler-,eel John Notaro Jr. John 0'Brien Michelle Ocken Renata O'ConnelI Kathy Olvera Foilure has o thousand explonoe Friendships mode in high school tions: success doesnt need one. will lost d lifetime - Sir Alec Guinness Orland Tobi Palombi Linda Paradis Kim Pasqua Kathleen Pearce things must be believed in The dreams ond wishes we bes- lo be seen Tow sholl now come olive. I f if 3. Debra Pelphrey Darren Peterson Matt Petersen Nick Petrulakis Dimitry Philipovitch if I did everything people sold I . , I hope we possed The oudi- dld, There wouldnt pe much left lion - John Lennon of me. 393' Kelli Piland Scott Piland Todd Pipkin Cyndi Pittman Trdvis Plummer ll wos nice knowing oil of you, our the parlys over and o new one hos jus? begun, M7 lv xQ jr Marie Prasch Kris Praler Trish Price Todd Priest Only as far as we seek can we go. Only as much as we dream can we be. Erik Prock Vansieng Prom Kris Puccinelli Tori Quisling IT's been great, have fun fresh- men! Alex Rands Jon Raltazzi Ron Reid Ann Renlziperis John Resso Cindy Richardson Rod Rickard Kelly Riley 'QW Scoh Risley Lisa Robbins Michelle Robbins Tracy Robinson Melissa Rubalcova Friendship is G special port of all ihoi's precious in my heart Best friends . . forever. 1 f nfs is dark Runyon Tanya Russell Raagini Sahai Chrisline Samuel Rosemarie Santos CICTS do not seize To exist simply iecouse They ore being ignored. J A f Stephanie Saragoza Michelle Saras Jerry W. Saunders Jr. Craig Sawyer Michelle Sbragia F Tb ii 1-A 'gicie sins just started! Mike Schneider Dan Sereno Dave Sellle Phil Shelden Karl Shelley Keep Ii Up -Loverboy 252 S ATHLETIC NOW LUNG osf Afhlefifglix Tubmcn O . Hd MOST LXKELY TO SUCCEED Cnosen by 'fne senkor ckoss os Most Ukew Succeed were Randy Strouss ond Ko to ren Jensen. 3' S ffw sihe f MOST RELIABLE Alwoys Oro und To prov' Qheipih h ide iii' 'N Q ond were P Zoocis Qui mo ond Julie Bur- keii. 'Qi ' Y K.. Q-dl--e ERS FAVORWE TEACH We-Q.-A 1 .3- I Thodsf ive TeoCh'nQ me deli were of mer C'eGQ+1,Gndiiwins2niOf dass' Becflusgorrl Kev Bogihers DV Noncyn Fovorife Te chose MOST iivoivioufxiisricg Kori Sirob el ond Shelb Through 7 ' y Curtis sho heir uhiqu w fheir ind' e sfyie Ohd ' ividuoliiy Qiiire. Senior 39515 424 fp FX .1 A Kelli Shull David Silva Sian Silvera Dana Simi Desiiny is noi a Thing to be waii- ed for, if is o thing To be achieved. Nancy Simmons Sean Simmons Melanie Simpson Christopher Skeen Keep your face io The sun, and Gonna Take a ride, -Boston ine shadows will faii behind you. 'QQ Debra Smith Not that I have already obtained Take kindly the counsel of the GH This' of hove already been years, gracefully surrendering the mode perfect' DUT I press on To lake hold of that for which Christ Jesus took hold of me Hanna Skytta Amber Smith things of youth,-Desiderata Kelly Smith Todd Smirtitt Don't dream il, be il!-Richard O'Brian nd Daddy, I finally Destination Unknown -Missing Great Art deserves Great Sacri- like you wanted Persons lice, -Miss Jane Brode Soares Steve Sory Hillary Spector Sonya Spencer Geoff Sprinkle 'N Marni Stagno Christine Stankiewicz Michelle Starr Sherry Stearns Richdfd M- 5f9PGn0ViCh Lorrie Stephenson Angie Stewart Brian Stiles Jett Stone Randy Strauss Anyway, anyhow, anywhere, I choose.-P. Townsend and R, Dal- trey 423 3 , , Sherri Stroud Elizabeth Talbott Paul Talley Rick Taylor Michael Theuriet Lisa Thomas Dave Thompson Tom Thornton Cheerleading-3 We loo often love Things and use You raise the blade, you mak Swimming-2 people we should love peo- the change, you rearrange mg Key Club-A ple and use things. 'til l'm sane. -Pink Floyd Dawn Thorp Shauna Thurman Chau Truong Dan Truong Alix Tubman Andrea Turner Kim Turner Karl Strobel Q' Josh Umsled Robin Valera Jamie Wakeman Do nol boasi aboul Tomorrow, For you do noi know what a day may bring forth, -Proverbs 27:1 Brelf Wall Jim Wall Whai you do in life doesn'l mai- Ter To anyone elseg make iT counT for you, ..,N,Sl . if k Q QT i Deanna Wallace Jeannelle Wallers Tracie Warden Debbie Walson i Give me The luxuries of life and I , will willingly do wiihoul The ne- l cessiiies. l filth Scoll Weiss Some people make Things hap- pen: some people waich Things happen: some people wonder whal happened. Which one are you'? Walls Don Weakley memories of all The good isl place CCC pole vauli, we've had will lasT forever, Lori Walson Do whal you wanT. Don'T lei ev- eryone push you around Tdmi WGITIYSS lT's noi ihaT now were all Thai old , Dui Then , we were Thai old -Eddie Money Roberl Weslfall Ste Nkrnv- 'R-'Ta' i 'iiii in ,e e John Whala Jell While Eric Wilbor Jeff Wilson Michael Wilson 425 if Paul L. Wilson ll Dale E. Wissman Joe Wong Joanne Wood Pam Wry all li I 'i it i al i its int Marlene Youngheim is anybody happier because you passed his way? Matt Balara Meris Wyatt John Yepez Bill Yost Time to face the strange Making your way in the world toe changes. - Bowie day Takes everything you've got. - Cheers Cathy Zirkle Paul Zoodsma Ann Zwahlen It's iike a jungle sometimes. It Be yourself. Who else is makes me wonder how I keep qualified? from going under, A Siror Is Born ,, if 10 Q- 1' Q E' Q' if X his as i K 1- A f 4 Af 1 fi w,L 3 ' ' ' ' 'L'7 lr f - , Q, gl as X mg iss ma - fx A if be kt if - 5 S is vm Q'f..: f'f+-Keeps' W 'N NSA . -i Sh W AT TOP: Scofi Weiss, sfudenf body president' Kris i-iinion, GfffSf,' Robin Wofis, spirif ieoderp MIDDLE: Dona Simi, srudenf body freosurery Marie Prosch: Michelle Cdrroii, sfudeni body secre- tory, newspaper ediforf AT BOTTOM' Kim Turnery iwoheiie Diikion, senior cioss represeniofive, yearbook co-edifor. V ' h L W ' fe fs--f V 5 . iz -2 .X.,,Nn '- 'ss N. ...M X :QQ--vffrfs f :: E - A g s. Q ifn'Q:-..3.a-xg-gf-sgww X .ww K , ' 5 Q' ,f sv of was Senior Wrolo-Up Wm W- f My 'J' 4 Ay, WW, f 5-WM ,, 3Z4'3W'Wi'7f7 ,,,, Wwgwfw 1 Q E W .. ' . V, V V g ,. ,. , ,,,, ,,A, L H A:,,,, ,,,, . by Pictures are described clockwise starting from upper left. Yearbook co-editor Andrea Dixon gives news- paper editor Michelle Carroll a perm at Adrian 's Beauty College. A group of high-spirited Davis seniors roots their team on to victory at the basketball homecom- ing rally. A familiar sight to Aa'air's Government and Speech students was his wall, papered with the covers of such TlME ly magazines as Time, Newsweek, and U.S. News and World Report. Debbie Maxwell and Michelle Ocken pose with their close personal friend, Mr. T. Three tough-looking Spartan football players show their pride in the Green Machine. Senior, Eric Knaak visits his locker for one of the last times during his senior year. Senior class ofhcersx CFQONT l?O Wj Michelle Dil- kian, Connie Christodulis, Lynne Manrique, IBA CK RO Wj Tom Nipper, Troy Javaner, Randy Strauss, Paul Zoodsma. wma mum:-ug oaassm ff xx 1 4 , ,Q Q 2- ZS.' 1 ,ummm 'ftipilss ,glam ggfgigxav BM 1222 was 411-V,-,,.w1L mmm Q Pnynand mm wma 'W ww, , A , 1 F' mrnmwfm ,.W,kN,,,M,W,,, .,A,, ,W Q ll' - 1w W 15- Uk mm S Q' 430 L wwf if of 4. Enthusiastic Freshmen 2. Soma Davis smdenfs supporting their team The homecoming game against Beyer. 3. Joey Castro and Jerry Silva snow off their work in rflefoi shop. fypicai Davis high activity court scene. 'ri yeiis her Team io vicfory. A. A 5. Sarah Goodwi W Kifiif. :fiw2ff2::w5ff::wf-- L 'K :wr S221 f?:::::: :::::::::::::s:::1 Q ' SJFHTXQM4-,Sfw K K K' Pzzzsrfizsrl--4 - W Kfszffimf ,wif ,:::::2:1s-Q:-::::::' K .,:::,,::::::: .L .. :: ::::.:4:: -3 11:32:12: W -if-,:::::: ' ff: wif, gm, G 5-mess. ,S-EI: ,:::::::::::::f' ,.grg9i5lfHXSil?i y -- :iff-::::: ?5fii?3::1: ' W ' '::g::-12212: ' K A :-N:::::::: :: :aw ::': 'Kw:::,: f::iig::::f :K:5:::.1iaa5:s::221-,z :g:::H'K 1 :. Q-44.2 4 F-:M Q21 4 vw:- K:-fW:::.,::1Ke:f: V' ,,:::f::. 3QTTegK 12352252 figff .W , -Yflifft5EfZ44 , ,, , . ,,, W.-:J5iiZ2?L2if3 t . :.,,:.::f:,:g,:,,,. , 7i23Z3Z xglsiiigzflliw Nfzjiilzlgi, jfgfiif W- ---:,,it,. 41:1 - , K, 42:Wg:::.::::::::::::::,M-13:1, 4 f --21xf::::::,:,i:31qg3 , ::1:f:::.:z: ::,,,:m ,::u,,:,, ,:::::,:,:3.,:: MSM ,:, ,mi ,:m,,:m .g:f,:,,,:,,,,.,::::,,.,:.N5 gy ' ,g::::::::.: :z::::::::g,:::::::::::::: :xii sg::::::::::2:::::::::.:::::::::z:z::22: 5 ::::,2 5g5iEzi:::t:2::?:::x32:iE:z5::::::::i 5555? 5355 1-1 QQ: Smiyeiifi' 'fwiim :zifiigsiiiiaih .5 'iw :Www K- mfziwiiiiliii Sf' Q4 :fi '?-'Wai .0 Z::iZ.Qxp24ww W W ,W :, -: Q.wng 4 A ,, ,:4w:,:h :,,:,:.,:::m ww, , ZSJN1 K :Z L3SZ1ZZz2ii::4 wi?-4 VK fggzif' .MQW Q ,gg 53555 .gli n ff42?2i2 :mi 22353 1::,:,: ,:4g4gz:::2rS5fi: M K' 'liqiii EW: 5355 -:::v::v:::f::::::mm3 :vm gg, , ,:::S, ww:5,I::::.?.:S::::::f':n::::g:mgg0: ...,. 4 W: wiegzz::::2321,?:2f::5'Sg?5w::::xz222i 5, 2 ,X ,WN 25?liP :2iYiLKi :25::E:,,:SS2::4w4ww :'.s:asz'g:- :,g,g:: :zjggzfgi :::::::::::.:,::g4:,f44f::::::m':::::::2 :ass 4:2452 ww: 3552225152154 :f:I15i2:w5swQgyz:f:3E mm 5523, mam :.3.v,:,::::g:fW53gggg,,i,sw,W :im ,Z gg :::::::::,::. My-,-g2g:::: 12: ff, wig: QiifwWm:3:z'g:g:E:ZZS32SS5-42'-ME: 33252: 322243 45i5i5ff:?3::3f,,,:5::e:N:::S:f:Z2Z3Q'E5fS59 4 '-if: mf- fg gfggisq: , , ,:.!5:3:S 12322252225 Skim: 115 i . pw K Zim-:-:::V::::::1 21:12 H22 gzztss' 'K 53: .::m4,,ggggg:'g Q53 'Z i!'fgZZZ EL Z1 ZfXQ5i?'QSsv -39 , fi- W 4, :::::::rf:::::::::,:g2g Y ?E55:::j:2s:Q4::r5:::5:f:E::::::m?5gQg2 Emi: mg: 2:21:53 me.: WiEE?2K:::?3W2523135252313-2222535222 :am waz' fu: wx: sl: nas: ::::::::: :aw gm: Ev :::::::2 ff '::::Ef.zs:m:::::::s-:::, s: :m::::m:, ,www4w,::4:-:ve--www-1Q-4. W Mq::g:?:,g:g:f:-QM,4:4,m:4gg44:-44wg-W 40133: ,m:.,:.,::,:f .:r4w4:4:g, -4 -Q:::,:::: :::::::::,,::: 7::::s::::::r:'2:::s2S2w:::::::K:-zz:ff :Q-ws:::H:::::f:::::::::::za rs:-::::: ::::::::::::::::::: :,,g::,::Wm:5g5 ggggzzggggg :1f,gg::5:7:K-g5:::g:,:,:1i,::K:::rf ,z ,.::::::::i:4::::g.,.:,,:,,,.,,W K :gz:wMm4: - ,.:.:P.W.,,., ::,,,.,:m6,,, ,, .:, gmggigglwb We 1:1 ::g::m::S::si:':::::1:3:m ::4:1: M-Hsfgfw::g:fif':::t3:EK3:f::KKf -::':1,:i:'Ksz.::E :aim a '.SiZ45ffL7S?S5i i?Zi.iI:QLL ilu :f:2x2gqg2, gqE:5gq:5KE.5:53E:3:.?:: ww: Q J 4 14: ,Q my Q W 4: f . .7 :ww I ,4:Q4.:::w:M-.: :N:.w:w:.Sz?S4E3fi25'Zi??'SK:K K :ww 4 S-zsxsazsws: :'g2?S::2?':3'K M I':5::f:a::E::5:,::5: f f5S1fW 1W iiligcqilillii '7'K:::-5:.t::a5QQifE??SEEi ..:,:,,-,::.,. : : , W4-4f.w--4 fb - 2 wb- . 1 ., , 'Hts ,::, fiitzsizh: .. .W . ,L , 'Ks :K , : ,Mm ggg::::::::r:x: :::::::,:::Sli:s2ri2Y2S mmgggw.-:,,::W: ::::::::::3:Q::,W:K -2w54gg,1:: :: -zzz,-:4:::z::::,g:, : K:i,Q:,:::z:,,::,:::..:Q, 'K'Y'3Z'3? :::: 15EEE:3Ef:??::::::1::::: ':::::KKfP:35K::'f:::i::: :evffiiifii-gifniiaanik, L 'WfS5W5ll2-7:3-'55'5 'b 1:15-1 ,::: ::::::?Kz::?5:::::,: lfvfiii K wr:f::::::::::: i Zi2z:v:m::::,: Nausmwwwfylzff :M :::i:..tfI L :ww f3'i,'i:::':':Iis:12l3i :ti 31 KM . :'f:55:,.'.: : ...fm-.m:4:,-4 f ' -vv- -M x Q f :JLQZ :K :ff'SL1:.:43fi2fM2fas-4M- ','.iiH',5'H:'PA6,a-ish, . KH' K , 1' HW: 2 wwf 'S-W:'g:w3':gg::1g:b::2f:323155-Siiifsmm-MW:iMT::,::4:4:::.: ,K,,,wV, My, Q- 3 U4 9 wxmww-cv' 1,2 4 Q www- -f:2:gMg:3g:WY: i wizis, :K'K'W,:' :'2'K,K12'w:-M.:-N 4 U5 es. - 31:4-awww'--Mywfgf zw','wfff4,wf-fM1-- 4 35:3 25' 5:2 W: Riff?'Yirsfr:5:::,i5Xf5i::::2'1fif222227, WW: S S:::4:f3if5??:SEi2fsiyK'1:: f::f :Z :: :KZ,lK:.:w :fK::: mfs: E ,1f::g:g::f .57993:53:25:?:ie?:f:i1:2f?iHifr1 il X'5?55f3',WffQ5a55?i5?f i::::::::::::::W:::::3:::::-:::::-1:::1::::M::::::::::: ::,: L::,::: 3353-Qggg4:S1gg:,:m,:,::-:zz:::.i::: ::,5::s: 53YLf1lZl1i,gZ ,1s::gg,g ?S4f?:::::::::::::::::::::E::::S?:E:'f:::: ::::::::?::::f'::Ef?::f:?s:H::KfK2:fE:::::fs:::::::f::s:sz 11z:::::?2:::::52:52:52215f4SiW22fff2fiS2225551:Pi1i?Ei?2::?5i5::kE:::::1 :4:::E:::a :M:Hg:::'i?::::::i:::::::::E:::::::::::SSH:rf::22fS?1i:55?g,43fw2?Sf isifiwiliiili' Eigfisigxlwiwan-XQGGHQQHWSSQGSWWQWK 2187395 'M gg bwfffw i :QW bi 31 Mf'2b5Z?2Z,5 3 ' Q15 f'g'1'Lfie'f2,fiUg,,f:,7,f' f1,'i,l3,:2'75, '35'b7gM?,,:,ZZ?,1i3ww1 1, Muwsvnq, XTQSZ5 ff '1:f,N-gwliivw, v vw, 7 ZW :i'2'fQf K ' 22 3g2f,QQ Q1:,,.j.?'fU Zfflgf' ,,QZSj1'fiQi2'Q ifZQ,giW Pay: W: K: -gavwnzwi., Qgww'-45:4f444wMf-mbzwfewggggggggrggt g,35QZ:QZf::L::,::,,.::fg Z, Kg2w:E:4f,L?:3S2.E1:. M ,W 4-ur, Y,sNf,'. s'ii:::.4.ww-4-X 44 U Wig, f:w,W,wNg,:4--K,: mwmw 1-:ww PK' .1 2223fKHsKT'f:15Z M :Jw -, M325 24:42 ,-M1 :MW ,: 1:-,.,: ,f:,:,1:,W,,, W M-:K Qs? N U wwrwif ZQZYESZKZWYSY'EE?f5i?S2mggg:::g:::: M: 'ZifHsZ2S2i:i:f:::::::::::W2::if 'K ' 1'm?f5ME2::5 :5:s:::::::5:::::::::::s:.1:::::::: 7: :::,::gH? W 2'x2i3 'fSi K ' K -2 A ' 'Y W :fi2:2:: 335535353531 WK A A Q' 'U W Q::::::s .aim 51551 Kf 12:1 -:::i,'Wf::i::::::' ffl' 75313925 22:51 e., Wiii, M A2231 Km? .wf WT U' , 4, ' :NSS : g'Kf2i?:5i ' KK: :::fK.: K:K:,:::::: :::..,: - Z: U, ,g gm k:,,3,.:.:5.. 335537 ftii?ifif?5::15f2fWf:f': K '1 -555-' Nia. iiilif 45 Vwfwfff ff' MW 5 :::. :fT35i5:i2.:::::::::: Q :,:::::::: : mg: 5:5 : , ,, . ::::,:::::::::::::?s5Z2, :.Z::, :: :H 2212252232 ::::::ig gi:::g,::::K:2:s2:a::::::t 232: :::,,:::: :,:::,:g,g:3g::i:::.s:.:,,:5:541:sa S, ::gfmggg::g::::::::::ay ::z::i1::::,::i:::iT: M .Zilillibiiliiaiiziiiifiieiir N,:3:S::,Y my:,gggmg:g:::::::::: W. :::4u. wwe:::z:::::: . :, :L ,. 25624: 35522555 :::::::::::::m,: ,:rg:i:e::g::::,::::, Ziiiiiifihll' ,t:::::gm::was:::::::::::::::::::::::::::s:::: :av::::::::i::::::::::::::.Wx: Q44:-:MM ::::::::::::::.:s:22azisirzpifmfssmliwf-4: SK zziizzziilllwwSflwsizisszi:::5::f:::f:::::::e ' 253: Lf 2-3 Weil Vffziii WEE-::1:::::::: ::::::: f:::: :Q::::::::::::::::::f:i5::zz :::2i :K1S12s2ii?252E22- :fir M'KiE2:,:::5:::::1::::::::::f::z MPX:?:iife4f2Pf2fi22225f5?1i ' :z .g,,:f:::::: ,,::::::., wsu, ft, ' ' -32: ,gm 122:12 zisxiifiif. 5 f:::,g, :::::::1, :wa ::::a::, ,i:Xf f 2 K 442519: :Q ::Z:J::Zz W2 652222225 NSY ::f3::::: Lil ':ff::: ,:L:::., :f::2:g:s2335 gg, Zsrlfl: ,:?:5::zf:::',i''rim-1' .gf42ff??sf:::::::12::'::Si:1:is:f,f, 4, ,,1:555:1-:r:::2V::':Ki2::::ff:, 5TiJ?'LK'1-LKgiairzffzzizzilifiiilifffm- A f- :SA,-Nwi?ff3?f5i5:41W:Y':f:f:Kf,KU,rrp 21:Wg:z::::::Z:.:s::rif?i2217N4M4,iK:f4:f:5Qi:2:I'3?i'ZZ4ilf:?l ri1:z,:1:5 Y,4:'iW1i:i:f:?9 ':f 1K A ,gA:?,,gg:g: - - M M 4 -4 44 , , ,. ,.,:.,:,,.:::::m,..:.MW. 4 a4,:L.,-:mmmwwg-f44w 7 4 4, ,, ,W ,,,,,.,, . W ,,,,,,,,,M,f,,,,,.,.,.,,,:,,w,,:,:.,,,.:-,,g,.gg,gmg,gg-5,3433 misss: :V ze' :iii M I ij: W -::::::::::1 2:1 fK1::- f: Q : 2::::::::::: waz: :KK 25531122 1:21::: ::::g:::, :z:::::::::2::::::::: :::::: ,. 'ZSYZJEK -Kf:w:::::::::::::: sm: :: Wwe: '4::::Wf::::::w::::r 1 Piswf? . 2if2S:'::K:::::::::::s:::::i ::i::: J : f :::1i:: K ::i:2::Z?5:5AZ1?Ej3ifz:21:i23h 522553 44: gm: ,::::::: ::::: '::E:5:g:hgs:- 4 W :::fK-,Y :Waimea WWE: gain f3::::::E:S?3iiiiiiiiiiiiiiiiiiiiiiii viii? iillfiiww::::z2:::Z:::22:2::E:E::: Em: TEES? 5335451535221 rim: 3 1:1211 fmfzscfzfz. 3:97 ?ZE iEg3:::::::::::::::g::::: ::::::: 5 255553f5f::z:?:2S:::E:::EE::::5::?fi :::EE2 :E:::::iffl?2?1Sf2fl1fS2fs::zs:::::::S::: SEM: :::::::E:5:2325Z2g2He22:::::2P24:2:::: mis: , :'Kim:::::::H5:igfiiiikiiiwiiiszxess :aw g. :Nwaw::::2:.,a:2z-fv:wfw0:f'3ww wa N W - 4 fwefw:-M: :::::::f:::::MffEW :ffm - 13:-41wfwmwimmzia-, NW MKS 032211 - W-:f4w4444m: ::,::,w:::::s:::::: :wc gg22533252?2z?2::z:::i:::::::::::: xii, - wig s 2.K112:::5::::: ::::::::z::::: :mfs 53523 :x:zw:::::::: :::1::z:ri-::::::::E'::?m ifZiC21U.'?l'gZf .wa . Mg. ,:::,,,::,::,,,,,:,,:,,: :::: :::-:1 z :::::e::f::::::,:::-:::::: zzm: 3'S5,2!,22'1Z5S:QYSi33Z.L2,,'1ZX,L,Z3,5I,.1i.i?LS5iZf ZSQSXS p::::::::::::::1:njg:1:g,:: :f:::f:: . m:.:z:::: :: :::::::K::::f :zz M41 :rs-::: 1 393:-4 55535535i W'3E?E?'5s2fSQm2'sTRia'5: 5:42222 i mugs 53593103 UHBEZQQEZZBESZZQXZSS 35321 5-is922251ii2+':2i:::f:E::::i:i5:,:Ei:: 1:::::2 Q gggiiwmefgwD5m:3,4,f:4,Wa,,fg:,ww.,-M z.,ym,,4 3 -uwwimi25::z:::::z:t::::::::i:'E::: 5:1152 - Rysfjfj N ww' eww-.NSN uhvwiweomnga az-wax. I mm:S,,z i,Q 53:3i:::D2::'::2'WK',Si?Z9g.'fZSZQ :EEHSQQXQMW :W raw ,M W4 Q.-fm W was Q I Q J, 544, 4-,44 W WW ,, :, , W., M ,,. , Us J Q ww . W ,,::,,,, M, M.: W: ,Wm ,, : W, . , ,M -- . :W : :, .ff 'K-f,ww'4,4,5s?:WA2:'ZFLSWKEQSSW, gum.: :,,,,,M-g,fw,gg3,1:3::::3:2Sm,::, mwzgp ,::,:,4g:,:ggf'::::::1,gw:,.,,:m:,,:::Wx 553235:::f:,5g:::::a:::W. N: vgggggggtjzgsiiiiwymwlfmlifiw- Mb if ,,,g:H':S:1':ziiwilaflzfkhifi . fZ':iS.::.Raf3 f45sT2l53?fK:5:Ew? SVWxZ524:SS4:2i5w,.,,x: ,K' ?'f'24:'2'2i.S,::q:1'gf57g1ygmwww :i,::.,, W nf-w-:,fsf::f::::,-:- 1,-ww-14: -:sem 3::::::::.:washwwf-Mgg,::::::::4:m::::::f:::QU is-'Emir .Q 122225 - :wtf X2:4g,:w:w4ww-w:fe:-e4-f--- :wwfm:-f::,:::,:,i:2s:::'x::::::s:2::::f: :v::::f:::::::f::s,:::':l:::zf::::-:Y QWSSQZEILQ:w44'?Sf2SSP2i22E5ES?ZS -53m-if-1-4-::: :::1::::'.::1:Ki2212SGvwwfw-1:zsf:::s:::f L- A :::::::::::2Xi:::'::::KK3::::2eKK,21:2ai2,:::::::ssfsmw-hmi5'22l-ff4fi , W K' 4-4:20:44-9:45,-f:44h-Q-Q44 ' 5533355531:-sz:SEg:ffizizsigiiikgigiiiiigiyWzzzlwizil:.USMQQQSZ::ef:::5:ki?3f33,K?.m'Q'EM4i443gEE,1:11 45:25:12 U Nz: ,- g:,::i:QsJ:2 riff? Mggggggggfgigziizigig x ::?gi:::g:::5zilfizuzlizbifipiiilziiiitzits::: 2: xiziggi- ::::12:::::,::23Ei:1:::E:g:g -f Gsliiszzzgmigs WW -M144 ::Qm:W:W aww.-0 M-.W im: WX ,, 935' W: 3 4m ,J Wm-W4 M ,K mtg: :Az ms: am' K ' ' K K KKKKK K K K-K- KK KfKfK'WN:'4fM-me-Q gem:3ii5g2i:Zv:.:5:5:f2'W'vfemvwmweb:ww-fffew-aw, ::.:-fawsf wwwwzssswgvssewawgA221444 MWZSR H x : :I N1-1'-f::':s'5. 1 Mmm W -wfrggsgmhww-, :Nm W, ma K:-:W:KK:::::s4::-me 2 W: W ,::-:-:4,- fW44:444--444- ,4 , www- M if mm: W, 2, U vxmgwawg,-:Wwvmwvqgsamfxwgawvmxgwa 4 5, ,4,,m,WS,-0pzw1:g:2g,,,3g5,,i,,,4.,- ::w:Lf.Km:M,1:. 'f' H wmvgwk fy U '. za 'WM :MQ M ,. www: my' . ww 1 ws:fbgKf:H':':'f: 4' 'Sh 'P M'B3 bm'K'N 4.,g,:.:Z-,:,,,sg?5.,:W3:3,: gh- Q, X MgggggewwwwMvwwafx,v:YM 7,,,,:W gg, H'-vwgrywzg :H :::.,::::gq,g44::wwWm WM W4 :::.: : N ma: W W.:,:. M A: F , Www: : W:-:::: Q, ,- 4, :ww f::::--M:-4::::zf1f:4 :::-::4:::::::::::.: :w .Q :W M ::ff':,4: ::EH W'WMW'W'WW i::::.1::::4 4 :Egg-vf?S:W Q:rms::::::3:g:3:mgg:5E-:3:g:E::3g:::,,:f::m:3:iQ::S5:y.44:5gggg4::-fiiwiiwigilwm, , gg: :ws-445W 4 , as i :f::::::.:,:, xhigifgmg. 4 3:53-:::::K':::::::i::,.,:s,,:2s::::::s:a:::::22.:?-:Rkviiqwiimway1?wi-41455MaiaGSM::'22::?::::2m::f::::5gm44w,,W::2m:S:,:.:,4 M: xv H4::m,::: : , Q - 4 Q 1 :mm W: :,.a:x4S4,4:4-M491 -V M: we A , -:M f 21 54 2 :wzmwiww 1: WM W: M : :ns .,:,,:::,::,:::::: ,.,:,,: mg. ::.,::M::,:.:::4 Hu: .: 5,4-mm. ,-m,,Wf4.6s4wm4m4f ww:-Qw4f4v42 N :E :M wa 2 ,,,w:mWmM::. :mm :Q :HZ :. ww :.,.::m A , 7 www -A 2 Q ws: 35 , .4 iv -SW is my mlm: :f E' gf' W NM: f1:ww:f4vw4w4m :M-. : 41, 4 V , .,,1,,wf,,g, ,Hwy Q,-.44-6, Wmmm , 4'PSW,:,,, ,mf :w:m:aw4 3 Rama: wa 4 W, , ,, , , ww. Y ,f,,,:,,, 4,424 4 , :M we-:A ,, 4 ,N -1: -:M mmf Q gww 2 mb:-:MW-4:4 V Mb ,:,fH3:'s W 2, :uw 43,5 4.w M Q M4 akfeqwwqgwg Wgsw M:,,,,g:,,,, Q ,ga-4wmw.:mb :::::::-wi:::::Ef:ffvf-2:42-f4s4,ggwSggSE Q E :4:4w-W-f:::2::z:sg2'4g24:f4 : 32:22:25: ::g,f::m2f :S-w-A221 2fi1s::::::. :fa ww- :::,m:w- - Hy, ww-: Wx:::::::e.:::E::::::sw::::1z'-:Don XSMSMQSQSWS222223:::::::sfMw:::m-wv:::3::f44M5M1ii:s::::KK1m:+fz:: 55.44::,,::gw.w:..:::::::::::::E : W ::,1:Z5f::32:Q2::m:w:,::5:ESWQFw::44:w5s:::.Sf2'::'s'::::::P-fW::::4:Sf':If mw:::'s:::::::5::::P::::::::::f:::22-Sh, I-::::v:: :::::,:::::::f::::.f:k:::,:.f:::W:::::Mwsw 4424-E444-4: 44 :wmv-44444,4S,-Q:m:::a,:, ::::g,,g::g::g5mggF ,,2gg5:5:5:::::5,::::z::::::::, , pm, ::m:: : , N : .::.4.:W. , : Q :N Q. L : ,WH :M M: , .J 4: , , :::::4., , , , : , , M W fm. W M 4 M: M .. Q: ma X: :mg , , M W: :,.:,:,, ,,::::: g5g?::::::5mS-13W.,.,,:gafggggwggglggggg-fg,,g5s,gg::g::gm::,sfg,,:,w:WmS,g,,,.,f':::2SvKS-455iw345154:WSMQ54:2:::::,,:,,g,,ggmgw415-3:4canw,:mm15:g:::g:,,:: Qmgiigvgiggggwmg 5,,g:gsgwgggrg:ggH:3:,:::::f::,g,4.W.,:.,::::::,5::::::2 ,:::::fW :Him-443225 w3M44iNS:xmmS::, :154KK:?::g:,fsf:1w4m,45m:WW,:z::,, ff ,W1W2::::::g-4414w:::m::::::Kz::::a,:::::::::::::f::::::::: mW:m:::i::::::f:,:,:Ww4M-rm:-4155,25w4W:::::aW:m2::f::::::::::::::K4:::::::M,,:::w:4w::::zv:::::-::::::::::::::::,:::::::::::- :::4,4:wf,: Wwsyf ffmwggggggg :fwg+4-fwww:W:::::f:::::zf::Ez::::::m:4xW:-wSm:::::::m We.:-3g5::m. 5: gwymww::W:W::w.:WMMM,W1I.7:QyiWmg,,,,,,,,:,Qgg::4f-wyfggqsgggg,gg: .,,,,.:,5:2:?5s?iff-ifzzewmw4f:w::1:,:::, :Jim 4 4 wgwgg::1:2:f::Z::mWw44,2Wf ,444 M :mg wzmwm53N:g:::,:1::::ff::::zzssiiwz:m:3:2EfS:1.4K2NS52k:m:w.::::K::512:-51::ff:7mmeQQ:::m,,gW-:,,:,m,gEgggggggw- e zz 1-m444m43,1wm f:w.:::Qf:K' 1 '::,g?:::ixzsmggigfiztzzizzfzgggfw3 :''Qj:,::M.0,Mm:pg5::g2:M Y :WMM::,::::y:4:::::::,: Km.: 3 Vw-:m:3ii'::::Zi:: ::::f,3s::': 'W:,:K?Ew,ZESi2?LI5S?4-f ' ' --:W-fffz:fw::'ff-we:M 14.-,if 'tiwwWww-m42NQiQ:JQ:4s4:24 'WIIKBZQZ K :,m::,,. M,,.,.,:,:,,,,:::.,,::WW.,M ,: ,:.:6f4mw-41-1414: :wsu-4 -:fm-wf4WM'ww--W' W T'::::aFa - - - f 4 'v::.,::,m:,..,.:m Q,QM3g3g3M53:ZW:5ww:-gf: ,,:,,,.., 1, M4-W4.mMm::.,m:.ASM, ,,,,,,:,,,: SS?S1i:2:i': Kfzfszzzszfzzzmzfffzw' :::f:::::::':::f25::i:::::W ',L:::',11z:22:2r::i::Msax,, .44Y:M:r: ---4w:::'M::f:::x: mm-114. 41:22:22: ::f:::K:::s:::K,i:::f f::::::::gKf rzizfegfi :, W 1: -:YQ '::g5gi:::: Qg::f'K: IIT?5iLif3ZZ5?Z2II3?S,Z1,:,: , :?::z::, - :::25?g::?E?::zff:gsg:: V, gggzgggggga i, V jg ggjgg :gf E2Z:,:i:Zi:::Zi:i T i1::Z?:::::::1fi2 WSF , 2iif1iTf?2S:f:2:: N :zz::f:'::::::::::::::::1:: 1- -f x :::::::::::::::f: ' i::,,,,ig74g,i ,. :....,:::,,,,.,.,:::.:, ::::,,:::-,gm , f',::..: ::.??4s4w:f4ww-:4M- :1g':ri:Z'3,2EfM:r2:i:, , , :3ggg53g:ggQ,:,::, fm,.,.:,.:,.,,,g.,,,:,,,,,,:. qgwgf- .:.v,w:::,::,,i:x5 : .,f:::::.:..:::::::::::::,:1fA- Qwwww-f:W:f:4-4 655335572222::zZ:z:::::fH1 ' K K i:1a1::z:::::::., w ,xxx : 2-?'5,gXiiQ:sms:fsfyzsg::::::::x:i:55:s22:w2 1K: K:::,a:i::1::::::::::::::2:::zzgzsi. W?--ifwef::?E::::K::sc::,:,, :Hifi f::::3:ZZ32iiWi:K:::f, i:::s:Q',:1E::::::'-5::::- 1 -fi 542 1- ::::,:::gg: 1 5' , ' ,iiifgii 21:fi'32lf73:i53fE:5:?:i5::::::2'2L1J2Q42:ss::f::2,if4::Z::::::::55:::::::: 2::22K:S:2f'Lfa::1:s:252'::2:f4r1:: ::2::xf24i:Qi: :aifgiliiiih -1-1 2, g2,iv,:wQ4,g0ggf4i?l:4:5 wif ?g2f3fEE::f4:z:fmw--442422422232:2Y::?z:r::::::Kz::?::::::::::i?:m ls: :Se2f::::::i::2: , :::::.'K :, Q: L :w,,:m:K4m4rf .,:: : z:?:::r:::::2::m444,wgf4-::::.,2::4::'zi1f-M M-lwmffw-N1 cgi?:ff::Q:1:::::ES:2??:::::::::::: ew: :K Mhiiisiiz 1- :Eggasrlfw2:41:25-WEEK-Yi45Q:E-:::::::255:32:5-?25??222:4:::::2:::::3'::::::::::fm::f13,5Qgffggm-::::::2:fi22f::m:::1::.:::-1 A'S5:5515?l53Z3SSiZZZ5S5Z?5Z2li,yliizfgggggqgffigfw ::::::K::2::::::::::gg:fyQggggfwgsza:s:f::r2:::::z:::m:::::::::: zsfgsii ' g::::::::::KM-:::::::g2ff412232ss:g:-wa ,:::??:ww3:-:Swi:?w:,s's,: ::Q:aw.4Kw54m4W:-fmafwQW' '::2zi::2X21?:3:i:z25,253-:::v1:?::H Q-vi2--ffl:-?f?Qfs:::K52'm-ffweza K 'S21:35,i22:S22i:::?i:25:-QESKKH :f44f44sw.:z:f:m Wiilisiki2ZS?'53w5:::f.:4:V24-U1Q6S2lSZ5EZ3QSf2?Zii?si5i25?25E25:BHK iEd,5:SSii:H:i:3iiSSEw3S38:m 51 ,..,..,. 'Pf?:::,::':: '9: .A : wg. Ei 525 5, 34 1 . f Iilfaii: A E .............. ,S .::.:.::.:.:. 1 N '-'- SF ..., H WW f ' '-1' 121 'z ,M EE SE! VE 'E Y W '12 WI. - ::-1:-was 1: 51-1 : :-:-2 f -1:- g:- 5:5525 :.F.,., ,.,,:,,:,.-', mmm ' H 5 S f- :I 1 1 5 ' E .,.,......... 1111 .,,,,,, ,,,.,,.... ,, ,.,,,,.,,,, ..A. W W 1 1 ii l F 5 Eg 2 1? 'E 1 '-'-'--'- Q M- 1.1, AAI, - 12 fj Q 1? ' -mmlmf? ,.,..,.,:1.:1 5 , A... W W sil 1 , gg i igim gifggisii qg Eimwaz 1 e Q M - WW 1-11 ' 11' :fr Q5 -5 2 1 :E 2552 gil E SXMME KT in 1 N :..5: .,,,::: L mlm ww 2 5 1 1 EE 1 L is QQ .... . Q W .1 N,,,..,,,.. 1 M ...... W ., ,.,....,,.,..,..:. ,.,. , , , ....,, ,,.. ,... .,..., , I 1 . E , 1 WMM? 11111111 :,V .:,,: .1., -'A1 ,.::., .,:.. .1,. '11:'1' ' - H fy eg -'----' W 'Q WBHE 1' :-- 1 .:...'--... ..-:faj'1ia2f1512 I1'if2s'f2 ,-,, 55.2.2 .V'V'.--'- ' f :':: fi':: W::2:'m 'VAV 'PE' ' V':' 3 H' H :': 51 sig E gxgggf as L ii s iggfgi i M559 12' 3 523 YE -' ' 1 -:-- 52' ,s Q . if 21 5 w w ig Q 12162 g iisi M 1 1111 s f 111 Q Q ...L :f f ... , ...., 3 7:- 153 :E EYE f?1 M, ,. 1 1 1 13? wiei gaigig wie? gg I , 2 E 1 Q 2552 UE 3 ' E5 1' , 2 si 5?Q3gE iii ?i 5ge 1 ,9ig 1 f 1 1 1351 ig f gg 21 1 QL Li W E? I K Q t' WH L 1 zz 1 E 3:i::5:s,::f:a A 5 1 151515 1515 '1 M! VE 5 1 Q ' ig' f : B1 4 , zfssi' 321 1 fi 225 ' 1 ,-1Q'i , .. E? fi! ,VME 2 1.583 E5 j fm F 1 1 S , :.- M1 , -1 sg W 5255? 555E51ifi2ifgQ?E?Qs. 1 mfg 1 .61 1, 1-1 . H15 E fi fi 1 ai gf?5s,2 f fei?EE?p55Es1fa H5 W. W fi- 1' 1 , -QW 1 1-.N 1' 1 2551 E Hg i1215Eg121g 1f.121?1?a51 ,1 5 1 ' 1 1 1 . 'F 11 1 35? I E: '55 ' -. -: : fl 1 :-- 15112351 'X 1 I ,1?1f121611i 15515i52f 5 115,35 1 2,1513 V v 511 2331535 EEK digg ffgigg .. ,,, L . ' e 1.-'sf 1 5:2113 :-- 1':5:1f:5 'E 2 Q g ESQ ggfgs f?1 gig5i 15? , gm 5 'W fY5?eE?.? 35g 1555532555515 5? ,wix 1 A,.. 1 Q ff 35 we 52 H KES? iii V H? Q I x -- 111 gi A',A iw -1----fA. .fi 11-1 . K H AA: W Alll Z .. igfgw1??Qi3E?i?,i5? E Q' 1 1 MM ,:., xiiziiggg S555 N m k., t Vhhk -' .-E2g5::: -:1-a -:ggi , 25 Higgs? zilimh 5563 . -- fs- 3 ,.: :,i:., U H - 3.5225 2 - lniiiillfiiiii F 51 3, fr 111 1 - Qfk:':. :.' '-:' 1.1 ..,. 55555 1 H H33 5 Z5 4, A, M. U . . I I ,,LL V L 3 .,... , Eh W, 255552225 522 X' E! 5353 52553 ' - 11 Nm 1 9 .V.. ig X ...., E 1 '. k ' X' Lkk- 1 - N' Lkkl W K' 3-ff? gif 5'I .:-. I :' 5 235 553 2122 53 1- 'W5 .:., fQ ' Q X QffiQQ2Q':f2a J : ' ': ' ' iii f!SX'H ?gM?i 1 ' 2' 1 'Q-1 V E 'A': :A':' .:.: ,.:. Q S gf g igE i gSsi we , 1. ,,,.., i: N ..,: , V Ilvnlnbn .- aff: :-. 1:.. :1:::.::. :::,:,,:.,:f ,:.f.:f f'ga, , 1 ,- 1 :-. Qs ...,. .,...., . ., W ,.,.,.,...,.,.. 1, ,..,.,.d .. . , .--v' 1 -v-.5 1 :-'--'-:'-: ' E V AAAAA W bbAAAA W ,,.,.,.,.,,.,.....,..V.,.. .,,,:,:,, :.,..:. ,.::.,..: ,.,,:. :.,:. 1 Z . 11 1111 1 111 1 1 3 lf Q 1 f K 3 ' 1 ' 1 QE! 1 : Q 1 Egg, 1 111111 1111 if 1 11- h A- '11 111 1 S 1gffi4,.1 1 , -1 - X ' .-.' ' 1 1 b Q1Ql 1' .-'QQ 1 1 Egg 1 N ----: 5 K 'h 2 U 1 1 '-,Q ' 5 1 1 , , n I, 1 1 5 .illllf ..-: f ' X W 1 1 gigfgf efi gg, ,,,. ,,A: 1 1 .asm ummm . , ..,,., . 1 1 ES VM 2 9? - 1 , l Q QL i . 2: E Si? gi' 1 ih, 1 2 1 ,,., , .,.. 1 P if 1 U Q bb' 1 , . 5 1Q12gE5i,5?1E2,Q1gi1gf1f1 2,11 E! Q M A 'Q if F' N 1 i 'N 1 -ff -' - 15515525 11151 11 ? 1 1 ,lf 1 1 1 1 1 , Q W l , 1 21 W SA QQ di ffs sei 11 - zrz Q 1 X 1 EW S iii 5 ' X' 1 ' f ' ' :': a H255 1 A . f s 21 1 .1 5 A 5 a 25 , E EES gf: 2 ,... Q 1,-.1 1111 ' N, f1 L? QWi1 giiff i 1' N M . 3' - Q . -'-' 33 Q 1 11 X ,gig fi - - f -, 1 LL- 2 5 - A -. 2 ig 11 1 ,zlz .qzz 1 1 1 1 -if ig 3 E ,ga 1111 . 1 ' ' V E 13' Wim if 11 - 11 1 1 g 1 M,g312g1111 22L : 2 1 ..., K - ,A - . : ' Q - LE f I S222 .... 1 - 1 'W 11 J ' N fe 'Qg 1?'iEQif?b,Ei71ia'E '-S1 ,f 1- 1 'Wi Q X 1 Q 1, J 115515 2 111111 1211553 is 1 13 1 1 --.Qi 1 1 ,. 3 X EN -.133 1 1g 1 ' f 1 11 11 1 53 5533 1 if 1111 fi 5 Z A 1 if ' 1 ff E if 1 '11,Q 1 , 1 W , Q' , 11 , 2 1 ST I 1 - 1 . ,', 'f 53 '1 g1ggf552g?g 115114251 5 i s 5- 5 1215 112212-f '15f1?2f:. H, f 1 LLLI Q 2 1 11- gi 5 'Q 1 55 F gig 1353 . . M 15 .Sff,1.f.,Y N H EE 5235535 1 gig? gg? 3 fi 5 'EES IIIA , 11 . A f :iw 1111 E X ' S4 11' X ' 351 3 gg!EgQi5g?g3Ez1g 5222355 f 1 X 1 .1 1 f' WHsw,.5 X Wg H 1 E ' 'Y' 11 i, 1 fix ff? 551W ' : ': , II 'f . 1' 35' W 1 5 1 Zbi l , 111 1 1,1 gg 15235233 ' 1 i ?g a1 ,Q ?'ii AQ fg22g - 1 Q Zgfsia .... ' 5 1 :'. 1 Ig Qwm, g agyw M-12 H 5 , E is.. 5:-gf WQBSWM1 wmv A ,1g5?lTE1mZg52'wwwQ'2?52mwwggWi m -.,..... fvwzfwwfbw m x ....a QWWEQL-:I .:z:s::Hsg4:fx,: :.: .-:1g::21!sa1,: i:-f:-'f'-f'-'-l:--:- :-f :-g ------- ---:- 1 5 -------:- - 1 -:--- Q 1 F1'ki:m:W2'w2553?2f:2224g?551:QHQQHSSWWWSHYSWEWSQWQQ ------ '-1V : :22gf3wSH?ff 5?sf2 S:?3p f5 : :1:1:1:1 -1-1:1 M .:.:L::.:.- :,.:-:.: ::..::..::: 2522525255 --- 1 , E2 1 'f fue 52 51 Q gm -55 :3 EEfi2.EK:: fi3 W . L L LL www HW iam f5 g52:a:Lg2' -K-Kfi sgg 12 : , :H a w gag QYMM KN LLLTL L-L 5 E L L 2 E 1:53--2 -r5Eg,:: ?g::..g:,L:fssf?::: L5-'L .:gL:5--' -S-f--: eagg 5LL2g5:ga 2 L Ei mi .1-52:21-A-L 2a3L,:u:5.ga?5e-L:sgglEiE :-:: g:-mg . mgSi:gm,, :s:2 L:-v:.L',-WL.. : :-5:2 'E :2.- I:'- gs'I5':i2E:,-Eg :::::.,L Egg ..,,. .-.. if X LL ,,,. L W ,Eggs x g eg gs 1 LL L K ...,,. L ,L 5 ' A3555 ff g g 55 .. : SF gig 3 is L L K, A :gl E: -ffffzgi-:1: LL- K ' f Q ww gg 5? 2 I A A T 2 5 f f X -E::a:L:- - - - f fl ' K ff YWWQLMQRSQM -5:25:25 g m L i f 'ESQ 5 i , 'X A L asf L Q ii X ,LLLJK Q A Z U V 1 f K:-fK N Q- 1 , .:,::-.sgrgg Wigan sv :L--g.:-L: gf-a.,5.:: ? is 37 S? 5 L Y - Legg L 221532, 25 lj -. 'L K- A 1 251522: E5ff'fELQ52-EZEQEQQSEL , iw ff' kj rg, if 1 .L K g ' N L 4 L A 'fgfK?r:2: wg, ' V T Q51 Qgggggi. Q iimx 35531, 5 5 is WSJ mf KK YS N L L g g? 5 Q E 2 ZW ,E 5--L,,,, EMM K 12:f -La . L K - , - - K 2-La: R I H 53563 UE 1 'N . EE 1 Eiggf g -'-'- 2 E S23 E, 1. 3 -'K-f2::sf5s:a::: 3,::s':'LL. :aL ,mgi2Sgs?2g,iz3135zW,i A523 Kb Kai 2 2221 L . - F sg gp. , 5 , ,L . aged Eg gs Q:g?,2,,,L,,,gkg.L.N,,,lx:,gg?,L H I5 5 ,E .- W., Q. 1 25H:a?,g5ii:5K:g1QEgg , S15 Q 41 L35 Q 3 K ' L L ASSY -:':E: :2:-:E -g: E: E. L3 if K ,L wig f L KE H ia .LL K ffm, L Laasag 'L' jk L VVAAAA X L a2:L LLLLLg-g:-L,2f?Ef ,-Lg. L Ei ?5 :K KK ::s5 I X ' L 'K .K KL 7 K Kgg-::?b5:,-:-gg-5:g5gg.:L,: gg: 33: U S L. L- S1 L ,W ggg wl ig ,W L- ::,3E'E5a5'E:, -g i!-52: ' .E:::5?E 1 LLL 1 KK Lz fwi LL , 'K X I L SEEEH KQE E2 X L L L gh S- ,Y L 5 - L 'wi K Leg.: 5 E g i: Q K L LL L. 7' L' L L L I g a 2 'EY vb K5 L H., as 122 L, Sk S NN L, L W L 511555,-:L g: -E:g ?E,5 'gg L A Q ,L L M ELE in 5, I 2 K 5 K we 55355 1552 'XQL L ,1-'N x., 1 235195 ig LL V., N L X g if 5? L X., Kas Ugvwg sg Eif iz K L, 555: LZ. Q igii gwgig. 55 5555: gg ::s:22L:Lz': , -. .L Q M ,L zgifiii-f1E21L: 1- L .LL b SQ 255' 525552 5 3 inf X ' -F f L f fig ,QE --L, '--' K K L K-' 5 5 K L K g I REM LK 1 .E .,.,. L ' A :K Yi 153 WL LLLLL 5 L g g, 55 5325 il' ? Q QML ' L E MP W 5 f k ' - ' I 7 'K' K2,' -5251 .,,, EY L wgggv 5 L QL Q L, , Q L ,Li Q, --.. L L Lx iw fg KL Q je E fs, 1 K X ' - K IEW: fiff iwzzg. QigW QLLLLL -g f: sw K K M tk K ag? E 552 ?LeL +? +' KI 25 f L QL, :KKK gglxisi ' L K - 253, Q Zigi ? Qi L gg iffgfi ? s5,,w 5gi,gf,-,mgfig 5, 1 K ' K K C L La QQX - mf 55:32 Ly gk k w g i , ,QESYNQ ir - K. N K K LL L, ? if K i K L 'g ,ff kgf . qp I QQ x .fl 9 K, kk X P 52 3 Eg5? gTi2 ? wq fg ?gE ..,. : E f w fm f g. L L K ,gfijy 55555 52325 Wsgxj H .Q if ::i5fk:3f:5 'j - 'QV W K i 1 71 552?E -51121 , fi rziiirs E , 5 f 5551? L EK? L: ' + ' is E 555 g 'K' 1 w 'F L f ig 3 K kgf12 ' + ,x + KK X L af? Q 5f-i: ::3I3 -:-. K9fM?13ZEHQ2fi'W' E L K- 8 -1.52 if -Q 125595 Q ,L m-I K L : Gig ,S EES ggggxggggig Hg wiki kg g V, L. K f L i gggggg xg mwzk, Sim, ff- EE 2' 0 K- ' ' N L, , 3293 L , x K .L K- K Q W CE-f -' - :Tf2m, gf g+ :4 E525 x K K I f ' , Q gig 3' gg .'-Sri: P 2 :- .E- 2: -. -5. 'K Az 2I::'5'2E-523225: QE 'K V L ' - K K ,jF' :g252g::i 2L,L 52 i5g5EfI.:g-2522:-ggir 5 1 : LEW ? H22-2EL2:s::5ffa22rmi-:L 31 1 'Z K' K . ' i Q V Xyi g w K f L , K' X - it -:L-, LL 2 5g21Q?f3ws6 K s 'K gg T L 5 Lg x K' -- If x -- K K ' ' . 5 f1Sgg2sE?2gKgz,3EQfffB3fs5g,L,i31K?S?5:ga5gf-SES V332 K M L 5, I Kzwfiggziisggi LK f 'K K 2 -3 Qgiggzsigzgzszgz:gSgg gw1ga I KK:e5g,f5iE3g,i K-1, L, W , J., K 5L',,:qxgi Q ' K L - :j:Lg's,5z 'E,'Q2.EQQEffEf 5 f ,L fag ifK2fr'1seu:fWv?5s, v:S3:w:l2g2f:g:,,,l?. Q 55- -L K ., 2L2i':::-I w , 2 L A Q gg?ii2g2s2m,ze5 2 3 igiz - K V 1, L A i sggisiiigglfigggigifmvrgggafig K K K'-f 'Lip 2: 35221 ffisgyghgw-72235 K .L cm N X ff .L -ff '25 siiziwsi W:mfgfisgggfigggszfggligfgwgfzigzgggg-355513539 My 5- A A ,wwf , .,.g.,g,L -, ggggggwxggggggfw L, TN, L K-2125: 4 . L Q 'K 4 L gzip -Lfl4 ' f Lf,,, N 1 N T wssgigiss ,,.L L L ' 2 W W EEE? 52i2EL,i2i.E2L5fgg:e:L . Q , , Q 32525 25 K QE?-3Mg,ii?5?ga.g!3?5ii5izgE E? vm is LLLL L Wgwwevffwzfnvzgfvwfpmv ff 5 wg-by wswaisw vim, wsWfgLupSgsp,QUw:x1H L 'K-,L 1 Swgw2,fgEgg,:segsm,2?3g3 sggmizzgwigagg f mm M Q ' W ' E5 NK ,N'i3g'2 535, K K ff:KS2i?iE1'Yas1.qXifQL:2f1i.3?iE?1 SQ, X2 :RS gwfiggilqxyiss?Kgfiflwif-121: WM W 9 'Q fr 01SZ2f:fSfiff2ii:Kf'w:L..LIK5s+5:z K M ww S 5 W K g :hiv sd 01355 :f 152:5255-fl5:,L?l52zSWx2LE'2if'ZgM??W V M ' fam, H P W 4' 5 KK yy Y LgsLZ,i,g,iKK2KK:gL,5 wSg':ei5:LfzafQL f L wav U:K14G44.'fKi:KfZw 2 3' 'fWwxg3Q55g':gi:g L, g 'EEE f Y iimiizilgii K ,, Q vggg. ,LQ L , , H: 9,- 3 5 I gif fire, ' EE E 1 353 . :g gl ::--. -W. .-.5 ---- , E, ,Q sr.-:,. , gg-cg 5: ::5 :::-mg: fi 2,:-.. :gg ...Q it 5- 55-3 J ?JT i+v2,EQ??:4iEi .. ' f arfxifsyx iffg 5 v ii. ,I E w x gw if SQS ' Z 1 1? :g2.rr:i:r5:' a:'5:-r ::r -25 gigiagggf -g::g, .., '5::2:g,.g,.. :g h 1 3 ? ag is Si gg i 2 5 5 J a, 5 ff w z . H 5 4, 42 gg .2 is a 2 gg-ag 55:3 -,--NA?-:-::::-:5::::::f: 9522, -:n.: ,,v, ,, 1:g:g-E., R mm gg , ig 1 , 3552 ' M W 3 ' ua 00 , :gf W 9 eww 324-r , gL Qi' 1,23' -1 --:::. 5? EQ Sm gi g 2 MTE ? MW hgh ?-, A vsllmmnwg 5 'iw I uf . V MJQ II QW17 12 3 4 gg! f '5I'ff2::2. fm gg g J r w W gg .. , 2 5555 f, g 3335 5252 5 55,5 -EEE . S .W 9 ' sg Xa N' , A I ii 1539 ? gig E M N sg 525722 325 wig gm A g gie ggi .mb W Y , E is 1 ' Vik if kk , gl , , f f y VM- .fi ,isa ,lfrrjr s QL Y ,ici 1, I ,, -, '. ,V K ' M f 1 f gg? ,ty , ,, I ' . ..,. 1 i .,.. 5 1? 5 ,1 , , W, fi' ,L 3? , L I 41i4M ,:1y gp Z,,Q i M , .E LL E ,W , ' M 4 t j:? ,V , bg 'f w e 4 QQ, , Q fw ' 13f, :-ffff Q iff ',,,,,, Q1 , N ' ffg 31,4 ....,, z , ,,,, ,Q , ., ,my , , .V U ,M 5 :-. qhi nif :,:g::::g.. sv: .5 gn 7 fl 4, 'I : f W N H at , 2 Wgktf ig 3 .9.-,i,.- gpgi g ., 2 , V, fl, ' W, y :gg x i+ 5 ,V L k 2 , , H + n , g yg n , Q ' 2 m l ' K w gzt f f, xt , Sf el w k m Qgf aiffs W y' .. 7 w i e X k ,g4A4 H f mfbf' tsl I 9:5 f , 453 -Q: 331 'pit ' 3 5? Elf: 1 WP 5-1,-::-::::f:.,5iQ -J ! f , ,f N ,, M , M gis grlmgx' ,,,, ,,,, A , Him . .5 ,, LX., ,G ,,,, ....... , , , ,MM ,, , . 1-'Y , :-g--5:-::5a::.g,.gm.,.,.::-:5.g: - ,E wg N W .... 65,1 ...... .... W .... G , - , V , g.,.: .,... 5033 g g ... Q5 222551 .gfiw wg +Hi'i7 ,g.gg,5gg ,,554g,g 1, ,Qv . , V f ' M Q42 4 4 5, A ' f A , ' ' ,4 4 +Q25P i'f 1 'f , Zi is Mi ff , H ,gl ' ,W K , - w i w-Q QE?-1: gage, wNwg5ifM '1 ff: ::5f:iE: 5 11, 2 .. Q V n ikki m2gg5 A.eii?3 5E? giifiimg sg Qf M,afwh'M1,fI 5 .Z:' , f , fuel-N y-Q A,,A I fx, Z , qw 22232222 ag, f l j -. ' ,,iq :fs:zffs:52: Nf'Z,,2gi w,iag5i,Mm55E + ' x: , e5 2 ' 3,1 33 nz, 5 ,v 'gf vgw x if ,.,. 'rf mfgggfigig gwgisgggxfggiawi 3 3e?g'g ggimig E ':g5'35E5:a5,2 -42:-22 fr:g ' 1,1 I W WA ,-.35 QQQAQQ V w wf: ::'EEg5:.. Mgi'-Y'a?'agg'Qf gg uggk HSL if f 1--1, , : X, ,e.L ,H ig1'i Lg., ,wa -::-.- .... 5: H ,gig aw .5 wg 5253 g W5 SQ :fi - v. A 5 .H wg M4 -::5iQ:-::-:rf5-5- f 4M,5 Mi3 5:5 gi ifgfgigfj Sig 53525 ' , f' ' 5512 QAH'5+ w: a5 53 ?g?.:g2i152is'i.f:6Q.'H119wf'i'w's:E f - ff ' NQWQ ysgghgwfg :5,2giggx5 Ugsmwga, g g 25? 2-fir. iw fl Q.. 'H WMM., m ' g ' 253593 ? H ,: vy.smii' QgM gg f av' -f aw 4w:if 1w fEg::1f iHS 22:5 1'-: 'E5f55g 251: IQ'-. 'E gg Q W 35 - , rfw x, H tg liwi jw '- 13 - I 1 , L f L , a r gl it '11?1iEi ' .. 5 ' ff fffiff 5355 - M f . ,w W Q Q J V.. wg , 52 +3-Q1 . .JE 3 ig Wg ' fr an ,, . ,,v,wz::ww,gx:1. ,, ,, 1, mamafgzwszeawWM ' f A W,f,-,fy ,izwnrl mf k '5 M wwmfwh AW 22? if sag! Eg: 2 as Zi Y E J Q 22 ii 22 Eggs Q 4- - - - wi s t T .,:5f.Q :. :., Ei, Q 15 2 E E 3 93 555 Lax is 5 mg ., ,. 5 E ig EQ 1 6 ff kg ' fa J 1 2 .1 ,, - - E253 a s R 25 'Tig W 3 ' ' Q Q -.. ,E 'uffwfw-2 f' i2 ' K 3 YS Q 'wfxai mn-3 KAAK M W .,... . , :., -7' : K W , W ii mg I is gg g , 2 k'hk k k WE Q. z 55 , kg L SEM ,. 1,-. -., T ' E Y .1 ' WA' L, 2 , ' fee Q izf -. A. ' LZL' 3 ' 'NXWL 7 Z? 5 X W x f Y F2 VN f w ww mg ,f 1 A 'X K-ff 5 I 53 f I is 'Q' r S E QQ iff FT ' 1 W' .Q ' Q A uf :?Q !g .IH Q E f ' 1- .,:,:5 - :11 '-'- :E5? 5? ,' ::-1 . . . ,i . .,.,, I 5 gig I : X - . - eil f X ga an w we E I 4-an ww: - Q.. B S Q X 5 'yi Q lull? , 25 , f Q 5 ... . - , ASSE? I E E E5 53 New . R x a 5 X --:-- 1 1 M ' Edwz QgxfQ'Nw x as m fs: .Jael iz A f e U 5 F X , Q, iii wwmwg ,N H X .:., . ,H S SQWXE2 -1 S52 ass? Mx s w a s E324 ism Q2E5 V J 'K 4235? . N22 T Y lx . 11- avi his ,..,, ix, , X , X Q X 'wg gk ix if x X 2 f P 'N' . - ,. Q -. N- fav i I NN' X L , -K.. K 'Q A . 3 2 .- Q ' QW5Sl'v4 5 Q- A SQ fi 1 , Y 3 ,, f' M wff mgawy . , 53 23 3. 5 f UN, 3 . . V K A 5 A, awww' x , --:- , M x L -Q ' Ahh :L ' H ' A .ny gm. gi ig, - ....Q PH o'ro ' 5 NOT s A VAI LAB LE 5 5 M TN NME 'TIIMW W' -'-- Zifmg ?E2 WQQQ?Gmwj WWf WH?W w5 w 55GNNi.E? 55 ?WM'+ ' im EW- M M N 'M --.-, z -..-: WWW Wm M M-f .... - M' ,,, fw- .:x.,.,.:E.,,: Eiwmmm H 7 .,.. 1 1 iw, wwf, :mi .... .. Sm T si Q f gi g ,:.:L.:,.:.,.,,.:..: if-Q 2332 5 N ggg ggyigai :f... EE.: 3555 E255 wg? 5, 35322, A , , N 2 2 Qs 'Pi S' W vu W v X k Q 4 if 'Wwgx gg k' if L XR r ,fy X X x u wgg s gg .,., . , ii 5 1 ig ii 5 E 5 Q ' 2 X is aaa- X 5 i f 'S 5 Q xi 555 5 , gi 5 . 5 ,J 1, -- Q M 1 -:- ? , :., .,,. : ..,. E E QSI K: U 5 .... fx 15 QE 5 .,.,.. Z5 QE gm s wkimijgiggi E r g 2 1 Q:,,, Y QQQA ., M S W as 'Anya B E 1 is Win? Q 3 Y i z ,.,. z 2 E533 I E E? iQ S153 9 ,9 5 2 ,Lf , M . ,,-1a ' ,, ,W , 9 Z i QESST wi lf.. ,ggimgki EE' i f -l'V ' I 1 -A-- W Q , 'UW ma ' ...::,:::E 5 E :E:.::-::E:: :.::: S M fifg ....,..,.......,. V V.,,, ye swiff 'Z Simggl K, SSW 4? Q3 1 , QQ gas? Nj W QQ 5 Q sl is wa 2 2 U Q3 gl .Q ... if .... ,. I 1 3 z S S 4 UH is Sliwi Q E ? SA E 5 Q , 'El': S 3 , E 1 z 352 ff X, g I gg 12 ,if fi 5 ,. :Q ........ 1 , H l Z Kg Q Egg 5 M E,.:.::.., E 2 4, E E! - ,, 2 E E gi E ,M , Q Ei E Gaim W 3 ,, X L Y , , Q . me f QE J ii ik i i 3? E ii 2 ...,...,... 4 ,gg 1fVEff'2i?fsg:zsiQi1 V, , ftzmszzrf-55g1r:'2szqsvgsa. f , 4 222:'ZiiSIY?V2IVVQ55i'QIi. V1 A - :,:L,,4.V,pgs13gbg,g4'gZ, Vw,wwwq535QgZ'a,Z:L Miagziggzmvsg:gm1S1V!Sf'a3V:?g,.VVis Y' VY UQWQWNEQLSQZEERYZWQVQS:gg,1g5::.amN q5yg5:,f.iZ1.L.,M,: ggigii' yimfmiiimak sgwlwgggggl ,asf W W 55 433 -.W x 543535: ' 355575vggffggmgggT'gi?g?5SEm55pZi::a,Vmm5 gggggwgmgw san-fgiiiflgwwamagg 7 wgffvhg gvghgggggw Z.Vz,Z3ZVx15uw13'.gagigEv'45?Jg3giwVf'j'ZSgA5gH'ggSH2?,.:g jgifw, Eyiggffjg ggiQggfgsgglggxigglgi333Qjvfwi:f2i.bFl5ZmZ?igjfg UgMgg,3,,,A. MEA. ,VSZQSXSZEFW ,,..3::S:SLZI H QV 5335533555535 V f H., ,wQ,W.m,.Qg,m,,ag.,wWWW ah, ,wsiwwg sfgw, 'aww ,, Bw Hmm my H, mmmw 59.5 www-vgw sg W Wig M WQQQQK V mm, Qkwgwwxgww-vmmhm NW , ,g,,,,,w,m,wMwffP mv, ,w.wmN.MS .w W., ,V V,,,mmmx 5S2i?w:g::?s:22:0z::is1iififgfwiiiiwiiiSwzssezaifsibgmsrezsfilfw S2'zsflidifmswissszfiifiimiwiiif2512525 mgQ5i'1?fggEQmQasmifiiazsadfifwiiiifflifififviiism2235252VwggiiiiiiwfzsssassssszsrifiZSEZSBSHGSESZEZTiw: 5SS??5?SQpfgf5fw ff zwffiimzf Q Mggggggggzgis , 3, Wzigf 1g,,,Q,4Qg,':U7wgfa55g1g3uL1vgg353g:g,V, 335x5h5gg?Umg35g,: .efgggg:A:VQ:: WMA QgwsfgwqvsswiaVgqygagpwgpgsmgggggwggigwgl 'gfmggggigfgggwmmgggygg Wggmswwgym YEWSKZVQ5553513935ISU,1F:wpqfwQgm3pg5J5SsVif vVw':gg.:ri Q Qfisgizgzgpkegy Nggizgm din :mm my,fVl'5V2g,,gg:gb1ff5ft5:g,g,f:w limits Zggggjw HV wwe? f m'1X -Q sfeiri-eww ff VVS Q ai M535 :Mm .,WW saves' g:,3:3EMWw Vg-:UW ,+if:SLwi S??r' fizztzitziwgflfi SSEEQEEQEMSQQQE22522355352235ESsssgggiiksfzsisgizizlssimrwfefazfszswwsizzsfswmmiiwiiiiiwbfefaQas-2222s3fess:Sz:::Em:s2,:m2m52Wf:,,:b:mw 2 , Q ,eiwwmssfiiizmzszebzsszmfsazmssgg1,,.M,,Ww Wm-VVVV wzzffsw ,z2zslzamggzzgg:g5gggg:f3::55g mmf ww mm gm ,,M,..1 Wu wm,,,W.b Q A ,3 ,,Ww,W,,f ,W.,,,M:.mm mmwg 5 X339Sgfizsgsszzm.giiisifmggsiefff 4 VV sigiggzif-lilslfszggiibfz bvffsisgszrzeaiaig ' V ,, 25225 JV ' VV wggigigzgzszxggsffwaQ,fgg?:.,,,,lz:if:5gMfgfii5sSggD:sV 5523? V WV M SSSSQSQTESSESSSEESESzgsszegzsszggsfsmesggg xl f v lg? ,fmillm sv ag-a,,?,?3w2-W H. ' V ' ' Q wgswgwwW2?S9Z'Q Qiggwgg A -., V ' if 5 .Q 52252255Qiezszsssxgggmjvim-VV,VyiEz:5::z :ask L, , :sgffVmf::1::af::vVzQVV1g,VffW1f2A,2'fwVV:Vgazsssg 1 4 QMZYV-1::Q:z.i5 fL2.SV?ff mary 2 -:W N 22:22 -' V V V - NM- V 'sam'':sms15221:25Zsssifiigiizgvgggzgfvi f'w,,+ f S52:Vfa:awrs:'s,2?2Q222S2wV:szgibaaieiflfVffwf-Vgsewiwzc 353583 Sw M2221M222SWSSmwzzssbffqssslffiigm sR:z2if:::f::wsfs:r::?3fmar:Vzffzfiffffffgigiiigg 5211215 'V , ., Y ' Q542sgwssgszgggzfgszggigggggggffr:,gig MQQQSQPEessssswwiiiiziigfizsii ?z::::,:2f?'WW'mZf MN, - f?2gfwggg:s::::?:,zVV? Qs:'?1fwsw?53w?H'Ef:Q:gss::U's':r1f W2N if 2 54? ifiieg2522221215212ilflgwzxzzzffszfziiigk V 3 EVVW?2z,:5-Gigi fHS5::W22i WS1iw?P'?v2i V 'israel2f55?m533EE?5:Q:SZQQEZHSQEQEEQE ww-,Www ,msiswvglgwzw f.wm,?ggg,,,22.saV,4 was ,, , VV,mwzzsvaU:a:je.z,gg4:,,,,,,,.mggmwig,,,,s.i V Www ,Wmww H V, :Q '4 W M215 may .MV M.. 3g3VgW1VW1,3MLI-,gggggg:z2:w.,mg!5,ffV 325:25 flsz1:m?if5ZS3:?SfziA wx: - ,gil V,.g 43 ' V'-1 , if-wi5Si5iiEE?iESg:::iSSHYQEESSEEEEQSQE ::E::5.:E:2: Q5ZKAV V W iw wwf K gan V ,Z 'V 3 ,swag-galwxwffVQSPSSZSM .M M3 H' ....... : mga as ............. ggi , ,nn , , .MVVBMV 3?w,iWNQ35?5HQgi2Qg sm,ii3: VSg32Z2fVgff'???1gf 3Qf:'f f , X - ' ' , QKL, Vyw' -, ff aim g:g:',i: :-:E--5:-5:5::3f'V Haw zr fm ---- . -.-- ' V , VE F V , ,,. ' , ' ' 'A ' gwswizf ,Vim V525 N W ' 'wh , V' V ,.,. :z.:a -'--- V gf- N is HV ' .... , :sk - ff , ,V mag:fsssfxzsxmzfsfzzzzgmiiiiiszssgm as i Z - i w QQ 1 VV 1 2 a1: ff 2'w,gQ 3 35 ' Q , 1. mg5?5:1s,,zgs Vifs igfgg-fisseze is 1325: - fg V A iZ?33?S2?5T5?3f?i3'2E?23SSli2?i'S4?5iZ35?55f53f?5QNS?2f i w jggw ,,Vf5g.isf VFi1fiVVfff.VV 'f 'Ms pi ,:, V. .fa a Q , V' , f 'V 1 ' .... . .... V .... ....... i .x .... 4+ .... k , , ---- H ---- 2 ---- ,, WMS wgwigkmfgxsf Eswmzxg sw. 3 125225 15222 2:5 9, ' Zgggwiiwgigiffzw:3Sgiff.52Ei4SZ53 viiwifef' ' VE 'ffff' I' , . ' V 335 ' gm. SZTSZU SSS il 1: h W5H:,,f.?fsa5:?lSg353m42Egg 23525335253 ,QV ea , Qiggggzigftiwitag WSSZQEQQESS MSQSZQQS QE 122' Rf : 2?'sE2:': ' . - 32283921 MESSQSM I: 2225201553 2 525 , W . . Um, wg? w w ,W 5 V mfg ?g,,gM,,mV, .. ,wfgg V V - gmgsnimmm Wmwgwgggzggzwslww QQQQEEBQESIEZ 42 Vw mg: 1? 1' 'g V 5335525 fiiistsf 'X . Aa- ,V -H awww gfsfgzzzgziirgziiiiSibiffgm-Mfisfvig 'Y W .Vw ,W V , Z7 . M- 2' ' :gE fEQ'Qif'2':- :gig ifiiifijfii ' I fa -'VV M ,V , , ,M ' W-'V ' HTS1x2LT W5 QV9f,g5f s' V 6 ' f' - :Wm f aizrfszgp' 'Q -'-'- : : E22 ' V f ' E E':E5E5 ' wg ,HES i ifiiwgfiv Qwzizwgii W? f ' V WJ5f5Eff.E 3 ? V Q ,ff W V' W, -112-22 2552.225 2-5-IE 1' ' 3 Vw -. 1 I Q V Mx ,Mv gw w- -V,-V11-V: 5i,g A V 'G ' I V 555555 A, Q ,, M W , ' . ' mhrrssw fPQl4?'ES25E55ma,z: zzzzfisi'-9f .?S325 5S3g'x'1'g V , . V V' ' , V 5 f 53gi5:w???2sia:?::S5i:::Eggiigiffggggiiiisf5:::fsf?Ea2,,mE:Efz3::zzziazgysfzstseilswigkgigfgiig' VV , wwg'gigiiiiziigift 3 ,, , V I I f A . V 2' V, -, gg , Miffiiigiii?ifE2E252Ti5532fZq4'iw!525'2:5z2:S5229 3, V ,A ' , fab ' f XKQSQZSSSQESES In ,, , V ,V K e.V,2,:vKS2gV51W35:2:+3mgg53gWE5,g,gsQgg Sggiggigggggggiigiggzx, Wzemsfqmzi 1 ' ? V4,i15w5i2l1?2- 4 x V , :I VV, 62- Kffsssfmw wg,,,f,f,1Vw new ',g:Q:sz':1::ima2::'iLf VVmgg,35gigV'Hgf gszmwzzamzss V J V ' VV: gm V V V- V ' A K K, xzzrzzzftgzgg . ' H VN V , V' -2-ii? ,, .,Q'2::s::g,,, ,.5k1Lii2Z::zf2ff 95555354 ,gQ:q:::::1g.Y -ii Var V . , -- N wwvw'-' rg 'gifsiztfm x,..,.W.WQ. fwl,-pmxmegs::: f::w:zx.z Xzwmqmm , . r, V W. WV 1:12552 fi wzsw . V.,VVWmwwwwwzzzmesses :gssmaVsi2if2msV:VVVSmf:MmwVfM:::: if g. ' g V , i - f V - V g s? ww Q s yMfn:gigsWsw112513TZH?aSZsZlZZZf:sM5wwV gawk1'Wvmgw,SEFSZSESSZSPSQQZZZWQ V. V - ' f 5 V ,V V if Vigimissxwisi 25222552 , , ,, ' A V 1 VS ,, ,121 2' ' 1 1.,,g,:g'gggq::'H3553Zgg:z,,,,grg:g5s2W2 V 'Zhi 5 nqgzzfa N,m:i:az51:55SS55f,:Z ESZSSIQML gb '2g3:Qg1w5:1 , 4 1 reg: QiggwvishfeggnssszzzzeffzsrW'2:agswssafzrgfggmggigmxsYf1Vezzrssbzfzfzegfaiqgiirzfsszzgsf535 VV . ,f 5,13 12 .,m.:2:Q:1x1VVVVWQVVWWVV Ag:::':m:4m,.mVWWWV flffwi-i5SfS2Zsf24VVV5 if-.V '- jiiiiesf fififsiggifewiimf?f7Vf T?sf5?1'ff5 V V V V Wg 31525524 Vw , ag. V. 5 V ' ,mix 'es Viv wasS1m,V5mg5g,g553gV:g,g ' Q, , EQ f V 'W' if , M' 15522 V ' ' ' ' 4 Ni, NV - , .VV V V V ,V 'ff' 5 'f' ' 2535 fig V, X, .AV 2 sg V M, Va E.. V Ea ,S ,sszisssgsmz iigfim ' ' ,V my ,' 21 W2 iQ'f 2:'fYs?vf:'s'f2f2vwf 5 , , SLM , V , , if, 2 NV, nigga. wr Eg ,Q W Wa 2 , 3 323 ggzggfwinlw 3.53923-falsify ,i':z:2fsf22:V:xQ2s1A:aVsgiggggmgggfigg VV - 33 , V ,, , :.,:. :-.,:,:,:.,:. wzpww yu . ,W pg H'-my :Q:::,g ,ggvfw Sy 3 ' 3 VV, ,V S., R V551 Wai M ma M4559 2 Wigwam A WWE, H 3 gg V, 1 3 wg m .,..w V VM 5,5.,:,.,,:,.gg. wg .,,....,.... 5 . Q.-. Q as a' - ---- ,-g.ggg-,ggg.g:g.g. V H H W V f X :--g-ggggpf g-g.g:-:,:gf:Vg:g:g.g.-g- D sign :::g:,:ggEE .,2FiEi55' xr Wg.fwasmVQgm-zyespewfyVgg-fggfwgggqgQIaxanyf.z,,sZ3 ':fgW!1':5255323'i'?,B?TE?TZ?f15V?i331?f5S156E-92325353E531 ga ::: :,:.,fgf- za. : :' g5F? 2'1Hg,MQ w5?93353g' :YFZV2Siiiwiwxgggiggiggfgwg wk: may fszsw gwgggg ..,.,.,, ,, , irzvzzzgszf, 421 522252 Qgggwggzgmg ew N - sxizggzgzzaszzcgisaefE2?5si,i?:ss52:grsfg?E2f5 ,.,.. W1 WAV MV A ' 3222215Ei2233553123535Sizmzzsmzs 'WWW saw!5feQy:fVs5zE5:,:fszezggggggggggfgggffm W 252--I'I5I5I Zf1IQbZ?7i1'Zbi Z3Z?a5lZ'f LSSQS-5 gfggggg1ggi',4Q,?tI ff: Efzigf-, 'izzazwm gg ,.g:j: U M- 2912540 a:QQy:.'s25S2t2:ZH,sVVf .: :5:' gif' :Egg gli: i 1 43521215221 2 5532522 1 gw::i01:s?z::i2giJ :,2:4: 'si fm iiwlffih H2 5 Q E325 5:25 Sig 59152 SEX -fr 35355 QE? :Emi :rash ga, vgiiflliiliw '53iT?5'2Z,T?.Z'2Zfl :?'2:m:f:, z:,V. an V W . . fi fgfgfzzszzifiiigfwizf V Vgmaz:.,w5:?:fzgg Mgggzazmmgib W'3i'395'l:.1?,K P :E :f:s:f+Sgp1V1?ggg:iEseS mam, M, ,V V ,QV zsazswzsemlgg, Wszzzfzfsrsizr i f22??:::1ff?2N Vfm:m.z':3i fb35935-fzxgbiiiiisiafyiigg Vowsswffb Q Wm Nm5SZi?s57pQ ' .mm g.,,9m,Q 32,6 Wu. .Www fuses V ,xifzf , X mgw, MMM? ,, TLIZSVE ' fain Li N 'izmw V W.-V V A A ,V VN. A. .. , - V. V A wavy? :f:5i5Si21'S2mifSQ152'VfWifiwizzfiztifmigzszgglgiizl1,zzsafgzzzzfzawzzgggzfsfwlzzzssffQ4-,m2zxm2pSiffww:,:352252259E51is1:V'2Qm:gGW25Z25 ' WW' 2im3Afg:,:1W ifwggwgfz mmssgVa::i2f,rf::Q,qwV Wzfzgggz g::z::AV'V :sein zggezsgggfzsggggg ai mggQ5V5,g:m:p.Y,5 32525355555z:ssamzggzzsxlizizzxsmsciisiiS5552 :E?ivs?s5Vgi2sz:zzEQ:ggEg3j55gSf3V22isfz2i A H2315 , AV V . a , :sw V 1:ES?.f . figilfff Sbiiffggsf:::ff2222QV2f35?g.f::fS55Si?s::z,f2?g3f::2?:iffm5f422?ff2222if2f::S2if2VQififisggfgfsaffiszzzfwlgszm g2 1?ZH53?k'5'VLl?2Tfl32M V Siiagw.Vw5,mwmgVfeVVV,,gm::gffz:21V - 'fmmztiinssafzgzwifefawiifzzrz::g,51:ggNsVVfgmfgwzggfriaVVwwfwwmmmgiftiwfrzefiwgggggs imiimwg wars,,kkgmgwwwWHMVVV2?2ii2i4V:::iF:::a11i5':f Vgggzzzrgf V2 , www. ,A.,iIaS?ltg2 1,V,H,f,...i V fVggwi,.,VV-VVVQ,m4:2gyVVw,H,V,,,,,.Vw1Vwgw55z,,:Z,, -VM MF M M'1Z4A'YffZf1'f'Mfwwii .mg5M:,,y1,4,MVv ggi fefzw-Vggyggggggvgyg gggvm,-, v ,Ms VV 4 2 fs qv Q 'V V ' Li, ' A . 2 V V, fZ1E3ZSZ1,'1g' f-Wfiww' V' ?LEi3,:'f2.W ff,V,igv2lZS.V -Azz: MA- 4, A .,,.. , , , . V ,VAV ,, ,,k, , ,, VNV VV,, V,,N.W, VW.,,V, ,M P 1 f V 42235: Q ' :rf 2':wm:2VV Vfviiif-5.22fV2wV ',:f:i:9f1:,V:ffi:zQ V ggrgqggzggw, simzsw' wg: 3:24 V V wggzggzzsziyf - mm. 4 wsif.:w,:V.y Q F z,qga.1-WWVmsmsm-.Qw3Lg,m,:7 . w:g:'f3::m:t::1 ,zwwsw rnzifbitzinii bein Q X -Sgfawmwgggw' - A--1wumum . ---I-1-f-BWWIMIIS ,,,, 1 1 1 :ssi3'iwmmaane:wzA-f- - aisalzgwmg mwmmms:ss'N-iiggygymmfmmymgg-gigg eaffzficewsmzvmmsfmmi 4112 Q, F , M WW . W., w W M Wmwmf Wa W wg 0 N W M am HD :xv - Va aww U M, S M 52- 2 Mr' Sf 'E U 53 H Raimi :fSW'W S TV'i5?Y553Z?67fg'73'?W2di???g5iY'5ipwiiiiw 222 ggqwsgf S 2aszzggigggzisigffgsgiaaiggfg2iitszfggigsiimiigiiX13gziiixiiiiiiigiibg-agfiggiiil vgiiigisgivgmxiii 85,,M3w, Www WNW, 1 m3m,W,wbM,,,,.U ,g,mggW55N4g,N q3mMggQD,iRg1,,,,W AW g,,,.,Mgmwm,,,,Mwz,mwHgw1ffww.w aww X Qmwimvmasagbwwv wm,1,,3wwsfmWe.qQWmwwwwwwwhmbf w1,Wawgm1w,, .MQwwoemfmmwfwiagm,,,.,.3Ww3.,,,ws 221522111 2952212312222 wzfzfeiisgzwm 1Qzzwfiisszszfmwiiw KSaeiiwsasiiiggzgtzzze'Ww:i?gfyz:2SEgz?eaQ1:f:sf-Q zzzmzsahgzzfw Diiiwagafzaffiiiliff: fzzzzamaszzagiaggsiiiw 21. , wziimiggzis J-fwsffgwzg wffmasaii mzzszzifzwn Ryffgggaazzswfzazes zvfwsrilfbzzw wafwzgaw 'sill-Q lfwwzemzmvsa i?wf'm R'?:1 fssilawzazi Sigzzm, I Wa A www wggggoviggggzivz ,wgwggzggfngmwWm ggafzfyf 53559232-354, F ggszggvlzgfwggliy mzfiziggyHziizijisgmygg1:12zZLgE,,sgi9fylgwZ2gZEi E322 'iiggggs 393:22 mzawfazfai ,m,.W,f1W bww M ' gspwaiwzswff 1 :Q sziswwwfi ' wiwzie-1f2azY1,1S'wb Qwggsiwo my 3gW,4fS5'50WZw:,Q ,qwwfip 355:'i:1155gjL1i?YQw+:Ls WibigihiwbiiitiiiiiiiiySPSS W' W'f2 W'0 'f'a sigma MIEZW-v :,..-:2,-g-g:2 i:5:g :.::. y as? Wad H 52182333252 wi -- ------ ff gi gwiiwwfgi M f f J H A G5 Eiga? E 5 iw 'W if 73 A U , szg :V ,H mas A W 'U'5ZlHEZfllf 225353 M Z ffiwin 555 gg 2 N352 as . M-:nw M -is Z: A ffl' ,igfiigi 5 N -fa: V V722 ,222 5 Z ag- 6 L 91555 5322 :W 2-fwf Q21 mei fy, QQ 1 - gizzlil' E zzz , 5255153 izqiiiiiw 1:12 M my gzxw L my . wg GE? 25550 X-R353 A '-ff WZ' gg' S 4 ,zzzigfl 2 :gm m,f,,,n ,W ,E iwgiiim' 7:2125 5 Fiiig my WW f 233222 wi A if Q' -:E H E322 Q QQQQZN ,W Wei? W 25:1 ,, ,2222Ti3iS'sf2'Ei:aSS,,3 iii? 1 25555 , ,, ,A,A ww sggngiqswgyggfii gym 15:6-gg,ig': mg' 331, A M N 3 gg 5 N L.M.,W.NMM-.WWW , 1-gwggw-W H-g,.g,::L,M W W -ww -M N 'QQ 'wWwgxw Q, iiilffn ff2?Ei::1f152'sif1'f'E'3? Q Uiii '11TEw1'??YfE?5iT 2i'5f 5 iiilfzffwfizffffgfzif 2S2?:Z1V1??5?iN1 ?E:2fS?2i'iE2: gif'-ga QSQEEET-1555i22E1'3if fw3,:Ewf5,,ii11 0illsixgllimliviiffiqiif' if' W if Wi V M 'lgiiliiiwslf' YSQSWSQ UQ,:jSQ1g:.ei:.f21E-31,555-gig gggiiiifif E wgixilk Vzgzrigflzfsfifzg. 51554-lzmiikussil QA Vfizzilgimasiaihz. azz:-mf2EF:::z:SEm:s12fw bifiaiiriliffvsesgifvm. .ffzspfawzssiiwiiiilfzm a,,p:w2w:2sXfiif2.:m2f lizfifiwfzm WWQSSTQM :lilly Wixgiazxgizgzzz , Uzmzzzziizzlwg 'mf' S Sjgiwaiiiktszzigg azgsaimgisifzzim Svzszfziiizzsmikxiz ,lim QJwg5fi1z?ifs ,g fx ,'f,sTf2Z:fs22Qgig:i Smwbifii-Q::Qi?A :wifi .--g,Q,f:f2i0P,fi'-Ig-QW M 'igg,?:21?i 3 W M, zwfwzaisii w?Vz.vmgF5, Eiwwg3w :52mw1eT i'aMf1 fm ggiiffi fMq: fi'1gg,'?fm7P1f'iwfvf'l'1'3521. ,givin affix! fXgzf2?I21WKwfg,x Ewgvs, sw Q 5, , 'img 4:16 gg,-2 Y ' , V 2g:'Ls'fz,,:,T5'2 5149 1 w,.0':,:B1,2flg,f?.Si cf YP 2,1333 5Wz:,.JfM'24f.Ji1 N New ,fx '2vz,32N'bu -.-:,: 22-: W W 32 wgguwvw' mfg' way gg 521 3211 fizwi gg? ig gig: 2,52 5 2 5 1 is 255 352 3232232525 gs 5 gggaaggg 5535 3 wiixemmggizzw Eiiazfa N-fam'zrJ',5'1,m:a:2G,z-wmwga:mr ia iw hpliummgimw We Mia? H ss22y52:E'1212'e2a iyiwwgfaswmsfgli 2:21rLaS21v5'wES5E,?df2M2222 frm ,sw f imwmmilifffazssziwiiaizfssfffwzws im wSEis m1ML1w?T f 1'3'?1r fi F-22125 lilmisilizgewwaW -'imiwwifgff21,22-rzfis' wfffzw 2:12222 as X zzlffpasamizi W -iEV:5Q53xEaZ2H5g3S' 'wszmilmszwi ff zrsfwvfsfawzzsfiassai zzziliwm 21:12:23'1:affgg1g1:3ggfg:::gfghfm' . s:y.v?gg'ggb wx 235-125, A Mg,gsasXQ'fi:g2,g,ggsqA ,ggahziggf:4iz?zwg-meQ3gg,1.qg1egQ,:bgQ3egg::f:S gf, nigggsssfgigfw ,2:2fEgm::ffs:f:f ' M-Xsmzzzzw, , Wffiffiiiwfiw'-101111 Q 2Ssl g-'fsyif A 1:22123 ' fiigsziilif 121111251211 Wimfiiigvgli fi. Qfsligiglgigggikziim iiwi:L3gh,zas3Em2gggS?M:7A 5215222 gf 2222igwSESE5s'2fQ?iE?1gif?f?i?1i:iS2EE?E:12fw 153521153 .aiS1f5?i:s1i'lfRi:a W212155:::i?'S5QWs,1i2i.,:s22A . lfziffliiiffaas2LN?'9s'asJfsf5apw E?H2ff??w,1f1Q222miZ'2'S'1 Wi,S?f's2W1P1P-W1T'3N'YE2sLi5U5E:lan235351-T0S3Sv22i1YY1:m'vg::mlw?2ffaaYw: r 1afeJ?1x1:2' Sw D'2?:zf2?2f5'5sssi'Wi fztswffzmwUfif'i1:.Ww242wv1i1'7- Wfiztt W Qififerwzwf rg: ZamwvflzifQmfgggihwggiiiw-wgiqfw-1-ME5?wff7 ww 5125,-wwggf, gg, 50agb,.gqg,,wf3P:,,w W, VwEw?5gg,,,,, . ,S M x,,qQg,gg2. 1 ,- .: A W,,,m,,g,,W13gf w0,1M-3gg:1w5ggw.- sgggwfw v.y 1,.i,,,. ,bpggwavv ,7 b ggbgw gf, igga,,9U.- gmvfgezww lgigzwi fgilw gww M 'sfiwwwm mist ww sh vzwms ssv ,Q Q wwf ,hwy'A-1-fvgzYiw:46sfiSwfe-wg: ---- : . Kewl 'wwfwsbkww sidgwg wwiwgwawzsgggfmww zzswwfzaxv wg? .... swAgE,,lli -15552 f'2f2i2zgz:11Q2igazififbifeffmimzwasiiix igzmif -, 2,-'fiffmi ii? ,wrfii ,A His 4's5f?25Afy1w114f:,WZk s 'wmlflwiff Q 255 as ' ..... -E.:5:r: ?N1w'S?11:Xf H ---- W ZEE?'i52iQ2im' SW9H2?3w2f21i'swS?E 3? wziiyig an ::. -sw--2 2- -::g:,::::.':. 2:-'-2. f::: Q EK E5QSif? gH L, ,wgggzzzi zasiwgnazi wgqis,-J fm gg 5? 'ig gfsfsggezmxiy S ZQQQQQSEWQQ g:E:ag5. mf wreaga we 2!5:g':g.'I:-I:-'Q-5-gg,, Eva :2ELf1fi:.E:.':5.- W2 9502529 3 ,, gvvliigamwgwggigiw gi ff. 'SEM was ' :: I2.--'21 'mifgss -I-g:,..::.'2. 2if.E5: :5:r-2: we fzm'?-RS , asgzwgszri-2W:ii.wWf:aA2'SiEa:2 21 11231352299 W 2i0E'i'ia0Egy:s'3'fW8 Jxfwgagwwangllw l Exif? Eixsiih :::2.2,2:1: :sr. E:: isis- Em iv .i:r:1fai?- JM QYWEEWE-if 5 Q? ffiamwv ::: - s::..-2. W 85913322 'fy 3 122252. :::::: '-'-' Sim-z:Ef 5'2gff aaffiiiffazsiwg g:::1i'w,,?'?i 22222212551 ,zzzzziwgfyaaffmz,s1w1g:vf222w:::m aw: Hsgeszwaiffzztl im xsspwzzzzgfiziflff Q QSW EI p MM www :2:2,w sfM gw :aww 2.- 1--I-Q: ggwawfgafsaw wen ,g,:WSJ3334b:22E3bi:2:2'i5 U 2w'3Q:2'?iZ'-1l?z,if'l 112522 wifi? :-:1 v1f2M gf? M 22952,'f1:',f2:f'l'zff1iL:42SEv ,,,,!,QN,,g.w1m,,,,.,w5,5 QWQW.,-in .wwaggnmwigigwmqmewmm,qmW,2w52,,.,f.wffg ,Swmgsh ,,xw00.Hgp,w5wHsxgww-:Q2ggs'2awe9q3iQ.2agEgNiS??, W iw xw3fw1P'3'S Mk wsfayiwgmm W wg pf wzimwgmb wi gfg.wW,mww ,ww fn fvwisxw 'f.wfwwQ,mw: News Qsawff 2 .wfffffy sdgaigggzfzgy mi ggggwggmgzigg' yggqgzasgwwfgimziifiggw3:52Wmzmiwvmgwgazkgigggissiiga mg2v.fQg:5g2f:5RQ'EeggzSB21wz, Wagga: :z.Q5w,,,sEg::fi52 iwgiffgszzmifogks b EW , g.e3m,wi3ggla2iS5g1hi2w Eiiigaggzsizwiggiazrszmii zzlg-:623Qw2: ffQgg1:fmK-salaagwpsiig-vga' ixw5'lim,,1:m3vMa1g L Wifi? Iiirikffpmfiiiriiiin-i5i?i w?g,2:'2WE??3sfi255555552 Slew Za N2 mimi S 9'25gE'i22?1gF:z:'sfffsw ,aaiwfiilrifiw5isN2F,,iE'3532iEi::::EE:EEEa:p::z3,:m25WP?Em2gE1:1i:2iiiiissiiwiiinSe'ZE'Sif:r:f2S1Z'gZ5?:4':iWiE-faq . Siiiiiliiilm1f2iE2E:1WEEvw'25Zi M?33fifRf?3'Y5' Ein: :122EE::s1lE,'EEir 'jf5H Qiifzevililzwflizi W' ' XWEPEWWQQ WDWE QEQEEEQQQQQ N WEWEQMS ewiiififlim 6' R gaiianbiglgssd-.:::. WSWZQQEQQSHEHEQQS S' E2 . W H Sa 2 2 WSQEEZSSSZZE2252252231522 mi 11131213595 .,Easw5?i:iS'22SZE:z3efgQgifgPm Qxeziwdigiiai Pvggggisagigiiznbiiifu wgasaiiiiiigam ,wg W5 H ggwaezgrmgggw ,wmgywszgsqmwg sggg, 3:22252 ,gg , Hamfgsgggg .-:wr-5: :E-sgrggp g, , D Q Gifwmsezmefswi Wiffi gm 2120 im Q 22'W'w222:,:W wk H w a wiwgazsriiw awww M wwe fav wish 1 W we swf: H 2:af..-::.-s.4':s:f:--Q1 b H wwf we-1--::... Qilwsfwsi me ' 4 amwifymaaziw 36 2 ---- - We 582322 :Q ,N Vw aEVEWiEv '2r1r1r-':-- Q -125212121 ,gi 1E2EaWF::2w'ii2?zz:::S2S :f:12'1i2?E 2ff221Emai2w:252E2E:ziiifiilisziiwfws M aeQK2:E:ifS1'fEGs:WxE2 Q?i'2i2w5isi3W?sz - ' wif Tsiiligfiqiigfiiii '- 1 igiipiliwfigiigwg Y :H 2:21 35212222213:f2f222-Qfwixmwffifgwffbffmh 'fifM'W'fx5fMifi5,,m' WJ fi q,WWg,,,.M, gfizzifiiw-,,Zsiigwwiigwzazr-f wgM,izsiiissziilwQ::g:1bWfgf::s2f5?igiQwm 1223b::f:::M:1z:5'5'W1vsMS31s33f2ziiwwsziiwaiisimsm?RmnmA,,,...f egQszM.,m,WM. 50, .Mg MEM W,5,,5ag2QEa?igQ,:,hgWm:3a ,15li'i1'1Z3ZTLlZlTli1'L' lT'?3vL,Lliiwilmllgv-fll E - mawww zw RYSfWffQffWH'x V Hin gwgifi ffW1i23i2'L gg ,g 2 E E .. ,MiE5g1:Tii2QiSw.sS5M mmswws EBM? SUSAN ' Swfiikmwww s' M QMSMW ai igizaizifgiffsgwgimsfgg QEQQMEEQSESQQ SQQSQ WQHWSKWWREQ WEWW , , f ww f MW , -Y 7 -- f zfgiggggmagiggzzz ff ,a:zzgg35gEha2gS5TggQ 2 Q: 9 -Wwi ......, mn , M.. Y , W' 4- gggiilwfl .N Vqwffgggmiwggiziiisil 1: zziztifw w: iW 1'i5w:::::S3fb:a:2z::sw z az: Qgiiflifii : EES33wN7iS35g0 3E?.3TfSf'? 1: rss Qwwgqgtifxlimfiwg ,XSQYWB 5115 wg? 2:5525 S259 S at Wazaqiiii? in-r':-siir mwah gm . ,siwxwii 2-fwiiw ff 3: 5 12 big gg Z-iw 1:ir-:iwwwg,s?f Qvggfz:5Q1E1 wg -W -' 1- M -f '- an fsz:f'2a42siHimQ. Q w:,:i'v211: 1:2252 bggiilgggixigiblklgig' ss v iwwiiiiiw :wa g,fg,:3i:S:-293223232gggzziiigggmigiigqzi? 222532 k -f - W f l iggggiimw H'5::222iiEfE2g:?:2ZZ53Z23ziA 23522 Q -E2 MM g,::m,hww, wg, ., has mg-3:01 'sag Higifil - , 1 .wifi ifffii ' 2 ' W 5 2:36 Q gszeiigimiii H2222 zffaieswzz , 1 2215225 5,5252 4 i Xiwziiw ' 5451125 i ,N ..,., ,.,. . .... .,., ,,.,,. . . -N ..,., , ,.W..WWQwM,,gm mg Q Q we . M UQWWNE-,M WWW W Www ' WW' ' W W 't Q g A U P U 9, 0 22132 A 5.3713 E33 mmwfgizti fiffiiisdxQinaiiggwbWm,,,Wwg,,bwy3gmWm Wwggmagm wggnzgwwgvgzgaseekffgusi ff YH- Eiiim' Wfiiwfzilfgah 715 2. mi? ' figzwi 2211 1525522252 gms' 'e1'E'Ww5:s::1S221e:zvifiifwlx Wnswwezzzxsagww Zisswiiwiaswiffigaw , 22 PZEEEEEE ' ill 'Q flffiiliii SESQZQSESLEE 12 12WgiiiifviiiiiiiiiifiiixiJiwiiiiiimizig52521355 9325532 F553 Sig ' awe: Qzzeew 112122 Q Ailiiiiiiimiyg wS::,amSi1w21E4wfzmf:2Mdzssziiiiszwfff:vwEai1fi?zEf2?:w2iS::f1S1: N'Yfmzaiifimzfzggzirlmliliiifssgxiizsemiaimzfagzzsziimswggissszwnmgfzzfm-figwwwMzszwil ,qsmfwsziiiiwxzswlilizaiifiii 1: Q, sm Q 2 zwgaslm azrmszsfafllff Hmm2222Q:::2iE::2i'1mgmgmfiiigssiyszffzziwzmzw Mwfzsaziii Wvfiifiqf ,ffmSggfsaigifwilgfazzearhfwasi22Z::zf2f2i50gw:1fs25312212225Wa:zzQ1ii?'i:a:1a161wsfsiigissmiiismiriiiiizfziiiiigi Q 2 H wseziw :'wzzQ22kw 'FE:Qs2wx1z11f1f2Zexryf' Qfm2Sfi:s:i'1i:21iQ:vaf2'Fs1i'Ww' LYQISZZEEQQUQQESH 'mwiail Zggiiww 'fwflviiizziilmizlii fgmszgf H :www Dggzzzzfggzzuggziw. zzzwgarwzssrils qggzissfmvvriiizzzsxiffzzaiiigizaifgwiffwflwizzszsiiiwQgiwiwzzliiwiiluiefiwgzfsiigwz mgszsalivzabiiivizwi?zW'SuSZ2Mfm1f12fS213W WWWiwiiiiidiaiiilmwmfigsaWiiiiifwii9 ' Xzzwmm magma Q wzzmsmzzwzzzw gamma mgzawgssmfffzzzzh ifQmsasaiwmsww:www WwsslffwweszfmwiwwfgwfGWW'i2W'f'W'W'1HMWVMW2wW5W5M53X b2T2mEFE3m'1'iwG W gmzwglwplsgaiiwgmh Wg Z25W'S1iM2fsM-S 5113222425145 Q iuizmaiii an m2'f1agz2Afa?:s::z22E:z:iz: fzziiigizsgiizzsaxsigzagf zzgifigzgiggxgiiizzzgaz 3W1zi2::wS?E331i2ET:zzgiliizigiliiig?gEig2sz:22g11Wgm:ig9P1yiaiwgemyezzzzsiligzasggmxigsgiglgs2311525::Pggm5P5:232131:2Qig:z332giggggggSigzf:gggi22EEaggQaf Eii2E23igggg,gf szszwmm A 31 f 1'Z531'L'V'm 1 .1.::'fa2m2wzsakmzzw QfszwwmwzazwzM, lmvwwb w'sffM:wP:eww.12W:,sf:2ffasA fafaiwagsiziirfxammss' zswsaowzzsimzii skzmwesdiiigaszgxfgix www W Sfwssiwgizsass Q Q mzwwmaw HA , f iwff fzsiffifwihlff , Y Pwwiwiiiwwiwiazww Jwzffi V ,2'35'f'fg!l'5'ffxigfiiwzslsggmiiilligggl wzwifawhaiffaaziiwip ziiasvzifwa2iw1iw::::2z:e2amswfizisiaeezwzffzziwlmsipM.fwSs9sws0wzf'SVWszzimwwNwwizzmgiif-imgHMWMS iiiwszzeikwzzzimhiif wzziikmozzsmiiw fiiffgiw ' wifiiqz x ' 921225322 wks misssiw' siilizfgmfzzsillzw iiigiiiyffwiifi fi wiiagzsii 22111522 0fiizgzzzezv'ff?:mfifSwssr2w2g::bfZi::1:1i11:E22s12 iazziwfs-Ef2:'1Q2:E:fzzsszzlliiiffsf i5kj,gi':l23?E Zgqgmigggglz W ztggggxgipgggsai ,zz-www: Qiggw W'gSE'12ggREgg, ,f Wgggwq Wagga?52:fbgwgggivgiigzigffiirgiigV imimf v Sf. Rgtiierwgzsiiipg gm M-fgzivmgaizgggm m s A A A MAA s.A.Ag2f?f2a ,,.,AAAA'i ---'-' ' fffisf Am AA-Af? ----s mf.QA2sm2Af3AAs.i2::::::::A:1:m:2iEE..eszpr QWQQQABSAQEA EQQEQQAQE A' new ---- . -A 11235125251AAAZX-fAfAAAz:-:AEMA221222-AAAAAmmz,AAAAAA:s:A1AAmA,1 AAgA1.::PAA .A A::32AAAAfAA,,e21fAA?3iig:xm AA . 'n:2H 2A'f-'Aff-' ---- AfgzzwfMMWSQWAmsswg:si22SS2?iAA:::wA1AA::w22Afe,1:,1,,A1A g EwQs'1A S3gA .... mgA,. A iS?gg? Aixa m? mf?-i1iggAAfQA:g2Q2w,mf2?AA:::gA1As1g::.:zs:a1fAf1:1121AgArAf::Qwgg:fQ.Aerigiggzzzzaw Q15 A32 A , .:..5:-.AWA a m.-.,..A.::::: :.'f:E .... ---- A ---'-f------ ' --:-:.: : AAAA: f- ..,. A ---- Q AAEQAEQQEAASGAZAXPZQ XAAAAAAQQggsigwgti.AAvgwzibAvgg:sWAAAAAAAgAgg,ggg:A MQWAAAQ: 1 fg,ggg,,,.fAgg:wA , M W ,... , ,, Uf2il6ffi:A:ff.,A A . , X A M NV A. AA A:. --:- f2'gA - -ffEEA1 'ff2i'f- , A ' A V ., 3 2 A I 4111 .A Af A A.,-.. 7 v -'A A. A f 3 :fi :5.Ai?z.z :Av .gA,z3.gzA'ig:i AAA ,' ',Ag,ft5Afi a ge? A , A A' A Ea:a:1:'242AA2 -A--s A .A f 'f-ff yfi 4 A A 21:2-GAA - I- 2. V' AA , , A, Af':AAfAA: A AA, A A133 AAA '5-Eff 5f'.. 2'2E 'E:?f:,f:5:EQf5I2E +A? .AGA N225 , W .zz ' Af' wilfwi . A '3,.X fy A. :gy 6. W K A- 2 A gQ2 AA,1 4 : gZi5 S Q25 .ww W... fi, A ggmzrii. 2225 M A Ag 1 fb? A Vg ,Affv A Qi . :' A A rE5EA2sEg.A:,-.a::,g -s.2 .. 5f'5- iE. aa. a37i22 2225 Q Q A ., .. , , fsAmsgsA...A, 'E .... :i.F'2.5 f?fE2.'2E.:?i2'2E5235R5-5 '2E.-E'5::. 4 : '5'-E 252522-QE! ' ' Affff, ALA! Efiiililivggiifzifiw SQ wg? A A A , ..A .... :AH-A.2EA MA A , AAZAZAAL, A ...W ii?E2?A?4A AA ' 4 , A A . W A A 5:52:25 . if ,, A, Ag, I ff mv, I i ,vw A ggggggligfgggggggyaiw S,zzEiEgZ22gg5fg:gQEi3g5 :::::gg,-A-5: . V: wi A :.,,:, ggggg.3:3g'.Ar.r ::g:5:g:g5: 3, A , A . T1 m5w::g2fzz?5 i2?2AAAgzg5:s::1:'iAm:,is '-any A M 4 A Agni? MA zxzziiijigiegssii si f1fAA'::AfAAA f fAEA.EA.2?AA.. 'M' , f 1 -wr 'A -:..,.,. :g.E..:fA. gg A yum ,Af 1 1 C ::g:':gg: ' , ' i AA ,A . ,,:z1:::tEAAA,. , AAA1 A,, ,A1AA Aisff A 3' MA ' ..,, 1 A f 6' , 'FA , . 4 5:-g.:gs,:-, .... A .,..... -A-gag: ,.,. :.g.-.,.5.:. :.fg:g:g,:5:,. f...,..: A: 5--:A:A.,,..A:A5.5A5,gAg:-gag:,5fg5..: ,L .. g A ,, , . AAAeAgzgSiWAAaqA,Ww:gf,:.:Sx.'?.AAAAAf3iAgfAfNs Af? f -A., ASiiifA::i2SifSiZZ:EASAAAiiiiwswmiiifawiif 'M ' nf ffl i ' A ,AAA M 1 W. .. ,, A + : , .A M-.AAAA3,A0:2a2g:s123 1:siAAAg,A5:a.A::1Av::::f ' WM NWS AA :A::.:: AwaAAAAggz::AszA3sAaAAg::g:mAAgfAf:A:Ai:AQsAAAA A A , A xii?Qsizfiiiggwawszaawgasz1:igSA?-fizsiiifl2Af.wsf2iwfA::41:2s'SEi.fA:2g:::fAAA:2's:gSAf21f:mer: A .. , . :A 1 0 Es:':E'Eff' A 1 3, :swf ' :EWiisg-::::12A?2izAmAfXZQWZSAQSQQAAEAEAWQSAAEgezszfwiisfssxfv iizffs' A A. A A. , .Aw A A A2335 .A 5A-.gg 4 , W ' Aw gg N img A3A,gg:1LrA Ag AA aafggggzzzaiwfiizagii22gf:12egiiggqifiggzzi5133:zzzsgigmizzazzfiiszzitf M A :A ' V' W V' wig P23AAA:m,,,..,:AsE AuA:w!g2sAAAAfA:::.2AAAsf:m2'SAiaAAwz:p1,,,A,r:!:z.,.fz..,Ag:,AfA ::s:mAAAASAwAA Az? . A v , rf AEM P f1-Af1 'A2AfAA:'Af?AAA-Aw:f'f 'z2? 2,g:wifg:::::Ami'x'sS2a:ff:fzfzzifzsxzzhiiwi Azz:-::'s:.1E?2g::::fr5A. ... A A. iw.. . . . W -A -A M A2,.,..,afAA,AAAKg .A 4' 1 ' fm- ' A' -AAAA A A AAAA A Ak wg, is iA3?1?f'iA M55 y H if A 1' W ' 5322 21 2 3,1 K 'A M 45- M M W H ik Af-gif' , A il'A7,:,iMZ1 JA'AAEEUBYRSTESEF:Q::L'2??ZT2:i2Zi1EQEzz ,Q QQ 2:A,TL23ggAAfs:mAAiaszv:zw.AA Amar. SAAAe::zgwAAAAAAAz: xY2AAAA:,,z::iW,A.AA,m AMA. A, sk TiaFIX?fs7'27mWQg?5?f?3?i2:1i3?A3'?:f1Ea32t.Z'ZLgQ1iS24g5'a':i:22QgiA,, D 1:s::fjg'?2:1:1QiJ'g5Z IAA sz A , , ,X 55 3, 'g5g?EgEi:gE'i!E?SAfEgg3fZ2gg22i5iE'iii.QiEg2QE?liES37E2iA:1iA?iS'SE2E525i12f'Si1 .AAA-AAAAA i1AA A 21 , :I--IA Am 'P ff:AAASW??AA,..,.:fAAq52Ag: :awS2AAf::f1::22?, ' ,A A 25:55 11:22 A img. ' Ai Af AAAAQQQEEEZQQAA . , , 'A ' Him QAEMZHAA 1 fi :AQ:.:,g'W Ai?:tAQ ?ii52'3'335iH AA Qf?izAAS'22F?1i A112221 A' Y 5?A'?'A2AA'2m Z::fzzA1wig-ffrA2SA22A2?Tiwpff Zliiiiiii 224 AA ., W 1, , AA , A A- -2 .AAA-A A ,wi , A 'W lk A' A A A A A ,AAA A . ffAAzi:A'2f'2 m2f..S2L2AAHJ'2AAAsAAf 1:22122AAAAw'NffAAA:4g::..A Awiewezszm fxsff ' ' ' ' EAW 2 gigwkiz :gf 33' za f ii.: :.2i1if?15Zi22l3?AWE2e::::f2A Aliamzzw' TY A K AA A1 ,,S:EE:: Zim . A v,,A'A SAE A . A ' 'H A ggmf'F2ieAwAa4'22As2AA:Pf:f':w.::.zAAmzyivmziiszfzzsns,:11e:2eAwm:QsS22iA Q , ,,' 3521? xagiiwziliwlsbis QvifwisfssfsigAA5g:1i12ZEaiz:0az:z':2ii::m,zQg3AeH xanga, , A. ' A. 'A ,,, .. A , . a.w.,, ,... A . A... ,.... .,,, xwhh ..,.. . , A 'A'?wfzJIAeAsAAgm, 952 AAA ASQ? ---- ---- - -:-:f::w:AA:.. A , Anim ., . ggzgyswggsx W AAi'gg:g2A AA A , A M A Aww' ,, ,M MEAE H., -.-.--- ---- A V, I A 231,521 555391, , A-:, g..,. - :g,g.A: :g g. g:,,: :g:,. -:- -A A- . ..., ZIZSFSMAAQW, 55-Ef. ::E2:' ' AA . . ,.vg3i?iii?i5zf Q A AAQSQQ QAQAAQASSA .AAA . .. A' i s 'AA 'AA A ' ,AA Ag AAAU A..AA1. W ,A iw, A A saggg - A A.. A A ' gwwfwx szbglf W A 1 fig 1 M 3155 is 0 I , AA ,ag -A f K' ' . pf: A , A ' Wg Af AW-f ,AA Ay Mi A, Ag,, A AEM W A ff. , A Q I . i 1 V V A M .... . iw A il ., AA:a21,AA..AAA. A A -A :M E ---- A .... A A.AA. s AA.: .,.,. A A AAAgg:zA Ag A AwAA:AimA1ga,.s.:1AAQkT'..,.zsAgA3E Zggsg , lim gfwgf 'PAA , ' A 3 7 . A .A ff 'M Af' 'H A5AAAA1i1ff?5'L.igf'.SEARSfs.: WEEE? 22255 'N' ' , ,. A . gg: 5-3593 A 'TW' A 'A ' ' 5 -W Af? WW: AA Ag. A, A.'2e,g, A Awgy-M wg xx. UZ AA Q AA M , A . - A- - AA vi, V AA AA gg:,AAAzw',2W, yggg 5225? , A 5' ' . es 5221 , A A A K. A A 25. HAzfgpZ5'ZKEgw2'1ii2iT?f'7 fT'AS'-K g 1:TTH'?AN3,bg1g, M , AW, A A 1 , k A A K 1 1, AA fgkmilgg. :Ygggg I W . . 1 , 'Q ,V 'W52'5fiMiAfA1ATA25'4 wA::fS?3iiz:a z?w'f'f .A , A -f' AA . ,A K, +A., 1 mmm M. A A3 -AQAAHH Q AA .Ag A AAAA ,X , ,A A.: AMA: ' ,,,, A g,,Aff4-2ivA fAwsfwAsAw1A'f M A LAY! 255 .. A . , , A QM E582 3333? 4g'5L'?X 53 iIX::Yw5 A MARE A 'A A 5 L, 98, , Wf',gMx1.A .A-.1 A A2 ,.,, nw A, , AA A gg , N A , W' A AAA 4 -2 A. 7 ' 4 ,A ,A wsai225'YA1w::sA' 3,39 5592221 . , A fx 2253::iiiAQ55QQTPEQQHSN1-4,1:S'A,yi1f523?:v1,:f+e3:?s.iQ 7 A -3 ' A 'Z' ' Al-f A , N' A 2' Y gag, Q X A ,gwx . A A A , ggiilihgfgg .S WEA? AQQQZNQQAQ A 2215233 A A A A AA 'Q sxaim SEP QGQEZAAAWYPHEQRKRYWZ-EAFRA WA.-SQ A , , ,, . A AA AAs,,,.fAAAAAg,AwAAw5H42AAAfvgifM:,,A::iWm , , ,W , ,,,,,,,,,,, ,W ,U .. ,,,, ...., , , ,,,, . W, .,.. .,.. . ., ..,.. .,.. , Q. AAAA , ,, ......,, A .,... .... .... , , , .,.,. , . . ...........A.... , .... .... ,...,.... , . ..,..,..... , .... N ....,.,.,. .AA A. , ,, AA . :s:-s: :r':r,:A 'r QEQWXFSX AAAAA if Em?-55525232 5EE222i2i::5E::22,f1l??:...AfA::z:a: 2Gw AA ,, S Ag,,bfZ9E? AAS 'Q gigigi' 2 .... Q WA 25.A5s?ff2--E-fE5A:.:a A ,gg '52 2SA5'fEfEEiE A ESSAAAAAWQA, 5 'SHAQZEQAAQSAA 3 AASEQ fr' 7535? AA ff:-1:-Q:-2 ,QEQAAQEQQ SPAS ,H 'M -A . :QA .iw :QAAAIAQQ Ag,:gf:fia:r.A-.gi zA2:2g ff5r5.5f55A5 2g 5 AAQAASESEAAQAQSMSZi?AAAAf::sz,,g:.'SfAfAgg::ALsAf:zzfAwgmAA2AAAA::a?AAA ., Amy: 2 Mgzffzq .,::LAA g ssfsAz:AfggM:2 wggwgggmiiggg gggsz gsazie ::.:gg .:AA: -AA I--Af - AA. .AgAgAg,. , Ag -: AA sxS,, :QgEgiAgAwA:::A:.5 W isifsgiggigai2iw::,g2i1Ag1:a1gw'iGff,::s:1f2Ar:,:1 ' AA5f:fA . -Afgmszz .., AAA' A :ir uiigfiifiligg zgwswfiiigi wlf-E225 fy V H.A i:: MPQE f''iffiggi-Zifysissgzzi2535552221j'QgEff?S5fi:li2Ei:: ,PA 'i . A A W 353, H ' .,., ,ZZm35A,1??ZAi'SSil'S35Agig f ?J55AgAg23AAAAA2wAw4A' AA AAggg BAa2 iAW5fW Ag.:. :.:g,ggg.-:,,:, :.. - aqgw wwgwggi miftmw ?'H ZKQWZKSSESSQQAQQQSQQEEEEEEFSQZTTZSFE'-fikflZ55AiE::2LMvHW'Z,F2Zi.i1153b M1355 4, Aiiiwfiillw 55g?E3'ii?f5?i?Zw9E5?55gM53Sms53Alg2?ii5m ? 5222522 fff12?'fffsz:1fA ' ,A:EfAAAAASAzs:AsAAsSQ? ' I if Q- xnfix , , K A A W, ,x X! , - .Q We X 'X A . . , Q S W -frm Q , ...MW 5. X? - -- X J L' . Q ff' 'nw 2,1-I .ms . - ' - K , Q U I il. 5,6 1 '21 K 5 ?l s l ,, I Wswsaszyqgszw Q -fwssizjjq 'bsgggiw 5 135: S M 0 ........... W Mme .3 ,W R :Wh gg 'ig - -Q -- fm, 5523555Si?ggZg25E?i?525iEEEEZf??ES55:3 N N 'W' l 'm ' sig xmas: rrcw sz.saffvsfgifsiriiiiiwiizeziwsff :sims ggmsi M, W 2 Hamas. X1 ziiwsm 221 Wmsjza -:-:-:e- sw Q51 wr 'wa sw-f2f:,s5S::izy1s:':1w, Eiisifg-a:g::5 1- 695555, 3 gwksiizisisizxgigizi igggseimmssiigi K , f C .,., Q 11 2 ww fa , :afar 532525225252 reign' X . ..... 3? ...... E gg M ' - f: 32525-5 NX Q Y' if H. :kzk 4 x .ih. A L - k L fi fam - - Nsfiq. .4 S x M S X , . H, gh .Kr .. Q N . 3 Q- - .. -v X wh X , Q.. x 1 'S . , . K X :xxx N3 SQ uw:V,m,wf:H'::2:,szX: A, 253555:Qggigggzggiisiimssszzlzwzw2222523253 law 'fs sw S2?Sff5w?:Sf:f2s2 2' ' igggfgze b BQ 22553 gf WN sm M Q mfgzigm 2? if-f Qsismgwg gnu g i:QgZj X1lasLga,gQzEf I az fssazmsmwsiazszm W W , I Egg ?yaS1QpSwwiwmQ,FWS33Qi rgggsgv M 35 Agw5,5wqav,w1bm,,-,.M.w Q .Wm gsgwggsgg ..,.,.,..,.,. gym g QS 'Q , i g gqswigiaggii ' JFI N -N See xi MN-, kk ,xx i . ,Z 4 f . 413, ,.,.,f v.. vm ,ff -.,.,. M W ,MWA M zzmssmwmmaamwpb Q :Aw mmm umwww-mmmmmwwmkmg. mwwmmymwf Wwmw Kmmmmawfmmmmww w,..,...,.,,,,,7m-,m.vfNx X E 5 41551 241 2 ffwg E 1 il Ez Eggs il S E E E 4 iii? 5 355 gi 5 1 5 . .. guigf-5 55 ' Fisk Q f W4 M1444 .-212 -- 2:-1-I-I-211:521:111:WEEE:gi:E:5111:'1::SES515111,11151:1-1g1g,,g.:1-1w2:f- 55155315-3151: .,.,.gQi512:5:5' 1: ,- 2.2. :,::::gE:E .E..2:1s J12 -:-:1-1:.1:1:.:: :-E ::.:1 34,55 Q, is g? Qg5sgg5w5.5wvv1w14agP? Qgm .,.w44w1sgwg5.'gggzs. Q5.gS,?:i54,E?3gS1.mlZS4Za2wggy2w1ww2vHgg:- ,igzwgsez333:55f1wwgg'g3:fig142S2JiwS1iw:..,12...m4m1iZm4q4Z1 mm gi HS: 2: 1.5121-:12..2: 1-:---:-1,1- mga? 214 ziggy 2:':2 ggmmi? s3ZSiEMkg5H5 if wmww'MQW4Zf2442mmT9?4vHmmwwffwwmgww P4 HWSSGSG 946iim'R 2iM4m44mEiR2w'WMWHSFEZiwwwmbvbwUQSWQW M .2 , 4 4 1--1.-.:.:114441,.1 4 44 .44 . 4 - , . 4 wgW.4,.444.,44..,..4,4.4444m,44.4M41AmMgP,. 4344444435444 4441444.54 4X44.4,iWms. .1,44444..4..4.44,444544.444444 1 4 by 4 44 ggfg,g5,.,.E.,.g45,m1SgE 359422314 4:,1,:::5Esggfw4g g3agw,M,,,,4..4445,W444mQ444m44l4Mggg.g.55m,44.444441444445.s4..,4.4W.,.,zS14 4444 w1f1gg15g:s4,14.444.414444514441435 V Qgwgivgi q-lim Qwggigqw :--1: -g.-g:---'.- Nawaiwg 'Q '21:1'- .':1 '1 Hggggggwvggw 1::.- 145 2, my-M444Wm4wm2gig,.Q1?Mg5:N'WPF8SfQ5SwKwglrkmfA23? WW'Wm'S'aSSS'Z9222mf444411m2gwWWi:Wmin1vwww1eM3wgfgPg?4'1:..W44mw4sMwW:v,,gPwM434 4 44414 445,353 ww 44 fwgvqggwg MN wgwg 1QmaM4444'gMS4w?s-sgSs4m44444i4444, 41:11:13:ug.msgggsfswm44gmw3111M,::giissQ4Zim:.six15,22f::gz:sg:sm444s4.1444444w1xFSLmQ25S:4421:f544g2 M W4 4341533 . .a w ----,ga11111- 151151g1f'1g11g.151 13'- -'Hs ......:.1x,-,1,.mW? 'M444 .13 -2 Q QWmi3iJ53geEfEg21F1Hx441ZfG444?KS4Sw4Vgwgvggw Mg5ii.,..4144g5Aim,-444m-444w44gw1-'QQg32Q2?.?EEf414ww4ws4wy1ms4414rm4fzm104sw1W2wM1f:g:g3fa4wwwxwmvw 22 m44444g .... . ,444 4 wgzsZW:HS 4.ww .f1f?2:fw44.44m4m44mfw,gQ. ,w44444m444M444444w441455535444454434444Wm4314514-Q151111231wwfggsggzggmz:.Ts2413wmw1e-M111Mw41mQ X 4.54, W '- -j:':j:j:g 1g1j1 '1j.g-Q- ' 4-mg a3ggg:gi5w:q5,d44,...1,45HW?2EMgg ZSZWSJSQZNSQQMSFQS' EWESQWSWQSASYSWSKESY533221532H5233SXWDPQQPEBXSEESSS3fSeLa1Xwfw44SM4544XAKEZZZSZQQLR44-wmfwwgggi.:QBQSQBLSTZQZLSZZZSQFQQQ M 4, 11gy5w4442:mMww44mww.g.z44aSaN.44444444144441111149wW:i?.fmw4yfw1:sN':.s.msnszszzm,wwgmzsmisfsw4m414Mw1Mm4111111112 4 931 2 1--1-1-111, Vs+zg::'gp?lMS2fmffima nwgwmzfsf-2:25Msrsiniiafifiiwmmzwk 225214151111111515:sg144114114fi2e'f4i14Sf S14kS5wgsggfzfgziiii'QQRSSSZBYSSZSSE' mwmmwggi w ---- 555 ws: ,.w43334f+gg.,...,...4,,4g4mmg11 :gigz5gsz:::::4sg::zezmw:44:.:...,444.32.4 4W,...44444 s 5 ......w-firmly W. . .,x..,,,. Q. 5 'fn - 1221 4 2. Q 11 1 1 W a . vi 4 s 1 H an K S Q9 2? in Q S :S ' E15 152 .,.,.. is y ,,, x Q ,sr 1+ 2 Vs- 'iam fm? nigga Ev ' 1 -Y ,.., 5 K V EJ ws 4 44212 123 K ,., ,V .14 -. 4 .-.. 1 .,.,..,.:,.,.,.: E zgg- ws. , 1 EE. .. 4 2259 11 ge L :fiiw Q 2- 5? ti-wg iii Z 13521 l 4 Qi , .SAQEE 1 , .,.. 1, 5 IE . ,... 1 52 .iii 4 sl ff ...... . 5?g3??251 V251 154151 1 W2 13 5125 is gl 445 Q S 4 . .. 1...-.-..-. 2? I X 5 zz 554 5 X Si I 11555234 Ei 1? 11fg1.ss,11 42 15411 5 Ni 53 21352 541 E41 w F155 gig K 523 13533 Sf , 134 411 131 s 4 N1 5 4 mga Q E 3 5????siFi55 X 2 'Q K Z 2544 5334515553 f 951 3 .1155 su WEEE xflgiifg 53555 22 isigsggsias W 41421 5k 14541 Q 52 ----- 4955 32 5 E11111111,-11 ..111g 1453 ggi? H . ,. 5512 ix 135 Es? 5. xg 4 4 my W I L54 5:25 ss . llll .. ' k ' W K .. ..,,.. E .... . .. i 511' Zi if f , 3 gf? 212:42 x 5552255 4 as wa gf? ,gag Egg! HSE! Q52 M '2E 1gSE4.gE14 if ' 3 iw 4.1 1sff151E 11i S iff gi. 155 338 55 1 gf 15 Eg Q Q. Xa 5224 W 532 55532 255 E 4 , ,4s4g.s s .Q E as 5 in 4 '5555 a N54 ess 2 x4 E gh 5 ..,.,. ..,.. 5.1. 1.1-1111:5151. 4 5 Nm E5 Q 245 3 si ege :.,.,. 3 Q .4 5, 552423 5? . ,.,.., . 1 ..:... miigf 3512555 2 E figs! 4555 5 453 gag: l 2 , .4 I ii E we 54 .. 3 E 2 S i 4513 E Us 43595 9 333? 1 5 522 555514. E gg xy 5,85 ,1 Q, am, 52515245221 1 5193355 gm' e 1? fi351 4 1g4 'W 4 4 1 415 11 145 .2525 il Figs? is 35 5 Q 5 SX5 E Eg 1 5 4 Mi I A iz Egfisggggi 542 A EEE EE gi g ,X W ., ff 4 424. N '9 ff' 25 ,Z ,1- WW ..ff 1 1, E 4 1 I vw ?2 veg ,v 4 x Q, .. fm, . . WE EE f W 553 53 5 I I 45 E354 5 5 151545 1 fi 1 11.24442 4, 1 411.65 2254215 , ig, 1 11115 252 E xi i 15 E5 552553: 1 Y as !47i1ig3.4g,if iii 22515225 5141415 5 gg w?i5fifffg1i?3 55512152 4 5 gk, 1 4. 4 E325 2125! SE 41 5 21154 - 2 mx 4: 4124 ..... . 1- 2 . ., .. I ,. ,. , , 2 3 E1 22 Q: 2 ' 'Hfief ii E 1 5:1 . 4 5554 4 'i V556 -11: 4 Q .1,1s ---- 5 4 W3 . 5T , g si 25 5 gag 4 , , 1 W1 Ei 3 ' HW Q E.. .45 , xg ,QE if? ....... I E., E:2:1.:'.-.11E1 .:.... - 1 ..... .. 45? W ,,,.x ,,., 4312 5 E ,..,. 65 2 ....,1... . Q I f 1:5 Sa Wig A 4, E :-: E 3 5 , 1, f'-x , , xxx , vwrf , 'Q ,M rf' ' I -ff u fm 'Z , la Ei? A 3551 '4 55 2 25 YE V .,. -1.1 1-.11:1.1::1,... E2 v gm S 5414 EEE 54 5 Q' H E .,.,..... S5555 S i . by ...4 ,ERE R 55 Q 423 4 as gjsgigxgg E2 W 43225 Ei 25 5 35? ,. xi U.. ,.,. 5355 S., .:., . z 3 E51 53 55535 mgsigigiggg V i 25451935 1 gi? 2153355 , mx , ..... . . 223 .5 223 f E31 2 i g Zf 2335 .1 .1. g I E g g si EE EH l 2 i E Zwgg :sag 4- 2 SEE E 5 g i g? . . . vm-a d E 5 35:52 ' Q IE? ? 3313231222 S 555334134355 Egg if T2 f My 4 255253 4 . fmlgwiii 33?2QQQWWS55Zf3wa:::SS3E:i'::44442535125Qsaexsisgsassszzsssfwfiligg-4155355355534 rwegig Wag? F U as we :emu '- S' 3 ENSSFEF Slim. we, W5 1414444 134.4554 -11.24.29-1 M24 .45 445 wggg .4...4,,4.4.,...4.4 4 ww: 1122S:1:,?Qa:11e a22-4 4 mimi, 2? ,.,gp2w,,,Q:2zw4 444i4,,wHS? - 1.11111--1- iagfigfi 45514 44 4225225413114gg5g4g1Qgg41gggkg24iga44si1441ssfswig wg 1' N 5412 'SE SSS? 1'1'i'R N 15,4 ..:,Ei:EEf:::E5 M5 ' Us Y S ww ' A if 14, ,R 44 H :---1 isis? 5234? fiffgwi'-SJHH 35141 4Gf',g?Y 412.3244 Niiw 'W : s 1'ss?5HaZ?'? Msiiiiiglam vw 2523324531 1S3SSEZ3S??EiS5a2'wv ,gssgggiagzssaigiiigigwfiaggggggggzgf122:ss5sz:4:EEiiEEsg2gQ?3sggg55:5g2::z:14sssszszsggessggiggi . 4.53553 fin 2 ,QMM4 4 444 SdSZ44M4:v mmRg4e.A: 0 Hina wwwwmggv Q., 122254 gilghz 'asiizzwgaggl :s45gj55gHm141SUris:SaiY:zsmfziiigw444w3gQfWwS:2id.zzgzzggsgfizrliazggifiim iN Q?ZW:S'Y'Zx'i':'3,gN'Y 6 5'WfM 2 2444495135354::iss11WWFZ Ti?S3?5m-41vfS??555fmMi'Wm'-5135253512: 42155 -1.1 ...... 24 sfizliifiiaf' 4-W'f':9 22435524 512214 sgqimggw 4 44ggggg,,, rw - is 4 H 1 ----- 43.153214-1.44.2 424531-41M ggm:1w,,w' Hswswgwwgg Q 52? ggi an 50-was 252444 1 :1 - 55 Gsszzgfi m34f'pS'Q E? 4 1 4 14414. 1 44..,fz.ff.. 4 4 4 4 ' 4 Q: H 4 . 45553 iigisggglgiigslm ,:1fm.41ga44S4:1QSf5?EsSEi333g22 iswixsssszziigiizsiiiissgifiiisse 552552 svsiishiz23f?5E?:5m???S52GPffWWSig?gWi35 EX M gi 4z41442W ffrwwwz WSU Ei WW 1 Q. lfziiwzzz M35 3'?'2kB5?f'?fi7?'sS?f?+T21Mxev:2'iffwf'Q552252555-4Sg22sfSis2SE32S2iMS:za55wEEi1Ei5iiE:sQSRHSSESWQQZEQ was :42W'15f?g?Pjf if-44422215 S2 V'2iiw,g,.N 523254175 Q11 AQ S4252 N5Q71?Efmi'f5a2i .44 QQEQQQWSEQ Egg? if f Y? Bb V11 S2 :a1g1.:11s:'::: - ---- NEWS? 4 M . Es . -g :E:.1g ..,. , G .41 pf 9 221 ' 'W MQ 21 4 141 fi-15 11115551 14:1:1:sQaa:r:s2g:535I5552125-fE'EEif E5-11-25,55-E5-21 1:1424 sgsgssgmsgqzi 21E1:' 2-1 :ZW 'MS .-.-.-.-. z 1 44425144458 .4 ----- 2'-:-: :2-':':21Qk-' - -2: m344v444M BARS 21.1 i5Sg?3gE52 ' S 552S?EQQS giggggggiiiiiiiggggiiiigg g 41 1g4gQf4144-4glim59g:445zaS144fAk1Qi12Qggffg?g35gfgiiinggg 47.4 vwsgigigggiissizsisrgzsm U SS: 22253 44155335 He 142 ig? ssggziiwi 425555152 55fQEi:5gggi5a: sz5sas:1gg 11 ffm illiiwiv-4ia.Q 52132621sir'PWff:Wsfiagi2?2?g:.4E?n444E:YWLi'f1.41iWl 2-' LQWEFV 15,253.5 if W1-MQW' 'Q4 SJW ws SFS? wglggg'igfiiiiigiwiiifwlligilggi'Eggf?u-1533135335 922 g11wf141f41.:14wa4144g15.321:1224Q441ssf22. ,., ,.,. M, 4 QW.. g-gg ,.,,.,.,., . 4 aww. we .MQ 441313 ww, 5 Jgswgb ww :,,: sf V 52 gk 1 . 111515 M5 4 4 4.4 fp 455525 g3 f 4, -':'i-If: :2.2:2:22:2 :2- 21 .2 Zvigiggiiiii wg E5 1 24 4 . - 1 1155511 5 2112 21 255 11 ,ww Wig ? Ex .-.. 4 asmmgss nge , 4m3'?E'i45iwiE 25 Qiwseiiw w givggguaxg .. Siigggiiigggg-5iE3 3 g ?E3iEg5gg5 5g SEggEgg Eg 2 1. --::.:::::: E32 3 14. 521443334355 NEPA, W 'U 2' .1 'fn v ar -img? maxim Sb 4 Mmm HMQN SHWS s agg? REfM:3SS?355:EZfiZsilzismziiiii TW? kE225 3S:wQisiifsasiisiezsssiii 23223 5312225222Eziiizfzsaisrsnzssgggg awwg 225331, bfiffiizxzfizfm M gm .,45g?1435w1iwfvgSvfg3E:2:g3s msg: glziggwg ,g .,.....,. 0,,,, 4, . ' W44M ? 653215 35534444 W ' ' 111111 :i?i:::.:E:i:g1 1gg Sigsiligggmigggd 61332 E 1 1 gEE3gEgg55443ggg5 ggg5g5i gg35 , H4 152514511 2 521: f' :, ,,,., ...Eze ....... . G5ek4 ,g ,,-, ,,,, . .,.,..,. 1 1 mwzwxspwgg .wi 1,11 1, -- .1 1..1.-.1 Q S' Q5 5'55?ESiiiW55iS 12 M 1 5:12111 WSG? Y ala 5' ...... M44 W?-M 1-1515452-is 5 455 45 1 waz' ........ , W ,E ....... 3 ..:..:.:.:. 443.45 QE Wi gig sizii 551 :.:1:.: H :-.-'-:-:1g wgggwi ' ..1: ..:111:. 2555144 ----- 1 -------- W5 E5'E5Eg :1:?E:F' :1 -'H + oggui gig my 'f i Q?-3532 Qwm?M33 EE sEtS5Eft?2324i?E555fS 6 1:5z, 2z'2z's:'zLz.. me 214454 42 214. fZEE1511g:EE1-1225-,,.if322 :ww .. 35345315 Misgigkizm ,mbgymgm we 4 Vg ,mg m,.g 3E4wS'QQ24Paf M, ,,,w,,3,,. W is 4 if S' .... iawmssm S V J' 11 4. -1' 1: 2 x 25 2 ig 11 i 5 ig 51,11 ': ' , .,........,.... 4, 1, 5 if iw E34 Q Els 4 114 a. .1. 1. .1 ... 1 15. E 5115. 15. 36551 E35 5 'T :5:.E. H 531 ' ,. .,,., .,....,. 1 gi 5525552 Y 14 - :.. .... . . ...... 1 ::,:2:I .2.2:2:2: kv 2: Wgigggglgi 553-:w:zg:g,ggg 'E 5Q5f5,5Q1E.I-gE,1.. 'f W , ggi 44 , f 55+ , gffggagfw. EERE 3 Q gwegggggsgg 1 Q 4 wiki? H Wg 4 5 ggi? Q 4 an . . W? .... . -1 ....... H in Q ag ..... EH-5341. mggggi 'Y H gmgfip-, - WE 58 U' ' xl k Af 44 3 gi 4 sm gm:.4w?.4m4444g :egg + , J wa gm? '22 4. , SWE Wg: 24222 34 if 2 D w4a4gs vw + 4 Q -' W 14 a 5 A .gg 411134113 ki 1-41. 1 . xii-ii w dgw 2 .4 Q 4 S 544,44 .,.,.,.,.,.,., ...... . .... , . 4.1, , Qwkwszg. 4. 4, 4 4 4 'QQ Qian -'- f'1g1111g11.1:1:1: wsqszazifaigiisfzzsai awwm23,,2W:.:4455 , .,.,.,. . . 22,444 F, 5.4, , 5 ,.,. 4.44442 n44w2g29,4 4:44 :Wai 5515555551 1231111j .g.2.1-113.5111-11.311 :Q555m53m w1me55:.f:S.2iiQz11:QQ155g5::gg5gg5S5Eiggggg?52ZQZi?.1'wiiizgizrzgm ,..,. 2322542224 s45fE2 g:gg5:2i2zff2Q:2:::Ti:g.,4:g :::4:::1.35EvwW:?e1i::2i.i:23124145353gg,g,fgg.5,i44 Ng . . 4-.4:w.,WmwQgggqE HQ - - H ,g:k,f?S,4::4,.g,.i.4,1,14.4Z:,?m41441434g3Xg gi ,iywqghifa wugggg 5121 5151255 bzsswsffww 1:1551-15-W- fi :xmas X ..... .... as y444 EwgEg2sgZ4.4,s4 mgw,,,,.......g gig...-4544445.44 Q:E?E..,w,,,44.4.,444f. 4 9' ia QSSMQQWH H5245 4 5, 41335252253 ggg g higiiggg, . KEN2vfEg3m44p344m3ggggAwaz: . 44.........,.Q .13g44..4,V.Z5..ES W... .4 M. . gsgw 44gg5rg4xQgggysggziwfzxxiiisiggiggxafii535 k:4g4443, 'Z iqwsiiggisgggiii .fmuwisigi 444 se. va.. . 33352244553 Y Q 155:44 4532554353532 gag:sezzsssisprsiirzazmv 'f'2r'r2 4 'E W mf W 54344 'mff4i155S5?'fiS31...:l1i4fQiESif35EES44-4V'W2ZZ3MiffZ?gE3E3iiiiffms 14 ' WW -5155351155515 4.:1sQ::z:21:m4::ww2W . Egkgwwssasssaazsszzgswihzzwa .... swg ggggggimigigg 54.524 4 32 444sEg.4..444ag54.4,s2.44 2, 4 ,,,, 4 4 w.4w5W,ggg1,....Lge4g4z bgfwgigswiixzi 11,11 g1.11g5-11155 - 432523 SEESWSW 11 11151315 w5iG5HWH2lZi'sS14S?g55 3 W ..:11-111111.11 :1.111:1:11s'fif H 3 M255 -1.if:111 11. -was 4219 H 42355913523 :fe 321 .4 .4 222112252 tg, Sl 12 45- 42? gm ss:1:::1sa:z.?:iS 2a W 11:1 if 4,,X:gg2553g5, 21.1111-51 W X 4 ' 1g g1g1g1-11 wssmigil? ggimviggzssim 'iszsw frf J' 4 V . ,.,,,,. isigi g ssiazsisisiiiiigssiigigfi in ei E K m4wMNSi43.4..g.X S'SgK?3m,4J4ww 53550334444FwwvwmHmt:2S.s44wvw1wwggs,y::3gi,2.,2.4sZ4.,x.4444441.m4S3q4 Q ?51S5T2Sa::i.?f1ss,:f2W5x::m3i?2 5231ems::a:af2iSf?E5222Ez:Q4azzzsssfesiiiiiiazezzeszrfzsfsmm 3255552351311 ,. . , 1, zgzfeggfggimigmgggg gggggwgsszsss wgafazssggzmiiggggiggzxmggs 52:1 s.2Qsf:1f4gg2Kf22E --'-'-- B2 2 'ana :vgwbwf ogg? M. 1: ::::.- ?f55M SZ?4z5ZZ'Qs43v4wgggiiwiiili ey. 4.5555524234 ?SiZZ233i4,QQZfi:f'm' 51,24 ef w 14 v g My ' 22353 S' HP I if ,gg agiggiggigggiagg fggfggii sg? G ,Q 4 an ma ,, va 52 2 4.14 ,gig M? .4 535 443234419 2,5 145 4 Z W 544334 3, mg: 4 ,g ,. + 4 4 www mg 35 Wim gwgagsa was gags 2 442 K Q 4 Q5 4 4 ' 5 H , .. ,.,.,. . 1111111-12, 5 ihgg 1 gl? s1?::E:s: :55 444 Kim .144 4444.4 4 14 .44 35 E gf .4 4 .... . .,.. ,... . ...... as .4 444. 4.44. .,... . ....,.... .,.,. . ...Q , . 4 4.5 ,, M4 .4.44..,4444.44444s..44.44- W- if .-.-.- - 1 - .. A. 5 ,Q Q 4 .. --... 4 L as 54 S mawfg W,-.wwl H4256 Wibiimx iwwwvl-ff. 22 , W.. 14, ..w.4.4Ww44 EEE gf 444.5 W.. 4 1251 4 -------1 --------- 1 - . W P W wffszizzzzmffigzswssfaf21:5121?5QQz:sSii?w::i::2:i?iSHQfi444151214 SA512441f1W:Wfwz:::i22f22 MS ff5f1f1 f1- 5 Q ..... . :.4:1mfa?azg5z msiiiazszmfigigzfi4s411?'ms:z5iY'5gggs:22124gg.,:gx5::z::?::ifgzegm.4s:rf::,gfz::2:5Q4iggg1,m Wi1:22r4wf4iZT4Z1AE: S ff, .... . 44 21 W1 xfagifigg iigiz . xg 41 56 is 4 51 41512245224 2,1 1. 1 '- -1. ---- - ---- 4. '- -5 ' 'I 2:5:1:sf:s:Z5.'j15-51-:::.2r 4 Ha5 'g4 2.211 ww ff g Kiwi' 0' wg 3 H y4f1W.,w,,.g ,W.i3Ss:i'2?:iE::..I'Zi S1223 4544444444614 . ' .. M, -1 ,,., W 1, . '5 EF- 5' E3 - ' . E- A i .. -M W M 1, ..1 ..,. 1 mmm.. md M .2:I'1:2:g:1::::':::'E: Ri fiiggwxw ,... M MQW? :EVE 2. 1: 551 .- www ' N W ...nm 21 M-,' 125 M 52212 gif M-W QW H. 5... s,Q:fm:: Wm96'fj,xjQ'iw,1,1 W-WWW 1 -M-. ww www.- :M 11 2 M ..1.W 5? WW 22 mm w1wwf2m2 1 mm .. 11, 1.1.1, WW- t 22 11 25 21 2 1 ,..:2 1 .:.5.:.i?,:,. .:.:.. .... 1 1 1 .1 EE, 111.111.1111 mm ...... 1-1:-11.1..1 ...,.. am 1.11.1 .....,,..,.... 1 .1 ,.,,. .1., ,.,,.,,. 1 . . . 1 11,11 E 111-1 -1:-11+ .... ..,.,.... . . 1.111 . .. 1 5 ...... . .... . 11.1 N. 'T ' E W ..1 595 211 1- ' 1:1:.11:11: 22E:2:-1:2:2: 21 f:2 -:..1:1 '-'-' E25:E:::1'::::1-::2 :2-- 2' is .. 11, gn 11 g E W fn? Qr.::.:,, f mm A.i2W5m mm mwmlmff .if 3 111212222 15112, ,..1 231 W1 W. .1: :-512121: m 'W 1 9 .1.1.1.11 ..... 1 H2-----1-11.-11-1 .-.-1-21z:.1:1::1:11:1:1::.,:1 ......... 1 ...,.,, 1 . ,.,., 1- -. - . .- 1 if, A Z 1 4 9 1 vs ...., .... g 5 2Mg5 - ew 1535'iH57 'X my W 2 ff ' H1 1z ': :Z 5 'f ' 'gfE::5f5:-125522-22325 E 1 . 1111123g,1.:g5g1,, 53 Qgywy g ym 5 ' 1 ' 1 . - :' .-:2 W sg . WSE? ..1 .1.1.11.1. .,1.,.1. 111m1151T11s5,11111111mQ ws ,.,.. aw M225 ww'-2551 - ima: 2211.252 111 -'- -'-' :1f2E2.:2: ...1 .1.1.1 , 1111 ............... 1.1- 1 gig s z.1e252.2Wi:x 1:gm- 1-11:1 ETE E EQ Jfibigggiigggqjlgzzzgggzsmgzzf gif-iff Q11Mmsz::2xf1E2,:f1:z 21f 1 11 Q1 .-. :-: :v2'-:-:-: :-:-:.-' 2 'E mga .3 -2-2115 1 .. 22222 I I E ....... wg S? F? ' z ,ZZ .5 555125 aim 1 Eg Q Hs Q Q wi agp Q32 J 1,1 3 gg ,11if2.' . 3 A8 1 : zszsisg SE '5fB5?E f2222i5.if 5'25 11111 11151151111 fm 2152111 me 013111 .... . .W 125,111 1 11215, gg ,Aw ,1,. ...... 3252552622 v21151111z?W22 3 2 1::5s52?'?5Qgzg3?2fA25E?Ess?5g . 191255511211 ms: 2 3251-5 2 if WM? S 5 ,..,.,..... ,..,.... ..... . 2,52 si? QW 22 2 1 W 21 2.-12121 111 -' g?g1,11Rg.,i,g:11111211,11Q12s ----- Q 5 1 ,H -115 1 . Lili is aa 12221 W2 mmm 2.,.w. . V., 4-...,1 ww :1 Vw... ...wwlfd N P 4 N '11 .,.. 1 ...,,..,. 2. ..... 1 .121.,1.,1 :111w: sfwmxzgfiziikilgwgsi ., 25 :2 Eggimiiggggggfs 22 22 11 -1 ---- 1 1 .Ei ......... .... . gQmggQgQgEE g E:: E:E gg gggwggi igsgiiggg' 5.1. 1.1 .12 12.1.2152 22' 11 . :2 1:-2: Q12 :E 1 R 1..1.1,11. .1 1 23525252-2:... ..1 1. ------ .... ------ es 11 E221 1' L.. Q11 .1 1 111 5 R 11 1. 5 Q ' :Q .X ..... .... ......... 4 . 51 .. .... . .,.....,.. . ------- ':'2:2i.22:'- -:- Uv ' B3 21212 S122 2a2: 1.121-'..Ee2Q .1 22 M212 55353 11 Elf: 22 2 1 ? 21 Q 2 ta ii gs 1 as ,1 :E 11 I 2 'L 1, Q2 A H951 1 w 1, 1 .ww 1 .1 .1 13 ....,. 1 .. 1 1 1 2 2 1: 4. ki 1 Q, - A ma.1.,..:wm,1 ,.,, 3 . h. , is S 11 1 5211512 11 1 1 1. ...., L-- - :-:5 fl 11 .12111 11: ---- E 1 .. ,EE K f .... K 7 34 3 ,.,.. . Ffa' gig is gg Y im ' if 1 ii is z 535513 1 X 1 1 5 W2 Q2 ggfgQ?giM1 gQ1gR:iG,1 g ---5:--1-2 .... 1 .1. 1 1 ...- ..,.. : .1:1.:1:1.g1:1:1 . 111Q 2W:f:.-A 1:11 zfszzaqwniggs ,..,.,.. 1 22? 2:5 -':25 5' -222 .... gg .-.-. 1 . 2: 22.2 - -1a1- .- - 122-122. .1 .1 .2f:P15: L S gg 3 1 ' 1 1 .... 1. . :222.1: 2 22 222 1 1 1 -22 . 1 -'-' . .2: 5222?-1:f:EjEs5 ' 11 385 4 E11 ' 5 Eg .1 ::1g:,:: D. ., :.:.1.:g.: 2 W ,.,..,., A E. 1 -11 11 - Es s 1. 121 3 'QE E -25537 31 ff 1:9 E M z B f': ::f gs.g 2 gszt 2 ' EE I 'mi'A 11 1 Z 1 .1 15 2221 i 5 - -....- .... 5 1: : E ::-' -3 2: 2 4 g -1 4.1.1--Q1-1 11-,113-11-111 -1 1-1:11. . 5 2 ' asf: 111111 .11 ..1,1 11-1 A 2 21 ....... . Q, .1 2 . ffj In ........................ in 35 W 22 E? 1212 F2 W :E 1 E Q 12 21. 551 Q 5 gig? 1 Ia 2 2551 3 . 4 35 g g ' JE wi xv 1, x 55553451 11111 I s 32 L :Eg 15215 ,129 Q L I ' 2235 1 --:z.-f ,:2 E.: f:g -:-:-sf:. -.-Q - 3 1 2111211 1 .1 . E2E2'5S'22H252:E2:.E 252252: .:E3 2 111111 .-.1.1.1i 1.1 11 1-1 1 .... 1.1.1.1 -g:gagag::.: .e'1..1 :5:- H I .1 Q f l: : :Hx 1.:1.:.:1'::::1::::'::::1 E fs. gggg 1 3 Q 1 -- '---------- 11,112 251 331.11 QE .six - Y 3 JF: as fl ..... . ' I' W :fs 5-5115 521-11-1- 2.2:e,51. ..... 1 2:2:i.E::::-:11.::::: g- 35-E'-5 52 .51 .... 12 22251211111 21 1 9 .1 S ILS Q w 11 E 1 ! 5 . ....... Q11 if 1 1 ...1 QEE E HX? M Q 11 - k-- 1... x 'Q can ' X 333, .,- N Xin? 4 N 1 12 4. 1 fwm' K N Y' x 'V 1, 1 1 gf 1 5 1 gamma 1 Mdvm: 11 1--N. 1 2181 ' 1 Q ' K .W N1 ,,1 1 Nw.- ,sie X Vi .nk A rf X N as .ff - QE- Z .um . +1 A v-- xv- CSW2 f I fm. . m 4 L K ig' C 1 .51 1 -vi? ' Y 85 1 11 1 fx B .mf KV? s U0 :af 1 i ,1 X u Q 111. My 5 we 1 E222-22' 4 X .pf ls, WWF ik X 1... fqgr viii i.,-M.. if 5 I N42 ..1 . . . g X 'fx 1 vw . A 1' f X... a E 1 Z i ii' 1 is .5 11f1f sais 1 5 1 E Qx sgf 1? 12, 5. x fi QE! Q .gh 52 K S EE2 Q KEE .1..1. 22 5: si? 2? 35 .E g lb ge 1 1 gl 522 i'. .::.1:: 2 5 5 6 ji .... 1 .,.. 1 5 .1 ri! 111 1 ..... K 2 1 21 E ' lui 2151 .2 2 :NV H 5:2s:a:E:2 1 if 5 9 5 s W EE' xl E ig 2 1 .5 L 5. 25 I ::--:-f 2 5 E 1 .1.. . if E . .... , 1. . 31 11, 321 221. W 1 .... . if Q 55 2 5 . 5 W 1 35315 1? 32182 45 .222 . ........,.. -H 2-121111123212--2 4 1 ' ' k ,gy I 1 1 1 21.41. E XML. 14 1 , L 3 1 2 1 1 1 'z G EEK? 1 XE QE? f QF 1 J 2 5 IMP S1 2 5 1 - --1 1 1 zz i 11.1. :Gs - is. ' J 1 1 1 vm 2155 2 Hz 53222 121211 s 111 512521 i 1 ....................,. gig 2 Er 2 .i 1 .25 223 i155 51 Vs E22 Q if! 1 5 5 5 :1 5 12? 1.1.1 H1 5 122 5? as ez 1. wi I .2512 1 ' K' .11 Q V! E'?E 1 31 Q U22 , 1. 12 1 94 1 f 5 gi g gg .. . 852355 5 41'-:: 232 1' QE 2251 222 321 2252222 F gg gf! 522511 ENE 1 2 i f 2 ' ............. 1 3 1 Q 1 1 E ..1 2 1 1 at Q 6. .' .. .,...... 332 52 ............ gg ..,. c. 14 1 .11 if Z - 251 ..11s .... 1 22 2 H22 11 1 j2I. .Q::j 3' 11 Q Q . E 1 1-1 5 .1 E g ....... 1 1-. A794 ...Mk E if .1. ig 5 ...... 122 21 . .X S X 11. ..... .S 111 ' 2353 552 255 2 3. :1z51g1,:5g fa.-1 W- a X 15111. '31, 1 552 if 252 2 1196+211 Www Q' mt. z .... 1 1 w. K s .M ' rfb 5 Qffl. 1 'Q' '4' 9 3 E 1 1 LMA ski? 1 123 ig ...x S i 3 i 1, 4 1 1 1251 s M 1111 111. 1 ' 2 2 1 1 S :Bi .1. Q . 2' 23 2 Q 'Q E 5 Eg 1 ii 2 .. 2221 1' ......... -.-- .-.-. ..... 1 ...... .... .... 1 ..... 1 1. .-..-. 1 1 ..... 1 15 1 ....... 1 - .... ..... 1 .. H 3 -1 ...... ..... .- E 5 E 1 XE 11'.. 2 1 - E2 52 Wag 121 QD W .... .K 11 ..1 ---- ' 1' Q' 2 2 22 1 5:22 2523.252 'iwgiww 1. 1 L E 5 152. . j 2. 1 z '2i 1 N 3 . ' jim, Q. ,.. img, QP www 11111 1 M5211 222222 ' . .1 2 111111 1.a1 f2 'N :-2:' 2.12 srl 11:1.1g11411,.1.1 2 'M 271 - 1 1 .... QS 12 -22-22 21.11 Q 1 U , 1 2- I 11211 1 213 2-111 21115111111-.1112 1 2 2 2 1 E 2252252 5555 1. 2 1.1., Q '2' 1 2 N 1 55 E5 2I.2E :2:' :-xq1q1L1,:2.2'-. .,f-' 1 :2::1: 1 21.1151 1.1 212.1212 .11 5- Eiiiilixfgiiiwiiggz za -2 .:1:,.: 'f 5 . .... .. . gig fi -Q-1 sss::1WS2ssg5e2?3sS2 im' s g 52515 11111 22 2 qgiigggfgs 51.g5Y52 f23 nm 251 ms, :-21: 1 if 551 22 .1 1 . 2 2- 2. 5 ' K ' 11111122111 mgmw3',g1,vgg52 1111111111111 ww qv 2 - . 1 K 521.51 .... M2 1511:-1:135:5-V.- 151351:-1:-1: .1 1. 2 f 1 1 QW 132 K ,. , 2 Y- --9 1 1 1. . 1 , E :1:1 1 .... 551 5555555 s2115m1s'E22S2222iz:..11:s 2 2 11 ' 2. 1 2222923222522 Q i32S'S222223W5w 1 2 ' ' . 1 2 - -2 1 me HEI? 2' 1 2 1- 2 Q1 S2351 21,111 1 W 521ggg:g .1..51 - 1 -1552252 5.1125 .125-151 2:s2ag5g1g... 1 . K1 Q 11 1 135 e g: :5:2: -22522 Q 222 15 2 K -Q XX rg 12 322222 S' 22-152222 221 EEf1- 12-2111 .1 llll . ' T' ' m 22 wa 2 .52 9 2 3? . gf? 5 1 'Q' 21 gg Q'SWa:seg1.1-122W E555 I-15.1521212122 '-'- 2 .1 .1 .1 1 1 1 -.. 1 ..1,W N ..., ,1.1 1.11 1 11111. ..1 1111 1.1111 1 ...... 1 .... 1 1.131 11131111 1g.1gk13:1v , ,,w2,,,, 1111.1 1-15,1 N 111 1,1 .... .1 ..... 1 ..1 ..... 1 1.1 .-..--.-. 1 M ........... .1... 1 mix M 1-1.1.1115 WM, M 1,1,1 1,1 .,., L W, 111.11m ..1....1. W 1 111111-11.1.1 Q .1.1.1. 1..1 1 1,1,1,111.111. .11.1.. .. .1.1.1 -1 m AS.1afMw12fm1? R .. '2'i:'ii mm -mf 111.1 WT-MQMH W 25 2 gE1l Q2ff 1Gf1w'2S s2:f22? WwgiimWSM 3W'WW 2' WK NWWQE NM2 ----- Q? 'm m If a gggelsj xr2.:.x2.5'ff 22x:12a:s::1 WQ1 m wf awm ----- - ' ' ' ' 1,1517 211-wm1s.x WM M I2'I5'I5I2i12 ..1.. 1 --v- - 1212-12111-2I2212E52I'I5- 25 2f 252122-52-1 -2222:2E2E:Es2 21 .1.1 2S 5Q '1Z'W2wfUf5 W 2RN'2fv1 f ?'fL5w3Zf3SSHE1' 1S ------- 2 wQQm5QHB1 'Q fvwMvv:V1imm5 225- 1 Q: MME'2m? 2223125252212 'W m9m3 G--2:2-2:.2 -'---- 5-2555-2522 1 5- -2 1255 2 -' 22:-22 2-2-12212 212- 1 f:1,sMN2.'fV fQ-f-f' Qwef1 1.1.2. 12121222222211232-:f:f:.f:s:1:12121: ::.:. 2: 212 1 S 22 WWW Wim 'WW' 2' ' 2 212212?:2: WW::3ll?Qf3'33f WwmWmij:'M2 FM MAHCEQCWWNM 111211.11111111.11112154515222 M 2 my-W 555 MWLWWAWM 2' 'fww' W W HNMWM --fe 11 Wmmwmw ------ 2f22fJ22:22i22E1:121.f:Z.i. ...... ..1-f-f -- 2 ::-....2.2'5EiTf :xgaw25'.a2:m?-Qw,.w2'W11-21Wl'i11 .1..1..,- '12 -'mi 1 M2 T32'?'? mSm:1a1:1:1f wZ'?lixE g,351E 112511 E 5 3 Egg ...1.. 52 5 is -2'- 2 5 5 if Ek! gg! in ia? gg Q E ww S1 12 1111155153 2 1223512222 5 235552215 E S 1 gegigff :V:a:w zQg V Wtisislzsfmzzz- V, dVMgggg:Q1m.4ew-:aw 1gVmeV.fVVwR.miiJ3Z3f Q Xmsamv VVV ,gg3g,,VMm,m53gggeg3ggx w5.gg5g5g3gmfMEV Qzigggsgglagspiilitiiifx iftwuiwwwg V Vf::V:V1isfVV Vf:V21VwiVVf1?i iiflgzzzsfw mT'sSiW'Ei iXSi'SF2?2f::'wgV VV isrzzzsfsiiifiwgsaiseiz::i:::::LL:L?5QfVV xg fziszzzxzsssszssi Lfifbzgzzszszisgagisw QEQESZQQQVQESRXQSNRQQQQSNXW V8 .-...... . ::?21W2mikQQSSSHSESSSWYEV we VV V ::::as2fsQii2z?'1SmL'i:sszggsgggggggwmm2m:sias2a:mVVSVawww-?2www:x:VggVmpgV QVVMSQSSSSQ1as2:s:pgszzzsflmezQ:Vupwxzrsakxfssgsksgmgwqixw Q :mgw ,kg QQ sxgwwmw Viwf-NQZSESXHSSKQMQQ V, ,...,. V. -VM LK gf Wmfww., 3 bg wx on V V fwfgi sa, we L Q m'i,2mw:S?S5EEeQ .VMWVVQQQEH V2'5gx53Xgima5i,iS,,gg Wplwikpdiiygisifiw QE1z,,Wm?'1w g w.N5 VVZHQSESQNHE 'E?,.im'kQ.w532b SSRN im QSBZZQRESEZEQM QW W f wgv ig Q Sw: g:,'-5-ggigm -Vmwmxxw V, , :misszzzzsfzximM:5:fezzamssfgigiifiiV5fVVz2sssQVVmasg:::s:::2EgV1, Vsgsfwfgifgiggga egsgy:zagggV5VVV,siggg gmzzszzigw gggmswiim Qsxiziggzzmzffs ggwwixsksssiisvezg ggegggiggagugsf -.--- gg VV2: K'sVs:QQQW VVVVM sg-smgggsssazmmffmezziffsssziizzQVfVf:i2iisgysgggigg:gx:sL'V:::z:gE::a?:SiwQVS2P2i2VV2V :VV -L fsmzmmiiigw Eigiwwi ,V?EzVzw3Sggg qxswVLfV Qmgwwasfflw Vmiwgg swsgig ggmgwm, 53 252 H12 -fa.L:i ::: ffV2fw V2Mms:VV? ffffif: eVL:V:efsga:a:V::- V Wm,,W,,V,V,VVWV,VM,,V.Vwss:V V-VVVVV W W5,Vg.g3,V,V,,.vg?Qg Qgggiigmlgbgy Vg wgmm, V my .as:g:::gVa::: . s::: a: ---VV-QV-:Vw nf: 1 s:1V:::Lfg,:g: -aw e gygw ggggmgggg335553355155-ggggmgw V5 ..,...k VKLLLLK K MW an mkexsmwimgggsi M Qgifzmsggax ag ,: :g,-g.-ig, My -1:V-E.:-5V.gx:.V:,V .... 5::-, -- wmgag f g a g ivi g --g:::-gglgg,-555: --:-- -V-TV..-:V.V:.::.V.V.:. .V.,. WV ::::'-5' -... if ..,.. wi? S V S'g E2,wmu wgQVwWggQgQw XEFQRQQQFQ Q K aww5gWp,,wgMqf.5m10V.3VM.gw.9,m,.Vw,2 .V V , K wwse M35 agggwgg Qag3g9 mgiZg535pgi 2 gH ..... , Q -,:.:jggg:g:j. - -:j.:5 vga 5 V. -2:-was wiki -:V 'L S ' V4 F ,Za V gbMglwsgwgxfggfgmmgggfh V ' -- ' '-:5-g::g:g.:5.::g:5.gg:,.,: 2-5-g -:g-5:'g'g.,. :iz:::,:,':g,5:5..g,:5:,.:g:,,..gg:g B ., E:::':::E:'E:2:'gg:-g2g:- E '-I-2:::I: :5.i.:::5:L2g:'::IE1-aV:I -2'g 2: :E2:' g'g:g-:g-Vg-g-5: :- ' :,: M1213-Wg V V ELL ---- V V V 2 iiiliifiiiiifiiyiwsiiiqi 3511 L 'L 21 -Vf2f2I2 fZI? If'f' V V VV k VVV , V, 2333335353255 35353353591,sssazzzzzfliwsia ,S NL - L -- -kk L g g::--ggg-:5.5:.5:'- 15:':gs: 5:'--f Q--V:-3 :-. ::: V V V , V ,V VV V V V., L V V,,. V - iw:z:':5f'P:fg1f.-izzzzzxfvbfwimiyizsgizisigsh ---,, VV K LL L IH V Lf 'Y' , W 5 2 -2 : 21 Wg ? A ? EV ,155V3v,fSggi5Vf:w2s:fg:zs::zV.,f:wi V V VV VL g', 1 L sg V Mfg, Q er V V L 2:i'x5'iA:w5f2s2fi:f::5.sfwwwwbwwzww VV '-- E xg, wg 2gy5Ngwv1g V z,sg,: WQi?1L: -SV X L Q. A Eiga: LVHg,4gg5zfP2L-mymf,r:VV'yg iVVf5a :r L- V V viii g?ig'W'f2f fLz,VsVHg mE SEZE E E Q ' sg: 2LSf13mZWw2SLE?W2?fE22? miziigiiii Wg, 5 gf: egzsizigkgimgzzeisszifsgwgghww V gvg-1 gisz g wfyfimsigwswwggxzzmfwyw W aszzwzm .Vx zz:'W'?,V,512fl2L1LS V o z, M20 ,V P' :VV 'Ez ,zfgsiiiVgEEEiwE55sVsJ:EEEibwigiiiwggiii V VV af -25 2212: V2V. V2f-f5,f1.'f5 E QEEEPKEEEQQE QV Vmgggm,3w,,fg2?gg3igwmlmsmimiiisil V V VV: :::-f-s--1' ---- : -:- :s :--- Qfgszgs ew V ,V , V E21 ii :eff V- L VV L L , zgagzafsezzzzgfzzf 'f L' ' N Lili ei? E?2Mwf2Vfvx?52?i?H25 Wggiifgm 'LL L ' Nw L gm 533221382 iw gsgifws 5555 1 fafzmszimafszigzwxiiazwEiimimiefiifizzszz N 'W 'fiff .fs:g:::fE25:,-Eg? ez-ff.aVfV IFF' Smgggg,ggg,g3g51f1V3ggfgg3Vg3sVg:WSfs2L20iWiggqgssigg '4 , L'-M1 V V 531125 ' u f-N- --55 . gg,:5:5:gi:g:5: rV:Ew:5. V:::::::g V Y iwXE?53f5QsSgw fi5ffQfgV L? X 'V-.. L S23 22 ff2V5ffL,351g5:s:g2sQffz: V ' f Vg :ssVVrmed5gg,QEigaL4:iV5s4V1? 556222 2 '5EZ'iEr :g flifiigwiiijliiilf V L V msg: ?Ef3WVfffW?i '2i.2?'L5?5??M?E viii' 13E: ' VV L ggg5ggi5222325233352gggiggzggziagiuptiiyii V ...V L Lggsa lmf EEE 2557255 W 3, www?MfgwgyggfViqqzcimsfzatwzazazf S L V, f 1 V M :s.'::,g:-::g:5:::-:ag: ---- . Wig :f:g:-s:':::sg:::g?::' M21 ,QV M ' ,,q. gag? V gg V +V - 1 ' ggi -V V k ,.,.mm M ns: ' was SSEz2:waf5W,:igQ:EV V L L V V V , 2 g R aff Lf, Vg, VgyQVZgVwW?Mw gbgggliiq eg 221fgfzwggiskiwi:fzaezaszizzmgfgwfff LV V 'V , 1 V V V A QEfV?Z'?zEEESg1:sggEggVwQQV-Vgksgwfigggiw-wi 2 Qzswzghesawizggiggaesggg,31gVgggfs5mg35gVV:s2: 'bw V 1? fy Vi 'f VV .V X V 'V-xii we mfr-M 2f'2P2fV.iv:QQg,,,gvf5wSg4L'WLL2 V J V ggggg ' i L g :+V VSGA V,V,g5fiY?'f ff'fLiLl,V zessezszziiiizfszzziif X ' - J' L V, :5Esfi???5???'g i S1Zsi512qfEf?53f32 ii 3 'Lg 5?E5::Ei1EEE zizsssazgzszggmzw imrszzzzssezagg -V V 'rf' Ly V mm 1-VEQSVERVQSQS f1,w33w3f5w?g'2?3Sm ,Mag , V L V ,,.,V,,gmm,,:ggg3il, VV ,I ..,, VV bk L Q A V V VV VV V VV V L L iw 0 V fwa sf15,gfMV4zHV2r :www Vzwf V VV VV V VV X V VV VL Q2 2awVm2i E Viiw WXQSQ V5 59332 W Y if Hg -fi im, ,-ywww. W Wvfwww5m?5???5ri52EEE Siwmiiaiihsnmlm. V 'LWWLMmssmmzafsgrfzisiassm4ES:ma,VV. :ms ,L MQ we QV we 2 M V Via 3tvsSi2Sqziiiizgmsggiwgggggiialg VWWMmez::::zizs?i2E'izE f'5QZ'ZSZl'?2iaw'S2Z,ZE'QQ viiwiigsgnvigikiiiy' fswisa V aizgezzzgggggiiifggagdsgfi HVV:'szfQ::2xwaL2QzsgygM.gVVW.V Vieazaseixiziiilsmlv MEN G 553...?E?gEEggggg::SiE3z:5:5ifii?QEi?iE'i5gEi2gf2LifaifigswggigiiigiifiqiiEliiiggisgawwliilQigffaiqibikfzfxiiigg VV VV,VVmasVVzi22222' '::f:f2a.m::a.,mg2fVf2iifafzzzssz, assziizzsziiqgwgi HSSLSMVV. QE,-5 wzwi V 2 2 ie?LSEEi?2fE22fVf LWSEEE5: K M V L-f:1mVzx4:zQ:fs:::f.mE, ,z,sVs:,s:mgwf: Y 4 9212521 V L L V V ' fgm:gfm::3g:Vmgzzimgwgzhiz was VM 'VV VV .V L' 1 V 3225555 LL 'gwiifiu C3 VV V V V 5 .V ,W ,W:fzf: :g::a::::VV :sf ,Q qqvsggszs szzaaz L ,, -' 4? ' V V VV-1 mwyns V?i5SE?fZiAi'1 wwiifiwifi Qwmgwrw wxsgwiwwqiil 5553255 ... V 'miiiilfif 5552533135121 . V f'f'f'LLL 6222522135: mzmlii2Z'Sfi11LsMVi:L'2f::'1::V11V3agVLVs,:gfL 31:1 , V as masse: gd ' ?4zsEE?032'5'? 352352252335miiilmfiwsiaf 'UH V IF' L N gg U ' MW V-M4-fm-V-4MV'.,.VUV 'Y 'S,'2 iW 30 e3wwuwkZE'qZmL'3J5iU milif L Lsrfszs. 1553515 LKLfLL:f an VJ: 55f55N'g' HkLU -95ziizigiiiifwairazisrms :sv sseziifflwsgfwilimzi V222 H2215 V VVf::VgVVu.VV,mV,,V,,V,zzlsizfzzzzwaffwiwf ffffz:zszz2,zm:s:::sQVVw E151-fm fi 2126? .f: V V ,N L ,V V, m?E:E:Eg5g5i?SQ::xszVg1:BMVVVYSSZTQI1551012razifzeg-'zzsrsziwawfii Lffgfi mg? ibv- X304 NS-TW zr::ss5fL22s::xz2':1a2:::VV15522gfssasifsizsfg:aw::f,2a:zS::E::E:E1L' amz ,aww ' 1 V L V Lx iizzzwiwfiimzzzzzzzfz7z2511122-12'S22I2Si:ssf3,,gxgrgggggggmgi M32 Lfvff-:V mag V V Lg, VV V, ' W 222932 V NV V -VVVVL'LL - wx wif ' V V LVNVKVL L WL - L if 'LV 2122322QEExim22:222VVLaagVsfxf.sg?SQ1i:2E22Hgg2z3EQigwiamigiiiiiiiiVgiiwi522WLfifvlffgiiigz V FN-V V L VVWW V2 gszsisiwf 535351222:SSEeEV2QE2VggV1gazisEV,i::szH55gk?E512VV1VV::QggE:gi2fLi:g2ffifP:,i:Vifg'S,'?fflwQ2 Views L ' V . mia? X V V VV V 4, V , ., ,V VV, N K VV Q 323522: 5inRWisfi:ES?i2wfJ2s2 k'2 5g: 3'g'g3? LL Qmsisimgsaisrxiehgfgizsggmibgfsssw XV V L 152242:zaaefmsmagwifazsmmaiiisw VVYQAZSQzzfwwfwefkwiiZszzfizwwmf-M555 .V J Mssrgy:w.um,W4g::g:fgf5ggfggggmfggwnzi L QS V 4aggmgeVV,2QgL2xr2z::z1zzzgfiggifsggbmfvasiszgzsg ' VV V, ZE2055wfif5iZEQB.?Z222Zf'33:gg-Ffsiviiwiiwiiiwiig ' ' ' J- ' V V X szgiwfsasssgigifggwwwfiriiazfssafwzwzws 'L V -L -V L -, ' W V MVwwVVVVfmV::m:MWVVVWWQQQSQLS V V L AV .V VV V . ,.,.,, ..,.. izggmgslkzzyigiwfgigeggfagwSSQSXSB-atxzfwxsw 4' LV ik, V J' L We ' ' Vagzrgfwg g f 6 'LW -'--' 23zaEQ2222afas2Esgzsziziigsfawsgxgggfaazzii M-VV VVVVVV f V L L : iw HHVVEVVVQ Wgswgmmmg i L VQL V . V V1 2 211-:VVzfz VVV2m5: w ...V V V V L V V LW' V E 5EiiQ2 5 ?Lii? 22iEE5iEi V V V V V L V Jiziiiii-5535212 ' - VV V... VV LL V ' ,ESQ :WE dwg? Q V iii2rVV3sgs.V:,LaLV5:s,V:.L1,g,gVffL wfivwmagm awePKiwi?'Siem:a:iPEE1222xf:sLm:i:EE1E kiiiiwimzxim wLVwggg22f2V2:Lf:,W smxzaw V 1g522:a:fzVfmViEgE5SES32iifsmisgifiiiwgaai V 'L , we g'w2?VmiiM:s:2gEEQEiLlfV 2 33355 -fm : :zf1i2z:::e:::::::eg3V::zizwqzsizfmimafs L V V' keg: QQQQQYVZQQQ an H3 sg V Sm EHrax2si'Vzm,1-Mwfif -ff- -: Qs' gg,ggfg:Vag533a'::sz:25s: mgmfas:5x:::z,z:-fVgs F QV i, sz: gi z222ga:r5:ef5QEQ3vg2QEiSB125ssgLg 133,325 ight .... : V 2V::m::V:fg1fVzgazsamzzzrzszziki LLVILLLL L1 S12 mm Lw,VffF2fsi3Vf ,V -VL Q Him: 21:12 ' Lf . g X 2:22:22 g:miE,:,li 15igg,1'Vf: p V:-,r:?42d5WSggigi:isss::5Vl:z f EEZQizzgzzgfgggggiigwiitgzagwg ew 5315 M L V E521 fzzggw gfzm, Siawzigaggy 1 QV '5g m , V V is L LL L L LL 3.3 VVV V V V L VL Lf' VVV V V L- Vffzfiw QE: WWZZVVVVSLLLL VMVSSSVV V L V V 23 V L VV ,V 4 ' LV L m LL is V V 3gmV,MQSW-ggSg:VW5s2gza:1:56gwfggbwsmif V' WM ff Q55 Sgkgssfggiiii Sis ff w1ffff?V'vVVJ2N8is:f:,i:w L' L' LL 4 VV V' L 2 V L L 'L ' V L, he MV a::12s?fgwfVf'L Y V Vw VN 1 VL iiiiisgwiiswVSQYQZQEVVQQQEEQVLQQEZZL12122222221 N V V V V 2ggigE.:.5aVVi3:-:VLfpgigff1?Pf2VgfQ???2QEE:agsEE:EE L1?5E2MSiSV5252f'?2W V V, .- . is wiiiiafvagwiwvif12Zi'N2:is?5Zm,,E5:?F NWN V L 'L V L 2 'Lf' mi V V L L X L ,V 255352 2215 L4Eeixff11sW5 5555551325 51: L V V s2g3gEg2EQ?igg:E 2QEiiii2Qgi2 SEEEESEEE, L mp: L , L L f- V L ' L mm MV is Swimswsmm L wiv S V::gi5w:zaazQ:::::::f2g41VmzzwsmszzazsxV N VVVVV LV V Sw? ggiiiigsgwiwisxffi:-4:i:fV2QgEE5SwiisS,VEL L-2 'L V V ,ag 2 gg,zgggggmggsgulirszsszzgigliingiisisiisszz L MMV . , VV , asm: :siw2BSXWLL3gS2.:Szwizzaggffiw HGV Mrzsssgggiiiig 'w2zV:aw QWSMLM:g,yw2:w02:wg VV V V V LL sm L Qifwaiwiiiliiiigswzivxm'gwflisiaiszigm ' V 2zi:Vw2 wis2H:wzs2f V V H2325 111Fgw2LafWw:QvQL11iVagg2EfE?WE'EWiEfSmK VL f Vmm-gzgzixw We wigs V 4--w .saw mg WMS-faZ4sf.::ugV-VVV VV 'S V Ir! 1 Lfgziigggggggg gqfmsii'Z12Srf2:V31g L img:figggiisffwigzwgfaiQgiiisasizsiiiagggggigiigg ggewwwqfma QVwVa1Si32P::wf'L ww VV-w2:f'VMv,Vm V V Vw wggwizmzzmwegzs VV z::az:V:::,::fw N111 ::m:z,:gE:E was gfiwigiwssizrsiiifiiifi 1sVV:2:w:,fi 5'2 53 HZiZili2: A V Jai WL Wilxzgi Wwffif-'1'?if 2 1 5gz:WMiVVzaEEE:5VgE:mw iia:f'zE::Ez:VzwV L V 223 sawPiV2f?i:f??fS+Eswf:VSS2 Eiiiiiiizaiigvigv g.:222ggagx?g5mggwVXVsgigagigzggggggg3sgVwgWgEgVEMVA ' ' L ff L V VV 53g2gggfeggVgg:s.sgg,giV5VV21VV:s Q iggggggiigaes 12131 1V,i,fz?SQ,V2w5QWzww'l2f5pV 4:3 gmsx Silks fg V qzfiezzeziwm, V. L 2:i'rL': Bl V ,QM V:-, Q' VV :Z 2 lf W L22 Smwiiiiii V-V--VV.V 'gsiiigffffgizi LV saga - MZQTSVLQZLQQSZZSQ:NLHazzimiissiaiwsizglszisssisiiemiigizi1222125232 sgwggifxzsg Vw A M, V, mm gizifzszziigfef:.myfgzgffssmsiismfiim W 22252552 VVf2V1222 iWV 'LLQZSSI W mi? 6V,mVw,,V,, W U, ww,Ww.w. W , V -A , , V V PV mssgigwa V Vwmgw. VV uma. V Q awww. wg Mg fe. .,,V.. si V s 'vig 42 ew V.: .-V... E ,M www ,VS Q , P mvvdwwfvwawmm V ka V 1 1, VQ131:35235:zL1sz:zszzzszxssssgmzQ1e:zz:::,:gg22g32f?gsi::gzs:5gs,:Weiiagggggiiiikgigggggyggwiigyi Suggzwaiiiii iigggggagii 23553gig?ggxggigs::z32EESSi3Qggg1gSig255fSi2Qg:2E 'N ziizagwggfgzaszsa1mgwassagszgszszzgzszzzfgwig gm-Vg V,gwgV02gmwgWgg swggggwgn ggi, VV,,,f,,,VgV wg VV N1 H aw gag 4:u,0:::LVV,wV VVVWMQQW Qggggwwwe11Mawazlfwiwzlgfqvs2V:V:zfffsVW:i:zM,?531Egg?VVVM:a:EESEEWSSEQSEEE3:sSEEez2:,:::sr-fwgggvn snszssgfggf QQWVQQQHVREQVQQQ A 532233 lwggggm QWQVQVEZEZM V 'wa 2SsgVV,szam '-'5E.:EE, V , N mg :gm Eggs VQMSQSVEMEZQLV K-V25252222:ssmmszzfzszfigiV22S:zziwifmiESS22azzzzmfwiilii-?f2f2fiV2:::z: LM EVHEVVVVVVQVV:zzsgiZg232xsimmgfif2::VHmyzz22mfzzwiiizsmiiziiiiiiifiziszzaiif?22fVS221S22ifffi1i1a2s V V, .V WWW:me0215isiagggiggggiigggwgagsiiwiiiiizmmfg LL VV V XWabzszwgzzazzsxzzws VVV,,,V.V,.,. Wmmsaggg Mask - , S? Q3 YS? :WSFY 4224-www W K 3321sgggimgggsssggigzk-eggs- gg wg-5-eglwsggi-9211-22-figLsfew-WM Q ., HQ? fs- S-Q g55'sa2-H-ss SW' W he Sv, , -MM, -,A 5,-W b -an Amimwgs up ,Mfg vwss M34 MQJQM, ..,w,-,Nw 4 MA ,,, :ww ws amgvwmiwgniiqgwmem..-,mxegifz sexi-Eiggmfmm-few --wmszg---WW usiwva W was-w,1,w -P B wmYWwN2'P1,f -,Q AV map? .igxpgmfw si 2 mums ww- - Q61-QM, , xx-SQ an- sz-ge5r,M.,g wywigggmgkwfggggggwgg M1-mftggwfw-5,555-,xgzfk,vm-Ezfiygfw?-1.-,, sw: Ass 1 - ,sv H mi: wiaffgw ss ii: www-.S Q1 ,- wiv'-af? f-elim -fa-sf21?aQs f'W-Evwm H -ms - Q 1- -Qf3'.s-SM w k-as--gm me-Q-xrgwzsqwmgggwgq 5-Q migwgiiikgmwegg-Q53 ww . -if-1--.-A-wgfzf-2--X.-,E ,g mggggf f-Qgh 123 3--,xg -:sg-3,-5 H31 ,g fggmffq'-Q-,,X., .bgywggw m.MKm,,gw ,J -gwgg- fQfffQfEs,5Qgwx--Q 152139 W WN ,M .: -s- .:::-:a-,. Q'-X 'E ::- --1 --fires-. W '-izwfi' -'-' - wish--f mv nw 51 gss ggsiggggamiggg-5Q ' QsgQ:g g8g Qg3Ew qq wgqgggy gg ggw mw.,,s-vfwy m wgfksfe'-??:f2R-P Q Q-gm 135- -- :A--A., Q. Q- W K: -L:::5ga.. - S ww, .. -:.2i-I-:: -:'g- fl ,., W xm'Mq,-QxfegfwfmY21wlQ'g'EW'-, Wg?--EWQ3b?fg Qmipgwsiz-asm5:-.'-axial-Q12-few M :ggi azxg w aims?-is-aww-5233-2,53 5522-ss Q:l:Qfm:9fm1- -V--mam - krasggkgrsg-ugh?-szzgg-Q -1:5--s,q--1:-y-:Q-11-ww zz--nw my-Q-sz ggia, Wg YA -22 1' '- 1 -Mi-Z... ---22sa.g..:y- 1 :Q . , E .. lfwmgg SQW QQM- Q ---- ff- ...,.,, 9 .-w,iw,ggQf-q,,,,- - HH wi se-mg www, Eiga -gg-5? aggg A T .. New H H w,,,g,g'fSs:- -W--mf.-www M-M+SgY5,wQwNw-xx?-.f , - W wi Q 5W5,Q,15iMQ??ggg25:-fsisefw -NE . - if :Liv 'wikwsxggi-Qm s ji-m Sfsksgmagwfwvw 4. 5555 x 'Q Lf 5 - , 355535 ',S 11-iwf -'fwfs-.W-fmaxw .1 . wif iw Mfbmrf-w:2f5f'NSBF8?g'-HRW SQ M Swv Sfiswgyzwlvf-J-izwafm ff vim --its-divx-Q51--Qgfhz -M szgieisffiffw-,iissfh - 52,24 Q2 'SJ www-vF?:ww,-w-221. 2532-Hi 'A -frm-:ge2'g:wi'W?3e+?1f3:P1'z55zMr-11125 wsisziifgg-552126:qalizgf-Qf iviisgfifff Sf? S1215A324335-S-552iifliiiwsiiiswiizbf' A 'diflqngtxk -warg- '12, - f W-'?f'Q5Q2f':ffe' 552-SW N 3-55:53fi4firiifzh22:3Q52:-2232-S5,i'4f,gfg12?WQiSsgwiki L, in M W, - . . .-isbn-2,22 -S, - ,ffm --.MM - mm-mmvzw ,255 -Q-nam. --A W, ggggsgs--Qsxsgzgggsmgg-fgzmgswg-, -, gym-m e waz MMP-1 M-ii:-1' wig -gg H- ,,,g-abmg--X.gg4fg---w,gSa, M,:ggg5 Nszw M mg. -Sr-124:--fzzwiisfiifisfid-Q2:W'zS-+iisQ,gw22 ggggsszgg-Qmggggfgggzggg 35,1-ggwgigxgggg ggi -gg: Wgiiqeiiigggnxlz ,-,QQ --21-gp-sig M, in 1-EMM Milam SYZNU' YW fc. ,, 'Qwwel4i,x H99S5i5t 11W5?Z4 1lCf '- mivifisgsgsszig-J-21,-iwgemmii-aiiiiwzg-2 55:5 A ---. Q M Q . ' -2 -H5255 W - gg-S5 Q, -1 my SW Q V- ff biigf-55 31- 1 V -Kia, f-gags-is , g' mr-:gg-S5 5:45--2 ,wlrxzgi eww ,SME 5' fqi fz z mzf P5 . N F ,m.::-:-:-- : Qffffws-12l+S-A-LM W- ': E':2I5a- - A -'sqzwl--Ssiswgizw-isp:W-air'-Qizms-Y::,f-my B- ,vwwww ww-,e - -5- -1- . 5-wsssfg--x5,gww 2:5--1,-GMS-N-Igg--5,11--VL R'-jfggwf-fsffxgaa-,gmg , -- 5 5 ' we-:iggg'gg?'Q?,E5: E?vQ:zf2,gfgzgg-gf 583, .Qs gg :-3,55 ,., Q 5-aMg52ir:g fQ:g-fzifxzvf ww--'Bw-if-'Q-if,-'21 W -wg:-Q--Ssgiiwi YS :ke -Q.. 'iiwggggraswz-1 ' S 2' hw' 1- fgiissgwswsgw-5:1135-me LQ Q efgigfw- S. :W wwf, ---- ., 22fx:fgssfsmssfgfzfsg-wif:am-f-zssifff 525 5?f??2ff:Pf-Esggwg :gag i -z - f' 55351:-1 Q2?3??5f5'???fE?isi5f55Sf3fm2 y M 5 ?',5'f5f2f-was Q A 2 eg-2225553 -fsssafw 2--22::m:s:,q-Q-2-S-1:1--W: 5555? 4-1 ' Q - X 1 ,N N 5s:f2:?f12555255-fsfzsi-mica::E522:-2-fs: mf-Egfsvgiif QMS? Wmfwgvvigw-Zggvsiwwgf mggw fx L, Y- - - S wstwe--Simi-,552-fwfr?Ew?QE:gf'H-SSWZZZQHS S555 ysm flggxsfwg-ggggfgkgwi-.-Nm: Q-F25 -- ,.- Q71-mvsg--:gg--:ff:msn-Dgffgwisgqgggg -mesmszgggsaeigrsggg ik sssggieqgagfegiggam 5535? - . U N - ,, 4 - 25Pg,ZZig':PA'7f3:E5l'EQgg5-lE2?5?5iL3,53'S?iQf522'2,j -smzssim-izwffmgiiiwsgspmgksiggwSQ ay 2 . . X ' -M-W , ::2gS:g:4Q11mQ2rs:l--S'::222mf- - - wgsgli g-wife -ln :fa I Q N. X 1 - I R - 'f , wi, - 'A ' Q A ' - -N-szgw - 25522 -25:-:mf-:seg--sag-f-sg .ggffsggg-5553--2 ' flggffgggi-'3:gSfQ55gggS5:is.,,Mg'Aff 9511353355 Q zigibsgzligggizfjgi,W'eg-i2ZgfgT5'!iig?5fZgE-LZTQQA -:gf 5 ' Yaffxlisgiiw Svziiliisffizsliffflib Ziff- Qfg-5?+ 555555 . -A 25253sfiiifiwggszgsiifgzsiQQSEESSEF-E5122? --1 , - 1f'::Q?x-Xffisw zirmsii- -gf W -:ir - -' HfiiimghlifiiylfiW5i,f3X5:5575i3wS5N'-33552 :::f-:fw1?2-arf - -s?M?22-sS-1xzfs::gf-sr-3-55. ws- ' N... .-- -:Q-fs:ffszgssi-1.-f-ffiisfzziifsfr'-aw A We 553536 . K if gsq-fissw-lsaxiiisff Simigvligybliilfgiiilf ' ...M ' - ww f?fw:E?:-Eif32sg:,?r2m,gfX155-giigmy-,,EE51Q: - ' ., . ' ' 0 ,,. - - MS' ' - 15: ' .' N 1' - Zgf-ish--553255351 iggj-fJ5f5f2f..,ggwS,i:wi e 'Y' TY . ,.,. ,g,:gg-Qzgfwjisf,-352: xsggifssfifzgizszgigs - .WY A - L ' A -- 'N -.--2 1 -ca A - A Av, gs - -qw--. Q. W . f S my - . -.. A w . g-.sin ,ziigxzgw--.igvufzgg-sS?2'g-www? rd Q 3' 3 -'W iv v I 9- - --N Ziff f:?l?3ET' .- 5 ' X' A 1 - Q ' W -EEZ T i l ' A '25 YF?-5 -ww P 5. 'ww m x - 'E A x- , - - , -'P 3, 1 ' f , Q - f- L - -ef.-,-gzffx lm-isiz If - - ' H '- :ff W , 'fl 2 L- A Q -2 ' ' 5 if -YQ EH 51- iii! 9 1415221 - ,Ere-,S X, 'W' :Q f . - E' 1- if 2-2522 Hr- W .2 was lf- ' zu-25222:f fgggimmuf.. ,---. - '- 'J' W X X I f: 2555555354445 wx 2 A'S:if::,i1fz1 5, .3 Q WR ,Q f R Q r - - . .b fav! 'wyljji w Q . iff:-3 .Xa -. , f 5 M . f P if, 5- 'Q -f55Sgg55SQ'S2:f5gsQfS.- Q - -xi--2 ifiif U2'i'fi'2Se??4. ip Q'-' ?' -a - ' , , - ,4 --,g,MB, xx -f . ' 2 Q Ez-1: Uwpifywlj, '- Xgvdff fii,?w'3'2f5bQgg -WV LY? ZEN. f illffilijf- 3fg15',2gwfA? HME'3 55? w?5i?'wqfngf --2.gay---iz-ggggfgmgfg-3535 , M gs 532- J X M 3-5,55-gg-,.fg55,,Qg.gs,:55iEfg-fi:-:gi-Sjxfig-S K - -Ns,,ef:2z'- ---gffllgef-55:55 :mm .V E2-i KF-flifzffX 5iYr?F22:i-fliri 54355 S:.M1i2li5:-3?-f:f'A ml 5-Sw, , 6 U' ' grgiizg-isszffifgigabmgw , x Q -, :5-F ,D f -'-reffipfmwsifwv-is , ww-'-1,-25:33wi-izggiizf-5f3Gsf,f.,g--.. x 1:13 -giizgfgfgsh 4 A Wrszgf-f,gfff2:gf' - U-?b:Hf5i'ifw--2551351 'f2P::f':-L-, f:zEf?:5f'-Mzifwszw-1 W ' Wzzge Y Q fiiirsii-2igS22Q,,,-T2 'fi 5413-iii up MygZf35'f2E:g?ijQigif-2?f?'65sfL5S:2:4?s-1-,f, , :ffm-E2 Q, 'W' --'fyiifirtfh 'W - ' K ,M 'ii5i?SE'2-35?555351533551 55313 2.5551-' -, j4?ffsfi'i2f::D 52325 A 1-5-1 Q?55:,ffi:: ff 32937 migiifg-2-7 Qgirzgpgsisggi-bb :gg-is: gm. 1- Szeffl Q-giisggisfs M222 gzfiizzi . 23355 ggzggsgsvggfgggss Q ggggggggkzw 1:1-,gr :ag-,m H 3:52-ff :f2r:?Eq Q2 gifizgl si? wi A Mi? ffiiiwiliiim ,ff Tag? S333-wfzikw-7, iargia --fer:-iffgv 5 :gui iffgili zazmzfsf.-u,:,f'f::::gg 3-f::,ss:::,v 555525 fsfxirzi-fi12331553-wezgg-afgsgz-2wazif Q. 5532 me iflelyggigsgggf zlzwrw 342122 35255513122-3125555fwzsiifii? 1 qw ., 5,5225 1:?2E55?i5i:f-3535555gzffliisf-iii:-2223342-12:'fw?i,a -2 ,QVQZSEZSKQ -gr-ww vwiff- ' '--zz?-M51 Y- iwi'-igaffi ESFMQSM-Afvfgsfzsfw Q-f::Qgf1?f?5HS:sm-ismwsgg-isswwgzf-1g.:Qg::g,w:g-flagwzigfr-sffgwisgaxwaz Qs:--J:2553fmgzzzylimss-235,-igfx isa-g WMS --lsrszwfgwi-:wwwQW--112-1-sxfk-S224-2.9-'Iffiwfgizi -Q f sw :mfr A -Q -, t ,--:qw i.,p1f-QAM . ,rwgfw-52.-1w2Y'22-V255-riizig gzflf-sw 7gff'?3 IJ,-?.w,Z:gg::ifzSf, m2fw1',-43 vw W , :wi . Ssgvlzggf-fav 45:5 -,,.igwsQzf-vlfgz-f'i,iw?5 '---A Z Y - fi Asqwisfmzhf fix? 'ft-Mi: wif' 5 WP R? QD 'Q V 9 vm rgffiwfzwixgwll ,sf-25. w--, W, A -,,,MN,v-7, :k,,,f.,g-gm-,bivwwfQ4M,Q-qw,7? agp-1 wig-A, K 9-M M-,. gf? -pf--f 'f i-1, 45-by BQ .235-f,-5 -M Qu Vg -5-vfyW,,5gwgg-2,,,g -gbiiggm NWS? 5'-gf E H 3:4gm-,.Vfw,-ygJgLvsg?-M ,fJ5M-Zi' E-2312 m,i,,,y1mf -2-fx -2-,ww Nagy im -f.,g,5:w-if-1?'W3fi5A: M-2Lf.'gy'h-M, 5,Sy213hs:gm-,B :W-QW-LJsu.,5f,JfS7Qw-3923-,SIUE'?,fff5Efws'i'5EP15 'ff.vmm...5ywg,,-. ',r--Sip,-7'T:x.Wmed5gg4:M53w ,iiefdqp sw-1?A5g43i9gs1572gAvix?-Q:,ww2'i--fgrwiiiigb-Km-'iiiwawiiw MS Mfr-vip? img W 'f.5'ZffMiJ wf-,N-SWT 'iiigf-we-wB'w-ig- flfkw n x:vvf4-15-'12-:wfw -wiQ2w-32,52-2:-Qfi-w-sx:42v:ggg2wA- ima-fifsfzfc-4632-sffaiszgffi' Ssxfiifaf S12-mf-Sri-f-1, Q12 idx'-sbleizfr wwxwf-2wg-:,g,fffwt nf,-,fga-cz?-2,'?-'?wfr 11s?42-if-:f?sf-Wg ef-Mas, -,4,2s?:r-f-:MM3?:w W -5,225-ff '32,,w::g'iW mg '- Wien gg-,zfwgfig Q,-Q,-MQ, -f3:g,m,5-ff1i2f,,,gE5wVJ , M 25,-f4,ffv , ff:-mls- W,-ziggy-sf-gig :f'WM521li:f,g,wi,w- W1-:M ,W ff' 532ff3z,zawz35vZi2w,i-Tim? ,QD ,Q 4 H U Mm fQ::i2f:gg--mfr?zfiffiwmgiiirmiizfiizgf?-fl-Fsigiw 5:52:16 -wwwjggkzgg-ii:,, ,K kffywfz g:fXa?y2':E.zSftzfjig,-2255-.fi?x:,,-35315yffzAi:z:z2fffz1gg5G5f-- 1, 1 1- .Q fi-Nigga wwe? I :X ici? f ,viz Q L15 -1 A - v . f lggffw-W, 1 , 7 lk gsii Sgkggim V Wwffzfflig' W 1-ff..-ng ,gg V ,M , sf. idix igffff ki za .ff - ki M R Zfiz K VX S iq K fx dx as If NNW. W .wmfsmaf ,, 5 . S- , Q Y N , 5 x f 5-fy-A .Q-' 4,3 Ly, ' -W , 7 K W'-v ,, 'Q . . VS ERN! WQWE fr J 1.5 sh , .,.. 3 is-HS W A S5 -:.lL m -L-,. . QMS Mp, W mf- ,1 if SA 1. J. ,W ,.N,,e x N-,S . x 9 T kk X 3 :Q 7 K ' H, F3 an V, Q 2,6 fx sf M4 S3 fs, 5 X sn.. X Xin , 1 ' QM -Nw? Q is Q 5 xl 'V Q 'Q' - .Q- .N ' .QW : N , . ESS Z 3 , Q . f -: - egg if , In NS X i . :K V. if N ' QR? Q ,WM ww Y N gs! Q FF i W J v X' ' -' N X15 , Q i fx ff I s - in 1 l -2 1 ' .ks -ga K X K f . S' 5 .ww Z f, , .sm - , R - 5 , ,2 74 K kv f, ' AT .. X. S. Q 5 fn v 'x g.. if , , W 3 334 s gf . 2:,::1:f.: ,NM Ss ex rw. Q QM -U, Nw X Q M ls ,W ' ,M-,ai W iifalgmmw W -mm'z m -'k ME M-1 r M 5,55 is il N1 Q f v Q ....., .f h 2 W K K Q' w N X .. X K f . w . rr ., .... xy vu... , .wg I S .. kyxf N -. f 4..q.- wu- ,Q - D M.. X x X X . if Q . . i 5 zv- :,:.q . .. . A . 7. if X ,L MQW - - .. ....,,N-uxwx-aawxwwwm N 1: ...MW 'H ,- Xi L: ' f m 'Mx Qi + X 43 . e 4 .Q N1 .iii ' X A L, L2.i L:Ai E5, K - 1-'1 - ? -. if 3' Q. p wh . M.. QA X L K ck 5 Qs. Q.. X X w ' . ,, X g mfg? 'Q K V . Q - . X ,,,,. W , 3 sissm 'E naw: VF-Q SK X N N N X J 1 Q I t gd E M...-x 'uf-x x, f XX , QN w vw - 'LTV -k,.- 5 M- , , . .Q-y.. V --Q -uv- I f. Q- u--W 3- 1' .,- A -.,f,w....:.,,,f ff -,H ay 33fE55SEiA2 wswsm w 4 ww- mmm W W N .W . aww. , N-,gwfvii g, Gf vY5'EEvSEL5QB?4'4,1f,31fPw4n Qmwxxm , ibwgwgwfw.isffw,1-swsawwmww,Q my M Y - , W W - .... M S 3 . E 'Hifi Q hy , wig 4 W N' 44 543 ii V W wwxsmiswwwsgx 44 -M-www? W ww--Q ,, ,. 0 . , ,ies Q 2 , ,A gi g f5f42?5Smf'm Q i5iS' Vim' L52 56553 K mmf V353 'E 5gS53 w'5 a R i Wfggmin 23352555 ?? 5ggQQiiEsEi3 35?2?i3?3f?3555i?5i:f5552222121944WwSS? f142f4Hi2'U'11'Hf'1?W X 4-44f4Ym5WW ., ,.,., ,: -11, New ':'-::.-gg:gs' S X4 ygmww -wgwqfi gr:.:s- -Q QR 3 Q -':a:f:fgg:.s xfxg., A N45 41, ' same S? Q J ' SW MQm44MWi4g4g,: ,:f4ggfSff3z:mis,:4S-5235111fff22?f54,T1?4SSfifiziiimisrivzss4 x.. m'fk5'3E3?'3g?N5E25 4 -wSSiP'1H:3sswxs,544vi5faw ,,4x Q 4444 41 3444 My H Wgfig-M40 w iwmqflwiu Q5 ez Wnfl -034224.44444 me 124 wwwwfw: - W4 ww NM Q, ,Q Mzg-:sim Wsyrsrfw-,sim Nm 4 Www 4 .mimi www :. S :L , -6 4 W 2 W 4 1 3.4 , XJgi?3:ggg,ws5sg ,-1-2-:i Www x YTRQQHRWQSYQ if W Hawes:MWQQQLQZysiwigwmifkiiymfg,meinLimmiafzsf as :AZTM f'f::Ls::f::f:4:mm?? T 444wwSS?2ifU:m kymmgwggg g ,-.::,:,,,: Jmgimqwxwgvawxx43,5434wwwm,,mg,,s2q4ww,,gfigggamwwX,,MQWgl,,wm:m,Mm W,,, . -Vgeg4f,g4gmw4 ----- Q as , V ik- ,gm W Bmiifigsziimfm s:s -::.Qga: f :::,. zgz zg wgqgggwig gy' miggssxggmgggzfssf24522234491sw:sfsmfiffffssslsssgsgmfigsfmggw,mf5m,,h,:4,4,,wM::::af, Qwsuzsssew .5:2:5': e,. :?::5:fEf:-:.1g, ' 55:,:-fQ:'5:-:-.:j:jg:g?':E' ' m 4524 Y - 532 y Saw N29 3,5 A .:: 9' Q gmfm , Wm M',lQ'35f'sh'?i1gQZ?W55fwwgiiiifii131wqaiiimagilzi2i2i'1w3'f::23221Z'12233555553fk5i5M533?5554954v3f5i3i5f32Q5'iJ5f?i ? Q T 75? wg:-5 X 5gI Ig?fI'Ig2E5h5I' M ?q.:':5:.5'a,I-2,2-', E-1. ,g-5,5-52525 if A 151.1 5:3.'ZZ 3 ' Q 4 ---- . 41 'Q U ff' I , ..,..,., ':.:I'gI . P1 w ,Q L 1' fwfz-Q' 'H 1' QW I ' 'MY'fifiiigivgmm-'4ww-'S-'W' WPVW-'f Vwfw ' w1'AX.iSLf,2TE9 3522-' M,g5w.,w.-My-ww. 4 :::2:-':::i::?s-' -:--E 593 Q P '2Z2:2:2..2'.::'. F-:g-:--- ' 3 5 Z iii Q .-:25: W. , Q 4 , ,S 1 2, ii 4 15 Q M 'L T359 Mm 'W'-f444P4 f'fAWffWHf Y, :J 4 ' ,zzvizkly-if-if' '5?3WZ'2Z'Zi'fHl is E in ks? Q, w as Us QW f 42 is W '-'Sw 3 ig Mjfwiw xm tfgwgwzgwgisfigggg, 2555251422:ssiswisfiffzsiixizxisseii:xiii ,gggfggar 1' 9 3' .. :: ::'5f2Q'2E4E2'.5..5: fwwf vl z 5 ' ' -I 'Y'Kw-4523Q'1TNTfP?'?'5YS3mm,w ki 35:3 'xi ' k+.f?52EEZxg'i?,.R3kl'k2w5 43155553H5?35535?Q435H555i5Z3S?3i'z'riffs 52355f35:fi??f'25gH5554J5355f3?535i4'i??W3 :E iw wQm W::s5sH4:s4Q?ff4E f? Mz: gg:- 4 ,, ,.,... z 5 ff , :I ,.., : Rif f a gig:-a: aaE ,fgr '.sE 45,9423 2955 .5 2222f:s .rs'3s' Q:?s'sf'42 1: 5--'-f s? E:f:frfr,r' r22::..z. Seqszgffiiwggpggzsgzassgifzaiywiwiisiiirssilvasiifizizgiiiwgif '. igjg 1: 4 M :. , ::.:g:5::: -51551 iw i : r ::r. :5- -:g:3:f.g. Mf g - Qgqgwgwii faghgwzwm 55Wif2S32:zWf5'S2SSSZSZQWSZSMZ F55Wfif'm:z:rzzsszlfwizfmgzx an 4 L ......,......, : .-.--. x -.-- Q. - ...-. fd - ---- 44 W, f? , 4, ..... : .4 .... wx MEESWS ,4 ----- F - 35 'E van Mb f,,.Q eiS55kf54'5Q2?5z-23 Wie-154 WHZW4wmM'3wv24: Sfwtqsr w:V?Sf'h5,w14S4eS4,,b 1': -me-::Eg 5:,::: :s:.,' 4251 22-.'E2':s.'2:4sE::::i:1- , ---- - Q .-f.. ::-E,2Ef ' .5:K1-5'--'- Q aw- ,MH fx H345 mwiiiiili-Sigiwmwfgiiisazi'M244'4EEi5vMPH1-9522642154211 Mt:ilir?s22:2ii::tfaQffA5Z 3, wp :: : 4 ,::Q::g::::: : ::., wg :::-3,13 4e5g4gggwwg . gw4 , g, if QW ,Maggy ww ,.,f,M.Q,m:.,.:f4m H ., ...... .:.E,m. ,., .::,1:,:1:. :-2-5 sw Ex .... mi x .... , W J B ,awpgsawm wh w:4m.fS.,M.NLMm.,WP:sQ.m,.,,.b,,,fW., L, mm if .xg - :Qi-5, 525 ::: ::: .atm - ig- g 5 24 355 52423 Ygwigiassgizmzsszagmfz:ss2zazmsgfffyzgsszzsmzagm1zf:z::.:4gm. '- Q:f:r,::::::.1mg::, 59 42 1 ' 1 A H 4 44 M ESQ SSEE? ,:,.g A B4 '5 .f?..,M 339 4 ww :.-. :,.::,:,:,,: :: ,,.g...:: ...,. W ..... wg! .... Q g::g,a: :g ggmi A sy Sm WSZQ? ,wg 'lizsqmgg gi-g5?g5x4faw wmgw.?55E3gg39w.5'?3b2'fg5gg Y 5 5 - v 7 :E-E555 55-:Q EE.: mg .::-:E -:: -: - :, Q W,,,,?g-3:5 gagggggggagwggigggggggfggyizviggggifsiggg g1Q.4gi3,:m31:::::- .g3i2f:1z:::gygf',w.i 5155.5 ATQEQQQJZLQ- 'figggggfg migii v fiw 42sQs:s2s:2e2:2:2e:a-fi 5? 1' fV3' 3' 5E f E wiifissafxfaexHrfrsrzfiigiisssei5s:::ZPSsff2:iii123222212f2ig2iiiff1f444Qis2 4 w::1:2f gig? as .2 Eg? 5 -Km :z9 - :.:g:g-.g::g :- 5:- 'E K W .- - s :,:-. .. ... -E- 3545 sm 2,55 QQQ'fi:M-'45+g.:g4hiwiggggggwgmMSMwgmsjgsifZwymiiigsiiifwrsw55255555-if -wwgsfwwf ggislwwffwwg N :-Ewa.. ,41-..- .,., ,gn 3,5 ,: ,., .: ::: ,.,.,.,. ...... 4 :,. 55, 31 ,.,. .. ., : .g.,.: ggp ggggwggblageg Swkahwsqvngwmx ,m,m1WQ4.m ,mam mwwwggw wggwgiwwgw 4 , ,J .. -L If as -.fr fzfgx. --'-' Q :.5:: E: - :::::-s:--m f:-:..: 3 ' w w w fasssww,aifzfffs-Mf4fPf?b:4-:W444fi4-2w14ff:??1?2fZSf-l24f4ff'f4i'2'222f1w:li2222:4'sf121wff zfzfszs , - .-.- .... .,.. PW .,.,.. , :mais , -V ::: L gk fx: -gl 52 : : 4 33:-,:,5:gg5:5:,-:5:: -: 324 .: g::v: -' r: ::'-:E2:sg:2.- g: :g'z:5S:5::2:2:5 5:-:.,' :i5E:5:,::s:g::5-I-'-,:fE5:g. g'Eg::5:2'- :g.g-::3: :::g .i ,. 3:'E':g-gg g 5453 A 44 S Sim vwwfgibgzggigah?,sPQN1iwM5252552iifmiiiiiilkilsiiiif Q:Si5i5i555'S5E2Sf'f552QSSf1W2X2w2HS4lffMg? , , ,.,., , . .21 .-.-,-- .-.- ,Q .I ,. . . S : ....... r .... : ., .......... w ...,.,.,.,.,. ,.,,,. ,.,. . ,.,, , ,4g,,,,,gg 9w5f4 gg Bisgkwwf X sm, 5358wwfgmimmgwwww W. Wm, 1,-.awww.wwwdilmuwwwmw aww 1 ------- 9 I ------ Q5 iw HQU SSM JSMQW ESSWSMNSQ 44235544XAYYSSSZES?25ES2 SF2f?3wa4:F?'f?Pf fWe'WP'ffgfW i22W202WW2i2QZ fk5GS f'22:S1 rw- .5 .. - '-'- 4 w ww 1-fu Egww ,wwf W MwxwfwwwffrWwvvww-www9?w?0s4: 'fs24zTifSr ilifmflf 'lriiswziiifiizmixiiff-'igiimai -'-- . -'-- 3212412 5? 4 E 1 s:s-:ew gsig 15 .5212 2-:: ::: .:.g: :::.::-: :Q-.:: : :: a,g.gg 1:: af 1:sf- : ' :f--f:':s :1:-::f r:4 ggigggwgiimi Swimsggifiifxiis:Q6Pm4 S?E?E+::wP3Q2iEsgsV4E'l?i2fg4fav:4,si:g:.4g4w: :Sw4ffff44f24L-fiwlglsfzzf faszzgsrg4f m:4.g:15,q sfzzmggfgfgrgg as Z 3244 X? 2: -'----- K gg ws f EE 2 ii '44 4W'gS'Sis41f ' SQHYIWi:Efi2212ff'iEg:EfwW W' 'iffy 'ifffifrfiiw Em 5 ww w ,.,. gggaisgwwxmgvxxwq fwmi , , -.-- U, M Q ' . :I- '2'::E-:E .. . :: -253 55-:EEEE ZI.,EEE1 2,55 ,. Ti :sa Nm We 4 F2 H vm fmmxisdiek 55:5 inf:-452: 4 ---- ,,,, ....: -.-.' . ., - -g1 :.:::,:.,: 1,gg...-w,,,:,,5g,:5-: E ,,.,R :-,:-:-,--- :-:--5-:-:--f:. -5,51-f ..: . :- -----... .... : .... gg,, .m-.lzzzvMmm,ffzfzzssrfiwbzmzzih 5115.1 mggfiliiiii tg :::: E::5:.fE i Lf2f24ff ' --i44f1fff4 wif- Y mi gmifm 'Elf-5',25:2E fs 2a,52f524:f-5-'5- 52 'W 2s:aa :s ':s:'-1: EW? '-ffm fwEfnf w4Ems:m ,4223:wassffewiififf5214425522212f24ff22f2i2wfsf , gf gggi flggskw igggi iSe 5 ?Esi5 hgw4g?g ,W ,. 4 b f W -: ,..,. : ,, M 44 2 Q .... Q., ' -'5.'222::' W 2:.::'.5.-: :':':j.gg:,:-: -s':5:2:2-.5:'-I 5, as G .sr ml J W ,S :',.: :'. ,.,. ,, W,,M.w,, ,ww we Sa is :f,,zH95?751g55R?5W? 5'9w5if3w5'iwiZESS' n SA-?3'V3'Q?v'1Z1fW3,'S55315': H?i?'333S33f53'3 Q' , , 4 wig? gvmmp km ag:3A Q.w,fgH2gwag,2,.Q':axM gisggmmzmmzgm :aM,mg:gg1gm Qszfgw wg wzazgff-Mfg5gqgm,ms1'2'fm Lawless: ' 4:fEfsm M2'siE1122WHa43if2'4if3'?f2 44 Uzswffxiifwifi-d3s'5Wl W2 ,,,:f2'f:m:s vwiniiiiiiikiiif xmzrzzsfasfawzzwfafszazzaafv4::4::::::f414 444f-W W 553355 Niifrii .,x,MgN .f .-.-. leggmgseza zsfgfsa wxsm wizmfswmggza, 4.sa4sza:rfas:W4::i4m2 akwzwsssmsswiwzzzww f4wW4444 NWXQSW 4 -,xxx M SWSQAQ Q iagigimgiiggg ggziggsgdggazgxis.:g::gim:a:xgm:mEi4:4gf5.g2dawg ri2,S45Qgi23: iSaiEz:.fs::lgl-?? 'EX w ig, gS??iS:3g 4 gag,s g ff4s5SE52s'iQg2wk, 55'324S14,,,gQ455gES5X4 :w 5 Qgiikwggsgsggar QE-ggi:kgsmsigwzzgsfgsgzmeiisgggsxafggsesgazfgsfxgzsimgsgaizzwzaswmsimgzzfsezszgssf:::.ss:weL:52:s::gx,,,sf'-. V. 1:4244 25?3'Q?W 243 wp WBT? ff-ff1r ': g41Sa5wwQs5f,: -I-212 :-:s f- - 2 EEQESQQQEQEQSQW W244:'55R7w' QGZZSEBYQSQQEWSS fwiifffiiflfi L 4 Q msmfsggsiigg wgggggiggggggggiggggggggggiggigiggiglkpgiggziisfgggjjggggfgigzgsgggijqggiifmigfssggggggggmigaggggsigjgigggiiggkgigimwggaiggiXQQSEQQQQQQQQEQQQQE 2f:s53SSZg i1ii55'i: q .z1 ?S::::sf2:gg': :g a 'wg w M 355. 5345 - W 4 Q x KQZZZZEZQZZUgiiiliililifffi 4mgff5,:a1fg-. .mem M, W M 5 4 saqwzm m'owuX.1-xwgiya Q-335.553 vig M :Z25Y53g35L:QW:cZ:1gygiqfggaqwiiifrgfzyiggyw wniia Li? 4 M.,:fg55q..iS:tgw7iEt3M lvxvifiivasa Mg!3w1Z 2,i3fg3F5'T,5.li.ii.51f,:'3gg,g .x,iE'2'x':3?31f3ZL.3?,QfiZg'Z: 3I,fiZ3iii 4- ,c4. igifziik H257 4 f:.gQE:I SEZ 'fgggggrglggwaz :Quq:zgf5f2m5gw,,,.,g::lfg2m E345 Zffigwgz m445gsfiw1 4' X4 . 3 4, W ' 4 4 5 W xg3gg5ip :g3Exii34Rkag-gfgifgg2SiEzm?sgggf5gi3qwnwxiggggQNXAWRQQUXMimmaqzdrmggqsmbssigWgwsfgssifzsgzz,Sij:x:E:::iap:2:g::gl5:gxi?is!zrrzmmg,-.figxfzm-M-ff:-f 41 1 1 wa :.::s: M -Q .4 M Q, M 'f 2, 492-4v.Sw :sw-:' Maf444f:s:aa ww 2261444,ggszsfzzgqzssewwmwas 4 az.: QYRYWSEXQSQzgsmgaiigggsgiikiggagsfzi gsSi5:Q4E444Q44m:::sSr25Qf 555 552 244 N3 11222 lffsff Q bf sim 1 was155bV5QEaxf5:fgZm wggwgg5g3 xamwwgxgpgggh ,wp,mggbwfQwwmi?0WMwm.wFwgwi-msfggw Wk 1w54w,Mww Sgigtw' 4 Q Sy., ntxswwmwsiigsgw QwXS22S534::swfESK 6:24:53ifikqbiztzstisifiiyfzzsvz Y Simissza 'miafggsn X. ,'1f:w44 W E gy .M WMM Wmg.Wwwm.,.,W1.v.Mmm SML 6. .hm , .gas A. x 4 , X Q ,, , .ax A . W ., 3353M3fy-Lv-442Smmygwuwwgwezmzzgwgsgg-4fswggmmximmymg,mwgwzgi,,w2wQg:Wei.QW wgsmWmazessgassiihfwamsggssmssggsseszmfgsgsssrgsssmgzzimQ25saiisisfffws::::sszg4w:::r::s:4v44 4 L- My ,,,1,,,,,g1,, mah., QM, bm: mf,.N,,,,,,,UX.w.,,,,M W-4pgNw,mQ:yw. Q: gq3gg3.W5pJ.,kzgygbmw Ab,g23.N,g.L,4qMf. h,qwm,w,wf. ffm,.9wQM?QQ5wM1wwbQ.:mmmmqbm,.w14-wwswqi, ,4wk..w,,.. 1v J-,ws , .A,wwM-- fW'sH'fW 444 -' 'ixyfwffff' k4:EE 1k4x5:4444e4445fD?s.:'i4-444442355S? ?WFS'Wf'Fii-f'fUxiwimfisii'fimqfziarsiiwi 'sw h'4f3?fWfM1iiJf15f-1 44 4 24322421 Wig 22519344 4:4sais4iizvzwmvzg-412554554153gf gpm :giftQQMswfafgzz2:1mffsfsfmsss2:232fi-f25:s,1:s22sQ:w22.2::::i'f5:552240222225552512522225511ws252:zmzfsazrriirsrszsmssszzizzfiiszefssvilfzuifissszwzwiv QP . ,w if :gem .ma2:.::.,'zz.,,:,gwsgmssmaf, ,biisafmig::.h:MQ,:1g5:.sxitimmrw444z::r1s:Mefgfz? szgmd4f4fws:fi4mWM444-fivwiimygif4524-Ximww.M.Fx..Wf:MM-44M-44wfSm1g. sw4gm,s,::,1,J.mZ.4zf:,Qf:: V 33255139 ,fzrfzfzmggf i,f4:1:::,:2:'ff11- mafzzeszzgfssf Xsszrzzg is: ?5? il? 35333423 Pi iii imiilf ff 5515 221 4mzgzmzg-fgxfgvmigzzzggikvm:::,z4m:4,iffgzmtasiffQzmiari-E11E??i:W.:EE4'Mf2i41A-lizz515245251f2i4fQEf,S'i?l1V- 'ff W gsffsiiuwxlxavizsifmsiagizgiizsm244,5Q:2.'1s,:msw2::iis:5a2:zs:14:1g::z:12azg:m,,Lgsz1:::,::r:::z::hi,zmif::i:z,gk11:23::::is1sQ2z'Hzmawf-w,J4bgfzzir-1-xii-4-14--Ai:ifwSf'fT4f2'4:f1'4f4?fl'1f1i+-2 '3ffvfff,7f iff' f STL W A if 224 vm xiixffggwzlgggggy4:m:ggsg.ggiQg:,,4 bggwgmyvgggqgmgfgm-wggwggwwmfffw-44w345-WMW1Mgwmwmrwyqsw -1.mf.:gM'5W1Ws.,q,SEf?2sgv:Qn w34QHfs.sE6wZIxQ'sgawrffskmiziszlrf1sH:?Sfagz1.1- vsqimwszi wsu, .. Wing fum -4 Swwfiiiiigsvxsiiwwfifxifawdlibz fg'62g5?QWS?4wggQf4E532:wS5g 5gg?g525'332'22P?Z?gEfMLS4'fSSgifimmviy2'S'5f25?2wf4ze::Q2:2325521-'fefWiEt22f:::1'f2gm:,si:missin:Sw:S:Q:fsm:::44f::zz::2Es:Mf,, 321: ma: , 4454414 1 ffflv Q f xi,ggfgygWgggg5yf f,zgzzwmrgmsfgzsmgggggrggrazggggmfyk5,z.ggggwmiwigggggigmkmy,gg:1g,gg31f5fmgfgggigzzwgzfgyeszgzggsIqlfzwzb,fgqzkgzzizszzszzv4,1r:gf1:m::::i':f'v?32-iz.z,:Q:4:f.ffi' fmzszzs 'iziwsazg Nizzgiigzi 4 mgisgimwigimzlfzmgzgmgm:5,Q:mx,iig15555::.:w5gml5,T?,fL:3:3ml,115 ggvgxgvvwgtglggggzigwl my 45,35.w,..,,:sg,32,5M.1':2-f:,1:s:4:L:35f:2,',q,g:r5.fLms4gggn:7?i3,:2f:g4,, .sf1:,1:gg:gQ:i: 4 : .S?-Zf35.E2 l'l71Zi1 zfxggffyni ,zgggp h'Z51:,,, f' 4-454 5, ,,fHgwP::msQ::fg,:gggiigzxzzxifaayv. msfrwgg-3qw:,:4f4gxwgggggwig-gggmwfgg5E,Eg2:55xi22,,2.3535 3533253545515:3s':.zf4gyA115-322222153-'ref Fs.lzam.::gmNtg:2:i::i :xr'frp:z::,:1gewufgzfsizi-szzzmiicgzzvmpgfm Wa: , fwwff- WW ff A M .. Aww 3594 svzfgifxw 1-?121fM2?Ef.sf 222455355 iiiiiifif25329-il2f4U1?14 , W A E 4 4 V fzfliw , K 5 WWW Q 4 z is J N f sfssz lzzffgfsiiiizssi ii: S3 53 fmE25il'I?m:f.f f lfwlfi 'M 303959155 7 - U4 if I 3324:wsieiwziiz143:issf:xS?wzE?i:4eg:qggg?5:g fwsfmzxzss 552525:zzzqsmszszzfm-:4f::g:s: i5wz:3E25E2E 1 553551125 24 Q fi 'Hifi Q- 44 5 s? swgggkggggw W4mis-reggae:xggkzsemszgzgsazlssgvg :asain wmswsfgzsirasmz-rlszwgzazzsssshxxwgfzzi-sfwww fnzssfiswilzfi'4z4:e:g552ff4fS4f4f44 slifiifiiwlflf -V A 44 4-44 k 4 22 f Q A Q4 5 f jziiigigifgj W H M 4 Y 4' 2 . 4 3, 5,:Rf5:Mx25ZiEf2s4ff'zai?55s2 ,, F 2 gbwgwwmw,gyw,3mV,,, Qt- rim?Wxwgmgwwisygyggmgn w,,pmQ,.g?,.?,WMsmzzgfmssnxmfisgimg xiasmzz sglqsfszzfs zg fzgfswaaissgsz Lggfsgfgszssfzrasfssczzzsmmi412222223252as2s:issi4::m:m:s:::::ff2M L ffffs?v2:444 4 f Q, Wiz. , ,Y ,www ,, wgmgw, AME ff, ,,,gW,,:,, m,,,,,,5,,s.,UW4U.W,JA.MHfznqwggmfvgsx Mwgmm-4Ubww.MM,,m.,,mN.mW,,,.,,,mmwgmwmwpWWZWM awk MMI:rwufranwwM43-wwsmmwfgww-fw.wW4444lW.u,M W WSW-. f UW 4 4 ,f 'fi , ,, fszmzzw gm w5,ffsgQfQmg:y3gpq,g,QH5ggfgg,f,ggf,WQZS fiwgwwexfligkwwpws .6.,N4zme,.M,,,,,,QM,,f,,,c,,mm,i3g gtwiwgggqzggiygmawnfggamwwmmgqiagwggqmgwwwgpqg:ggvMn..x.M1,13wwwgl4m7y.ff?w4 e.-,N-Q45 Www.-w.,.,Wq?g1M.xm.44.,,,w.w4mNw ymzww. if Wmii, M WA .,:3:i ., aiiyimfq mm .,,,,, Q, R ,m,,.,,w , W .,, gQ,a,. , , V ,, , 5,., , . , . , W ,q.. , , N. W. W 545255444 . 255, wma vw wiv? gn Mw4?fgwg4gggg,g qwgwmvg f' EmmmgsfifwnYfwfwgzxzg,Qzz,fz.i5Q,m:z,.YQ:,,2S M2.?:'z?5:,mL mA22'Z:'.2'zs,:?Z':iziUiliipwifzzgzmziizrfzmiizzly,T:ai,a'B:Zi',::.x siiizzzsf ,.,a.2i?F1::: V Wim, ,, V 4 W N H b. 2RW. 51.1 1421 ,SM x ggQ55kgiHP SEVJSXHQEZ-2,M:YzMmaf4:f' 321954 f-Qiwsimsfswzsmisfzg we 'w4f4Hii:Mwz:g:f42:ssf'Wasfmfsfflfysfx-2552411142:sz:s:mi?2f'2:::zV4::'5?sszsffwfzfgfifzigfzwfi-35151524 Q 42Yf41lfff44li1: , ,2l?P1ff?:: WS14z:f5Qa wwf2s:as?3s: -?Efsxa2iEaaw:,444QQ5S?4fsS4Mwfi?s2i24Si24W14mw4g54 4: E S,Mi..m:y4zm ?2,.2sw2?42s244g X N 4 4 f 4 s :4:ssMgsgMfz:s:aziS:Szi5 :Simfizsssazmiwiigsogiigiiiiigfgiwimgigf22?E?2M2S2 hSeS25S:2ssWf?'553f53525?5g4W45??s3,'lqviggxfi ' gfiifiwiiggsgfsgzggwgggsw 5:54 :ser:eggsgfgwrzvszwsegg?-szzfzzaezzrzzsazmazfszzzgfiwawifgigs SiS4w2Sw:Q2?Sg54:55g:si5:4Qssagzagxgibgiiggwgw ,5g2?gii?5m'fSX ikgge wzaisgiiiwiwsgliwi Wwgzb 5.552152523253332figigiggfggiiflmgqsszs:::.a22W:f'sss:Srlsisrzswissfe:gz:w444Mf gfz8g21gg5g5 ggrg!22m.1,f'f,aaf,-Qiszxggggwggggzzrmxggasfxwgiis Y.35g.g,Q5-fggggggxgzgdfgzgfmfgqgswgggmzZguwgblggigwgggmigggm 234:53 Iszmkgigvggggzggix::.i,af5g1Q5g5iz:sf1gfg,gj:322332533iggifimzgiSfT4f??4Z:'::z4:'fzgiSi2 mrftlysklzlfiteif 26255144 giigf wiiaw Wgfqrffigil 'QiZim?41433?5fig.?a:?.7is,fesigiQ5s?mmsi:ESE2g2gEwm 2sg?Qfr22'23ga:i551ss znsiiiisf gggg zzzg -A :iz grfgfiii A f c 'f zzazzzszqzlkg 3 ag fmgg 1:--g:5g.gf 4f5Qi5252pgsEg2gggRg2 2155 ffegsxggigglwggfss.gsfsaiaazzziiwszsmhggfl 4,E??i a :-sifczzmsfmi? swag-fzisw szsirwfsmzzzqszffwgfizsss :::-1 b ekGbwaA 34 4242425431444 M 4544? wsiwzwkiwxwxiiv Aswsmmiem 1:35453 2 Es3 ' 54si Q's4:s2?S'f4SQf:Y 33242 'Wig 'ZQ',?'F5'5mEZ 3 ,,fx:ewm4W?f,mm4-444 wiwwwzzszar.fafaazqsggzzfifweg 41. fififfiiiliiww S e.4anfz,Qg:5mNSigQSerZig4i gS?sse:f:es,fS5s:44:iSws53595 944425445533 am A5 wg Wim w,2fsf:fm25'K,g2Wggg mwggigwggifagf Q W '4f4:f w2:::fg w:,,gg,,gwweB'Wf,gwg2 wksik XMSQMSW ammma:WWgmz:,Pzg?g:s,w 4-4i 5ig?1.,Q 2g3xwSgw.wk WM w22'v?QQms2g's2i','Q-fiiffiwgeiafsgffg 5 fgk wQ2,Q:5QQww f2, is fiwmwf,MSE232zf:WS4f4H2f:fHM2eaafmmiih ymsmfm wwf+444si:zz:20:ws3:2I.4 mywg,,a5i.f,1,,b?g4x.imwsQv::gm,Mw,,a:QSm4Mmg5Z,, x,gm,,WmgQQ,, vgW,Hs,ggm,gBiiMQV,a,Q,,Q,ham gm mgggqvmgmgw, W .mawpggwxwml 5 :-Z-: www WEWQSMQQmvmq,xs,WwNmggHgm?,,iggQg4?4fwgf4gg.gQ5Q:msg fiiimssi SSERM mzgmsg:::.,:Wk,m.s,m E S ? J gf' , E Q , Q ,.Eg.,: :i,1: ,gm jimsgigf mQV,,g,sggg,,4aQ wwgg I Q wggaww, QQ ., gm wig., WgwwgwmgmW,mmmwmgimwmEmmywe M36 EgS,,gggS2siEgg: Egs4sffigim'gT'f-Eegg, MESA 5 5 55552 ia 5?Ef4fM g 22ggglgfE5S,WSgg3f 'QfgixmiigfgggigszlfzwzZssgigigizgimzs1ffgsimmsgzazsssizmszsg 4 gwm gm g 4m4f1??if42Zv4f'f mwggvfwgeswwgssas fsgj l v 5sg,wfemssgezaammggyigg4515325522522W214422252fw2fl?fflSigifif2Hi3E2??E:E:??EEE?:a Sgsmififzmszivsszszggszrzisiiiismsziwy W afzgzazs fmi af: Wffwwqwagwwgmh,Wwmzssm mizsmgmms wg mmmzkwfwsezwwzimw 42521 W 4fmfhafxwaswzaez2-:swf-4':Ewf944zff444S4w214w?Q2iif4iS2'12z:Mf422252412252141 m444f41f:4w:: :mais 5:11wnlzlmzifzxsvzzg .--:: -1:2 ...V m444wusM4f. 44w4gw,2.i2.Qz5askH'f4 wn is Qwgggsfziwwimiyaffiixsiivwy QwW35f?ww42?'awv:,f?-gm fWM33Mfgg5gg5w:44:-4w4'fJ '1'EfcA:::e:'zwswweQ4fNrwr:W44M4'.4: '1m::fKk4.2,W1iwh2h 444MX,W ..- zzg.,-:Z fm 41e4f434Mgig4f,g :1 ,g,9.,:zgif?,a444:wg,flg,,,b 'RQ MM? ggwg iggxgwf mzfg, aim? m,K:s:2:2:,,mN ,Q2fgggyggimwfwsywmsizszzazztf:2:z:zz:x:szQ,:,zswzzmfwm1:K44f:-4.-4:fh zzrfzzmz M4-'-Lzazzf J 'T gzwz,-'wa . I w i- US .-.- was 'Wg'? g5Qf254 'AfQ ' I ef 'fi E4 Wm AQQQQ' Z xg-::.- :.:5-.5:.::: 'E ,. ,,-Mayes: ' ?Q2QSmXK Wiifib' 21:15 .lrgswzsvfvwzfgaigefiwf efi 1 5gggga?,2::f,i2,geM2fsj21igg,.2 5g35,g.gg5mMQi:,,L MQQQWWWJ44 gg f gfgga ggggz?s2WQSEE:f Wgwssg . gm, 3444 :a:aQQ: .:.:s2 'f'fr :x :1 X sf' ,A 2444 Q ,gm-msgw 244az:g,g,,mggizxmgagsL52S S Rnfiwifsff 24g::gg,,g,,gigM1g-wiv5g5??azgg,ggggig2W0z:,av,5g?,gsgg2:gm4, ,WmQ.,ww2vgM5,mlg:isfNWwM41 v g1g:,as,,gA,g,,gf4QWf,i:gW,,i 'gy yg ---- gggmewggwg X, MyY,gi5,5Wgg-QgggmgiqggabvfwmM,if5gg4g:4f4g'4ggfg,z:i:::22x::,..MZQWMXW-A44 4i::4,g5s24qwwwzmsizrizsagiiiiziazffsi, Qwgngqgsgggwgjgiw mm5W,w..yg,wg:Q,g' - 'wgmiwizswisziixwvwanggwsfgwawmfagif Hwxgipigimp-153:23'-:,5,:,r,f4m-4,Q4wmi215:::,:f-4:2zffM:d,2sS24fffvee 5::az'sw4z::,:sgQf052z2f:.41wzaff 42.gzwggfrfi2:4fitsvfzzgfzfrrgzwbwrwffw s,ziQ,z,'wMw5gW awww mmz:'4V:zQgzggf4-fi ?4f'4:f444f4vS0fww.4W43sz'mx,M:Mw44-5442224441:M:z,,,:y,w1f-fq4wfz:m' i44f44f25mW:b'-f2ff4M14fw gw.4fW'fGw,, mw4fw'f1 ...- Q2 3124155513 f'f2Z'Mm4f44??441f4ws :4b'mzw frM444fm qwwswwv wweWeigh'-m441wm4.MisEswviimzz44544sg-MW?-f-45Wi5EE:4:Amss?EQa1am4W5254'ws gwzwiizm ayawssgs sz4f42fifwffS2g,w4f4f?2v4fM ZS W444442?2f::1 2:15444 Qswszazwf' ::mff4.f 4, ggiwiiiggggwi 4 ?Ei'g5k1565f2i35'fgEg H53555SiU53'3'3i5iSWi3x'?ffqfg5Y?iQ5xs if 333 9' ??'1?gQ3??gg55giEgw5SSQ5 3552551 6 ffsigwgg fs ? zglgggfiii Pggggggimzszasszzffzz, egmizfrzzaai, ,f M Y Y M V4 A - M ,fm ggf.4wmmffz4fee.,2vmz::w:QezaW,m5 ,sM,g5ws:4,:Nm,:s. w iswgwfss x, P553-fzs wa wg ggjgwggikwigxgw Nsz::mW,swgs4s,5Qw1g?4gms:::gWWfzgfzwQmezzzzfgzzm missin19azs.22a:w:fi4f:4ff4444www 3 555535521-miwrksii fffmf .' if Yizffifzz 23:5 .V W 44544444 fw4w,4 24 M1f'?5W'p . wb .ff ak v mm:-5 4 0 542 im :.:f.::s::--- 4 T 2 0 ----- :zfm gs 4: Q H ' 'sw H, fPa'14f1r,:s:,fz::5f:xf kegzzszswzzzzww 4,gf4rg,sQ2z2f2W,m54,f,ggggvfQ?gQ:.s,eg1?2if-gwifm452 - sig ma limits: gwiwwizifzwfimQsffvzzzzzsfzffW-4w3?55SE?zva5isfzzggw44M13ifsffQgfq:gzaeszmszs 1 'fliffsfifiiififg , fffffi 4 riff , . , f . , ..,, .W MM ,,,W.m 4 ,m::,,a, ,.a,,mQ4miw,slAixLLMi2m1::?v2,5Y ,lixg2g23g,,gg, 'Ty' -,LL ,wily MA fm 'f ' vwlfllfw N: E S J, E5 wx Q 5 im ge 52 53 Z 'Z Wi iS 6 2:2 Q Q 55 SE :il if lie EE I ff 5 as 3 1 I Y ,Q n I E S 3 5 I 3 1 ww, mmf: mum: ws a mmmam wwwmm mmmsm ,,,,,z:m::wwMWA Mzmmmmwmmwmgapmzwfmxmmmzw4mmAmm1::mmmscmxwsmwmwwnwwsmzvlrszzxzawwnwxfmwwwmwzuvmwwr:-sw-Wwxff-w1wp+w1mw::f.:aMmQm:.1:m:wfswmwhwwmmwmmwmwwmm1:wNswywmpmwwWMwVm.ma ' s Hx' Q mwgxniw wwwwfwmw fmww L M W MM ! M 1' W ,,- ., Maxam M s Q ww X 2 , ,, wWMW f-'HW W -Mm.: if H .1 W f. ., 'M M .,.. Www View 5 A M W . QM . .,,. z Q ., ...... ....... :xii I- gm I ,..?::.:.:.: ....... .,.. , ,W -M - in .,. -.5.f.f.,...,f -,.-. 5- ----: -, N' ,, X 1 V W ,:.,:.:,:,m--::::g55:w- m f ... ggi mN2,.:,1::f 555 :, -3 :-:::: EE 5 zu' E xmm i ' -' ' 1:-fig --.,. 2 -5 i as- ::.gs.g-.g g ,Egg-:sf mf 32 555 Q. M ,href MMG-QQ? Q ..... fm M ws :M 1 - Mggffu 2 2 Q33f T'Wf lf Mu Wm 'M' .. Fi-.. 23 ' 5 WM ' ------ ---- ' ' if -I'E' :, 5 H E X ji gg U i E W gM,- M 511: g n- W.. .M Masai, far' . H I 1- -:-:a--:-:1--f- 5 'mmm' 'M '-mm... , 2:51s':1?,1: ------ 2 : ----: QJ.. a::e::a5ra:':: 1F:E:::'f'2 -'-2:21 W- 1- ' ' -W 'NW' ::': '-'- - :- -1-:F --1g.:.::- -:- :L:2!:-:,:1,.5-, .:. iw 5 55529 fgM 'm'W1 'WWMw5if' .-..-. . HW -.,. . 4 w M.,-mfmwmw mr 512:22:Ez:g::5E5::E' imiisz. if ' ' K, I F2.'-- .- -22.22-'E2 ? 1,-1 WW Y: 2-:f e:::.:.,1.:f,:1E5-525: W y ' , ., ,fl in I xfx mwzzr egg S E A f y . . ' p a 5.-W, ' 4. 'll' - wg ? 52 25252 K -1 5 -:A RSS? f i! , f 'Sf' J' mfg -21'.E::-Z.::.. 2359 Ig as v: g .:.f:i.gi 5g5f' ggj .:::- -- - Ea:-:: :. zz 'V ,, 1 I - w54gggQggg, if J fimf : i f . ' -, v- f' :1e' :.:.. f .V E ff - , ' W A? hx .- . 1: fr . :E?Ef.. - . . f f x Q 'P' V M ' gmaiffsisagmgkgqig f . x P W in . w s. 1 1 .:f.::::::2::: iff.::::g?::.ggffgi5:ggg5g2gq.:5:5:.5:'.:.g: E'gg:515:-5:5 5 , ' A ' X ff ww ':,5g: g- Q , ,g M1 ,sf W L34 3 14 Iwi xslt f 4? ggfggf gg3,,,g53SSfigg5?gggVg5Eggg?Q?g5?gg -:- I -'- : :g:'-:3 .g-g-g:-g-ga-- g:5'.S.:'.:-f g f'-2' N , 'iziisfwmmgfffzv :gh :W swf: 5:35, 16 W S E ig ' Bu F5 fl 1, Q us e , qsgafgfgjv wzuzsifg ,Heav y 3 v -1.1: - . ,. A ,I ..:.': :fag sm, M., Q Me, fb M Q L 51 5: i f ' 5 Eg gy IM ,H :f- 151 - , Q 1 , -- . v 'iiiiiif-252 - EAL. 4 wi ftggf - Q- '::.2: ' 7 W 532321 ??i?'2.i::zE1S?i4?16f'3'E?:-'gidfi,550 2. mpg V Q' -7 2455 .2-'5E.:E'5E -' .:i:5 jig- , .... .:.5:1,. .:: :-: W X F 1 'f - is ' gffigfrmiggg521?'2sPi::gggg-vSlrQwS:s W fs' .-21122 -' '-'- -2 sizing I in - , faq? ,I ggfisisii-' in Q 4: M533 5? 49 Q ab wi --:2 :::::':-.:-w--1-:f-IH'2:2-:2' E::.:: f .NSW s:-:'. V f mu vm 52 Tw E if fi J? KX: 1215519 gi gi -1 35s22gzgg2a5s55i3:.?:5es5Eg,??,Egsigsg5Sig . 2:'--I-:. g':25w.... .:::g:. H . 353 U,,,s,,5w55'fi?2ia:2Wf.5?, 555142. 1 rig 1 E V V .. SEQ f 3 5fPafEf:'3: , , -l I 5wW '::f .5f,5,51, : H 52? 1 .al fggggg ggigiggg ssgggggiggggg x 4.::f-:g.:g- ',.-::f.E's-:5: .ggs ? p , gmf wg w iff H W - gs :S .mr 3 Sign 52525 U A aaa: Q A sw f 53532 2 'M M Q ' fZ?:: Wfzg1?,,,f k5?sgggf',g ff? '-f,:v1WW5A52m Uv :s.:: 55555 gg 5 5 ,ww ,Q 24522S9933?g2S2555233::g5gggg S5555f55X gggk Z igi 2 Q ,, 1 Q. + lggggfimgsiiig wi f gi 5, ?ggg2i5g5ssfQEs4a::55EwTEfgS,5sg 2 23.5 may IV VVVV I Q is 355551555 255 mb. ,U M ' A i 4 Q in X' ff ' f' 1, ' .,.. Xsgziziiiifwigs g ....... ::..: f. 12:2 :.:33fQ.. , .f , Q E gg 1-.1g M y ::.:: f' i 5 K QE :-35:gg::i.'- ., :5:.,:-,ggg:::,:g.::g..::',:: .2 .g: j 2553 , .,.,,. i ...... ..... 6 1 ,, 52 :-::.:s:5-'2- rf ---- r , i im 2:g5:?iW.wZgE24-S mzz s , 40 - . .,.,. 5:f :.:.a::g:, :.. 5f521:5- ' , ai b:f?:5gSg .A 5w Uggww, ,.. ,., ............ , ..,., ,.,., .,,. , ..,. ,,,. , , , . M ,, V 5:22 -:' -.EEE:'Ei'.E' is , . , gg jgxw gwi gggsggwg wiggwg 4: f 5 gg! EM ,yQ:r-Mi sgggg? Qgggg QfZwQ?'E s ,, I , by .... 1 WKVQ nm .:. .gvgf:gQ-Q:.Q:I' gg, -fm eggs in. 5, H M , ig if 51155 3 119 .: .If1 '-Q : -1 vsa saxw , 'f ' V J 5 .... : ..:g,-5.52.i2 25.5f :f-12: 1 ' , ' M, , , . , lb ,, g fix miff g y b :Zigi 3552- gs-g.:aL:i. ,5:,55f:5' erfrair . Lil, ff - 25552 :S wi N V 153 Ee Q Eggffb gw Y - , , 5554? ix - A gguig gg iii H K: -?-5 -i i rf i' :::g: :.., Eaa:5.5a z'5n , A 5 Q W 7 Q 5 W V :wer , M .: 55:21.55 :g:s:.5:::::g- ::.:: : fi 21 5 A 4 lg 3 :Sig fr A l ' ,iw vg .... ..-. , 5- Q '-.:::: ::.::sg- WSE 2S'mg2Qi,gma : :2 .: : .:.::-:'- .nggg g If W f Y gg SEE Ewmiiiiggggiggggggighezzs sieigggf ga gs? .A f ,s . m X, Q5 .... 4 , , Q f .., . ., ,.-.V M If -,, wi ' ,. ' , KE , - :5::s-,. za ' wwf QsT:s1f '?3?SWM s4w3g2s?3xH 32W12Q,zQ -: -:. ::- :gg- f - ' ' 1, -, 5 1 I w- , . 'wwf M' 'Q W , - Sl Qi? Gb siif.5i2f.f5-f1121f2E2f.1f ,, W, ,, , 7 2, W , 5 ,5 Q :. .,..... , ..:,:.:,:::::5::- we qw , V H X YE I , Km QS.: W m , E'gs - 'F' V gg -:' :2a2:j: mga:-.!::: :E:E.EE: ' , H I mil 1 .... .--IZ XTT' -5.2 Q 'Z I-2: gi :I ---- X -2-275222:E:E..E:. 1-1- : :-s-- :S W r R' 3 ' W , Q ff A E: ,X E WS W gg' ..,. , lam Q gggwwiw fpgmggggxivgggm, M ...: 5E:g.5-,gig-:,-g -' 3 ' X Q f -fy 4... 553-gf pf' A em. ,gg - , .-.-.,,n Chung ,R Q 355 522, aaegggxsiafgg SQ me W 1 W W ., ,K ' frrw s ' WZKEQINSW g?E.,2f'MM2-wa nw, W SW' W -v.- . f ,LA 'W W H M W GW m'x'HN W 125.725 WNW 211245 , 3 , ,A , , 3 W .,... . M Mm m Wzgmw fsws:a4:m'ewm Mass' wwm'faaU':sww ww ,f usp, ,N'?fQw xiaWm NK Qiiif gimq W 5aS'5'5f33 KH XiZR5'5g3355gE mS?3'QSS5?Q5 12E'E2:: SQQEXE WW ..... 1 :5 , M A, ' , , i,:,g,ff3EQS:1L,5S5Q,ff5ZZ5?b25555 , i A 5 A fm ' L A ?f'f?'i?2'f ' w , In ll ' 1 ff f Ng .111 v A fl, 1, fwgfwfiiiwpfiifkmg -' fm '2iz.'f?'fM Fizz : E':- wi , ,f V ' P H 'S We,fs'vQWH new H w A E.. 3, ' f ' 1 w s ? ff V. 9 2fSs5 gwm2ggfs:af2:g3s2?ggs?:s:a2s ' QESESWS x f ' 4' 322325 21 S' :Ziff-W 'SMS 4-f 215522223 552iimmkziiiiwwszss:SFS-f3S3'if'i ssszeamifii 'iT2'?ffffSw?rf:S1f1Swfm? Q Q W' g'ii N 3 hi? HZ 9 ws like x R W W M 22,-W gg Q :DQ W H .. 5:6 Hg, an ,ww w ,H N Nw .wvavmwrfwbz 33322535 is Asia' I U mi , MVR 5253 mirmzszfyk 'big :-:- 25 ge-Esgfssggsfeimhwi 2 52553392233:m,s1Q2gggggfms?f2fff3gQg H wzszzw-1 Wy sawn . , ggilrqm, zxb'-Mifiimg' m 3123 11. M . , 1' M ' W M ,.. n. 1 J M :15?g.S1:f:s?:::::E55ffm Y f. EV? ' J 15: V , ' V - ' 1' ff' 1 M ' - ' Q22ff::mw2212':. Q xy, 2 :wi -n 2' 4 S-kiizrswWQQasfzsirizrasiaslbsiffwgi-2fT2Zl:1 ifm,.,W4ws,g2W.:b Q. Q 6. U 3 veswf f - s., mm.3Ztmigvgm2-mw,w,,w,m2fPxmffffwza 55533225 1 2 A ' ' ,V . , f ' 'A , - 1 K :A sfgggiziiggsg'ggwW,fgpgpxgiygfyssfftfimifbgqqwqigiiiz Mr' V 5 eg, H isNgiaggmgfqiigiiiiiiikrQgggeggiiaggigiiiii 5215554521 ,s :gigif- :'115fqQ1fS'iL-.W ff' Q53Wiiikgigffgf5??5fi?2g?SEf515SE5fg5S5555 - ' 1 i A iss:2a3:gm2.z24qzz1iSsg:i22fiS??:z4:ww my-fi f Q fzfsxzmiessszisfzsftsezzwzdmwss:smug? ' Q ' 1 1 :W W55q5fif5?S5,?S',SS ZSg.2iiLfQ3'f2WQS35wwma: bw Q 'gsm asf. .W is 5 WW 2123 Ti H wfbfffwfiggh -. 4 'A L fg:S?Sf:::53g:?Sg:fffl1:5??iEfWs:S2K52::12ssSsfE? 523252: ' lv '--' ek W 6' 5333553 EQ? :Q 'Psi 1 ' -i .. N L 'rm 3 Tfiiil fits: I if , ' ' Q MNT' Xl'-Y--fw ffWf? uk. f-H 5 5 Jig :Yami ' I' '2i '? 1?ZZSri-K?-35.i7fi?ZS3m'555fTi?ii: A Q 5 R QmwigwxifisfiwwrhSSW ig 82 ' W- - 4 A4 ' H -L -X525-W'wzmiiiswimfiawffiiffiiiis bfxzwwiwmgiwgiiifs w ' V , , wp s::gsf:m.,MgwM.Qasmwgg-iaxzxgwm ssssmfesszemwI-'vcr 'ismffwf 15 Q -M' x. ,. .,, -W t X . meessfssefiwmsekswgsa ffgfghggggs ' ' -A ' , ZYFQESQ ,, Q ' , 5fgxiifiimggegigfeigisiggggiigeggssgsvs I MS w M SFWFNW 'F' ,Ml V 'ii f MN- iii? J ' F N 1'F'fiwQKP f if N Q v ww ' fa 1: ff' M I iwsfh:H55?Sw?s?m:zS55b:SfmHsswszminkwi b ,JJ ?:s:2mg.rfT wiiissmgiws. ,, ,QSM M , SzssimE2S1Msseesmwx:asssmwfwz ffff fzS2fmWW-QA M , ,.,. , ,. V W ......, .,.,.. . .... ,... ,,.......... . . . .. .. . .W . . Q131550:Hessen'S-fyfiiffffiwiimmfws 214fgsfzwmgg5:as5:-'fQszfix??QZQa:25:WW5'?gM'w5Sfsggg,?gwlwgzwi zzz: .... N v aw . W was Q WSY'N:lW5?S2Y25 i:E1 fb M2525 an I . .. .i . 3 2, -. it ww -- . A, M x ' 'lf J' I A jx Os. A E X 2 ff T ff fi ' - I - el .N ,S .Q-pf S A it H g ay, ' P: , .V E N 3' U MQ A A .. 1 W M.. A ' ww- ' ' -- '- ' ' 112' 1- . A 3Ig,j!,iSf: .' ESNEWS-4 53 K3 V ..,, - , A L if . L :QL-fr if fir I zggsaik K lun A -. - J 1 af M., .Nw ,.,. sf . L W MM- .. V M ii.. L, . . Yi Q Y? 2. . -. in ' if X Y W . - '-XM - - .. ': . K .f 1:5 kk, kk, K Q K -Q Y Q' ' H2 Qsiagwgaaaisia? Qwiieeegx www Wim af-:aff W ga 1 ,.,. . isixiw., ,xwgiveg ag Ms .,... ..., . . 2 M e f W fmxsm N My-wmxz, -'-' m 2 me wfgefiwwwgiiafiiz Fai? SEER, is gggsxb wgggezinmamkswv22gs22EaLwn.wsg3kq,g,kgwggw --- 2 sam-X 'iizssiw P H: 125253 wif: 'iff fi Aw1fg':ssi1iSMWg mm X vwggbs AWww.wgggwM mfwfwzy wwsfww as-XE: ZigwwQwisvrff-mzzbvfSfzsifwweswffw Qwifit 5 1Q'9 'm'3Pi 2 B My Qgwggzizsasfgi w ff ' 6 L1 f ,W 1-s:iaafe1ki,ymfg,m.qgy,gQgKg2g:.g5a:0vggE aw izfzs ' - was 225223liisiixriwm::s.:v2g:m2fggg, ESE :rs .. A . 25222: g2?5?Q5MQ:wg 2:Hw:E:b::.g2 w A SS' aw www. WNW 3:2 22.5. 2525 12f2E 2 Qsg3sf 55f : Q Q :: Sw 15 :2 ffisai 53 f::E?:E -'-'- 12121 H I- : 2 ' K Q ,, .. V fx- A at i f M . ' I -M' . gf K wi :.- i k ' -2-1:5: :2.::: 22 E5:-a-a w Vfii fi-:5:: f , f ' , A , ' 'LLL ' k sg55:.g:g:5 :,:,. E3??4fes : 2?:j:5- :g:- .: .....- 5 --:-25:2 5 :::-:g.f:f::3Q1a.:.- , EH 2 .nf wi' ' , - . ' V Ni. ' . Q. . ' K is . x M , :tm 4 in , v ,. A 11:-i f : v K ' ' I f A V A K N A Q my I K .VLL A ..LL. E . immm 1 :i: ,,,, y V g ,........., , . ggi ' : ..,, :hwf F' .T Mx fm-ss'R's-.. i .f-'fx it N 1 .im ' H .W L-L' Y Q x 555' 'b lf 911- Ax 7 A. . -Ii WY 5 f Db- if FN, Q ...- Igg Yes M , NwvmmmmmWMwwmw1wmmwN-mwawawfwwmfwmwmw vff- -awww... 'Sv -rw XXX new N.- -,ps .....Xx.. ,nk WX R xv' XX: mmm W X W , X, , N W1 Q, ...... . XXXXX 3' as Swim W Xiao ,., in MX 'Tv dv Suv ' an XN X S 1-K as - A., wiv ,fr X M' X i mn .X if Xm X WL. Rm kwfgx X 'NX 4-.N hXX...d up -, ...nn W ,rw-ww New 1 -vs Aww. QB v XXJ E 'E Q E is 5 3 2 E E 1 X 2 2 E ,LMfQ4mm wxe a:zawmezxfrwwwzw-1w11m,f,f,X,.M1-fnmwfmmwmm MQQHWQQA.:-M ,,,wQmf1g,J Y,,.. sqm ,v,,iX1.,wf ff .,AX W .. w,,,,kW,4 . , k M f f A we mv , f - MM , . WM Q--- 7 f QDMW., ,f.M1.Ww. f M,x,,.,Y, V, X -.X is I KX S -. :. A ki .... .QW 3 X M A Y- :F X X X Xf X Xqrx 'N X A Y' X is Q 4' X ,-,N ,, 2 Q . H' 'S EQ? .... 1 --h- :Xx x--X wg NL Xa- .N as ' ,, X. HX. .XR x as twsgxsr' X X ., I xx X X . 1-s NX, as fn. Y Nr if .. . Q -E Q., Ki fp. -AX ' , iii ,. 5 S .k., '-:. '- A W 7..:. . fi - 1 if L Q AZLZL 3 , S LLAL QW, r L- f -..mn -X gifs N ff - cfm- ng XXXW A R 5 X lf' . Wm. W X X X. X 5 -15 X week-XQX 9133 lj,golml 11 .W 3 fs! X wwf' ff 'ff-XM 3? X 7' .... i i: 1 k sf 'ja' Qii ,Q K 4? t Q , li is VJ' ti :V -Qm.,:,:: .XX X11, .Q , ww-I f .... ' - Q .... ' v fy? in ak' We. 5 5 X X X X RX k x X x E , N X X -XXX , ' X N X f . Q? X-T 5 XX ,,b. .vu gs f 3 Z ? n --T T. N , X - .. . SFQXQX' . saw X X ik X ,.......m .g .WM1 I ..,gQg 'wQwmW:mg3mwmg5,wf5?7 ':gMf.?gmSWi.gQ 7smsw?mgQ g .... . fig mga? . 'EEE Q 'mf'?s 'Q' : . -.-. . .x..,,. ... . ..:, : :2: . ,....,. .I ' W5 7 M 5,5-awfm Mx, ------- E,.,........,.,,,A,,,m,..,.EfHfIg ww-f H 5gg ...:.., .,,. .,..,:,: .:.,. .,.,..,,.:,.:.,,, 5 .,,,A,.,. ,.., .. Ill ll? 5 Q IW mwgg . ,, ...,. I .Dm ,ggggmggv H, gy WM I . .I Zfi i wm Hmmm.. 7 QI-333-MW.:-7,....M.,g .g:.:-::::g::-.:g my 3. Q .. M- ..... I .. ...... .,... ..,..................,..,. .. .. .. ,A I W. 7 7 vw bibmws E Bm 51 in 7 W.. QM .,..:.., . .,., . III W H3 Q wa , Q III WM wx 4 Emiiwwfm T .. ...lm Am, Em www 7:52 ,S-5. ww 0 Q W ' ,.., : :.. :5:: .2 .:: : Q W My -77--2. :::,: .gi-5: 7777:--1i! 'T:Q E M is. 'ESESI .gp -i' .:.:.s.22za'. ::2:-:--5-3:'::'iffEI ':II-E' -5 i5:F 5: - j-5--f::x:- g s? S 5 2555.55 :f .f: Q Q 25 ' , :-1:2 Af ::'::.:.. sf' .. w ..-...:.-,::g-:2:2: 'E :- w:w..,, , ,wm U E mmgwm , ..... gy bgmqm 2 aw-7 . wggI5gIIS1 7 v'vwgQww Qm S2iwiZ . . . .. ........ E... ....... ,. E:. :E:I,I.I.I.:.-Ed, .... , 5..I.... HW, Nga. E:-1:2-. ' ' E' ' 7: 742, II ---- --:.:.: ..... . , ,.,. . . MNM W... I1 wmesm Q W WWWWM .:f:.:.: :2:1:f::': :.:..,. 1 .-....,.....,..:. .... : .... : :.. ::::s:: .,...... s-1:-.:-s:-'-: ::a::':',:'..:-. :: 7 V '33 Q v xv' wr:-'r .W .555 5 .,.. K, ee.. sam s ... ..,..G..... . .. .. . . , ...,..,.,............, ., ,. ., E5II5I. .,.,.,... W mm. amy M-W .W nd . . 1? , . ...... ...,... - .. .... ..... DW .... mm I. .I .... I. I. .I I.,. Q R 5 fi' 'I I'I:Z.'5I: :E':lf3:': ' :' ' :'E:HE:2:'E:: 1' EM' EI'j Nm . -I'I' I5E:I':I'I: . . . F 9Ei.:Ei:lE'l't1:- -:SEGIITIIEI IE'E1'E :' 'fi 'W' 7. ' ' M ... ::7-:-..:7:.-.I7-I-7-...Q-. .. e..7:.:.- : : :7::-.:s :g:'g'.:573:'5:5kmm :lim 'Ze .ag II . Iwn QR I ..., X: I ' . l ' I : 77, , .. , V 7 A H 'Q JZ F , 5 3 .4 v. . , '- ,,. .- .W . gs ,' ...... 5-:: - : avaisgug E ' ii' T 93 SQ Q 5' -is Sir-mini .. za . 7 5 If QW I M sy :.l..I .... I ..I..I.II. . M B f. . . : '2 '-I swf: 1 :, ' I ..,. . ..,.,., . ' 5 - 352 E 7 1 :'..'f fQ':Q:'f fE? H7 Ik . :- :-: 7: 5233? EEE :... ...-.,, , -. 5 EE , , .........., .,..,,... . ' M E? 5 ag Q5 Wm 15 Q-I.. iw... .ik:kNrrIk S Q 7' Os, M E' Q51 '.:'2:':f: 2 if If .'I.' 5 ' : : ' ' ,Qs x . li - .fm wr S ,Nw QI Y' .Q I I Q X I 'X X Ns I. A N ww I Q ,. 25. .7 -if. , - - 7 X ' 5: 51 X Q Q ' X x 7 X 31 5 xx il X Qi E X ' 7 1 N N31 1 X . WMA, IW' 1 E ss! ig! ..,.,.,:..:.:.: Eg! ,..., E .,:.: E ..1: 2 I , I M I 3 . .-.. Ig W 2 Wi. . i .wwf I 2, I VV .W M, ww I, Y - 2 V . ..,, wg Z: J, ef , .M ww 29, 7 1, A 42: Jr' -.,, - ' 1 ! f! ! .. . .7 , ' , f 5 1 -, I : ., W . AV,' 7. 4 'WI rw!-'Z-as. K I s ff x wi' 7-f'..'m ' I ,ZW WWW : ---- .. A :,.:I:.5-:.::g.1Z , ..... I W .. .... ......... , ---. Www www 4 A ag : .Mwmm 9m..... 1, 0 I. - - 4 4. .. ' 9 -., 7 'W u If L . 42. 1 ,Q W A . ,. ,Mg Y 4 I '14 1... xx , , I W , '.,q,,.. J 7 f , 5 1 W 441 Y .Iii .... 5 ff ' . -,Ay .:..,. 2 A. 7 3 55:57 ....... . I 'fm ff-f ' ' I : : :Z.5.5:'5:E: .... ,QSEQ 'wmg is gg ag 'gS'Sg 3K V Q.. .: :I 25 P :ii ..'::s?' ' .,. .. 2 , 23? S We . .........,... .. .... Jw fi Eg W E. 2 .. gf' v 5 5 . .... . 5 E gg . I - :- - . m -:. - .- I, .. ' ' - -. .. ,. 35: .-::-: ...... .. .. . . .F . -.-..- ..-.. .. .... :.-:::-:: ':':'1':': ' E55 ggi fi: .. 2 . fi a ,J , Ig ,, .,.. ,.., ,..,h:,.: . :::x:.,..n.:,.:. .,:.:,.-ia1-: :..: ..,...,.. 3 E , is . 32. .,.- E .,.., I, f 3 S3 E 5. 5 2.5 3. XM x ...: .,., H S W Ig ..,.. .... ,I . fs Q if ,S.,..... . :ggi .,., .,.,. I .-55233 'iiW.55'W??'18- .H .. 2::-::'jEj:?E5:I 5333 Q23 Q 2 ......... Q A ,I Zi 5 sg 1 17 :i:i.: gi -:-:-- , 1 5 'QS IQS E'-21 iss: .Ii 27 25 E f 5 .Es2E:'Eg,,E - I H lj Q . SI I gg .:.,..:. I 5 S S .IQ .W I ggi 25235: gmgf w ff H 5 fgiffg :QI K 1 E N3 H I, ..:E :.: -- ,:,.,: I -..-.- Q .,- -: I :--- I ...,,.E I ,5i:.: ..,A.,..,., . ,,:::,.Q..,.,.,.,.,,., I .I. I . E UI SIE? 5 a II. 5 ga? ii EE IE LN N .gage 3215? ' 3 E N gg , EW ...,.,., . .,.,. 5 1 23 5 ' , Q gg I ------:f:. :', In . .... I I 7. I ...:. :j:5- g l-mm-'H ,... N : QQ Q . 33. .... . . ,,,, . .. E ,. . . S+ 5 5 E S51 7 .. .... . . .if .-. Q M .. 7 Q 5 I:5 ., .I I. M535 . .I .I 6 M S? . .ig.E:E ' , :El E M ww mv .....:. ai .. 55 away . .... . P .:. .:. Q .5-: ggww .. ... ., ...,5. ,, .,... :-7 ... .........Z 7 - .,------ ' - ik . . . .... .,... I I ,,,,,, 7. I 5... II- ., fs . . 993 g ., gi? - ::: 77 :S 5: 55:-:-- fww-.ay g.'I,,f .. 4 7: wa Q Ei f .'5sf:?Ef:'-E::.. ........ ....... . .. i W 1 I Q .... . 5 W , W .-..... .. .... ,. :- -:: .-.. -.-.-. 7 . ..-. was 5 gig-5575 1 7 --.- ..... : --'- . ..... W ..,...I. - ----- ----- - - W I A ...... II .,.. , ...,. -- Igg-.wigmggn ,Il .QQ ---- I I- .. Egiizfmigig 7 -2 -5.- Q: f... '--: Q 5 55555 :.. - .. .. . I .. .,.,.,. ..., .,.h....,. I I III 2 ggsw gwiisi +1 2 'ss 1 25235 E I .fkfg Z E A ' , . I .:... .,.,... .... . . .::. :': QQ . ... ::sa:-i ::- ' ' .55'5f. ai ,, ....,...,. -. . ..,. 3 .. . X Z' ': Us J. Q H S? V51 ' a::::gg .jjj -er: ,..,. ag QIIQ Q ': 'jj ..,. '-' 2 Mg Q iq, I 2.35. Q F , g:z,:. Em' QI ... 2 sw aa .... .... . . ...-:.., i 2555555 3 H P 7 v z .5 55 .Eg . . .. ..,, .:....,.,.:., . Eg 7i?? .. .... . .. gg s A . 5 EW 5 15 S ff: ': :':: ': : I: .3 3-I :EEE 77 7 . 7. 95 ' E5 I iss? E g . IIIII ,,,, I ..... .. g y. gg Ski? I if g 523553 E gagging 27 g sg W VS. H E. 7 Ea fi mgi ' 7 259' 55555255 Q 77 :.- .. 5 :SL gr'--4 -'H - I 7 gg 5 7: III I .,:.,: . I. 5 Q I ...,.,.II 2, SE 1 +L Sig :. . . gs 1 H5 ,... :.:-.:s5:- 55 ..:. - Y .535 E af 1 Y ' gr III QQ I I 522 .53 ig ,.::. E :N :ir . .. . .. Q 5535 :....... ':'V MQ' H . IIII will 'gf I 2 . I ..... . ,..,. I 3 5 I W.. 335 I s fi gg! 21255 5 is E25 17.7 E373 VIE' .7 gm: . . Q: 3 i .,Q..f E Y -122-11m 'Eg' 15555: 2 7 - ----::: 7 , .: . X 4 X . 57 ia ng xii I .,,.,:,: 7 zu: g:.g' ,I .. ga 5 1 as ggi? 'as 235313 .. I Q5 :. iv 27. I IK QII fi 25 Z. 53: II .5 IEIf7:g'.: s?f . 355: 77 . . f: 7: X: : -'-- --:- 7 555- sf: E55 Q? 'Q 5 Wg? II. . fax :.,.,. ii gggfiag gs sg a 5 Q 53555523 57 1 . .,.,,.,,...,. ,.,.. . , , QI gig -. III ..... , , 3 Eiga S 5 ag 55558 5 Eg? gggggii ng I:Iaf7?5s77::s.7I ' ., H S . JF ,. - . f sf? ii 2 .ig I ..... : j -ff ,III II I. '::E: ..:,-. - ---- -.-:- ..:, Q fx I: II-- 5 -,: -I.- -4 2:3 5 335' I S ' A':- I f . .... 7g : : Hg ': '- 53 . .,.:.,. . I . E .5 ,.,I, I I .... , , EE .- is .3 1 -:-' 7 ., 77 2: f .-.-.. ':' .:jT5..Z .ZEZfQ if f:55'.:3.Z'i? I . if 2 ggi 5 I I III IIII I :f ie :QQ :': -uuu a sg -r- IE Z! .. I I iI ,I ,.:.,I . i f Kgs g s ,ggg H ' gm 5 My .,.. . . ,,.,. , .... ....,.,.,,., ,.,.,.,,., . . 5 J U7 gif? SEAS' Ai 6? Q ,E I, s I :., , . EEE I. .QE E I ..,...... .,.,.,.,.....,:.,,.,,.,., :. . .I.,,II., ,I. fbg? . ' 1 : .5 3 1 7: E5 --:,:: :z:a. :.g- --'-'-s ..x::- ::- :. 7 3 MH 'Egg 1 .QM ' Q, I:- . .,. ::s2:-.z:-s:a.: .gf II ..,. Qiixgfg ff g J mf - -----:-:-:: - . gk' . ' iii? 'I - -' 5 . is 753 3 41 5? 5 . . .IFEEEQQ I. EE 5255755 2 2 5. 7 as wg, 72? . 9 :f 1:1z::.f.-ii :- .-. . X W 5553 E5 5 . .5:, .' I. 'Lf ,. ' II W U gg .5 x E g 3 i . . .W I I gag! 7 Q. I., A 56,75 SHE f iii gg .,: , Y 5 Fgigszg 31 Q4 .g: if 557271273 ig!! ixgznbfm f g 5 Zi gi! Q ., ESSHE M7 5 5 551 fffg sgg g gg fSg2wS ?f 775325 2 I sf Ei i im ff fgg' 1' M.. Eig a W 7 A Q gi? 555555 I E3 5 g 5 we gif Q ggi: 3:5 is 1 sa 72 I :.-:..,......I,.I I,.. , 3 g 533 IIE E i7 E 2 A 2'EE'EfE25 H -: -:-:- .::E: 1 2 I E 5 QE ...,. 1-:f-rP-2'-2l2 S I -'-:1 2 ima'-.:.. .,- .-.- -.--..,-..-.:.,,.,:.I.I : .::1::s:E::h:s:::2:s'-s-':-s :-2: -2:7-::' WWN'k 7 ' E g gl 7 :77:7 -... I 7 .77 .75 : . X 7 , 5 7 EE ig? 2, ffm! .gs 7. ig sg. 33 , 5.5 5. ,g : I S. 5 2, 5. 7 5. fi QE, . .,. ... g 7 +I, 577 2255? vgf . .gi . I :.- 353355 gli. H . , E .:.. :, 'M Ei Rs, . 1: .:-: 1 .4 24, 7 :H ..,.,.,.., 3? 5 Eff . . .I . .. SEL . I , I .... ... . . is 5 , . 5 Qi ga . 5 .,.,..,. .,., ,..... z ----' is .. .....: . .5. ,. .- .- .: .......... ., I I ... .. .... E 5 . QE ggi H? Es I .I.I.I.. 7 7: E . -. . I I ' I III Q 2 ,N J1 I 'W .. ,. 5 7 S ..I. .I. .. .I I . - '5:E5.sE'Ei 53 253 gf! f 6 2 :5: 5:':5:: ,.::g:- II ,. 2 I 2:2:'.: g:g::5::,..:: H ,I,I - :II ': ....... .,.., Q1 -. .-. ,..., 3 ....: ' gg :::: I 7 gi: .I f 5 E 1.7227 MES .5. 2:5 .. 'fE .Er s 7 :E:?..gg .Q 7 : ,,,. . , W .,,.,... 3' . ,.... .. .. g gi! .. .,..,. .. ,IEE lggksg 7 Magi? i .. 5 gI ...I . I. ff 'fww .,.,.. ,:.,.,.,,,....,,..,.,..,,.,..,..... 5 3 ig 1 3 .,,.,...,.,.., ..'..'.... .I .I..I.II. .,.,.,. I.II I I,,I, I..I, , gg ..... '..... . . K, ,. . ,..,.,.:.. :.,,,,., ,.,..::......, .,.. .,..,.., ,QI E .gg .,:,., I .I.. .I .. W.. , .,................................ ........ Igng ..... , 5 ..., I .,.., .I 1 I . , . ..... ....... . I. I ...E .,. 2 r 7 Ei :' - 2:3 I'ZI'EfE,-rm:-:E-'E-EE: .. ...... i 7 H . .3 pm I . .... W . ........... z .. E LE i f 3 2 .IQ .. .... . .... F ,I.,I.I.. I.I 5 X .. I. - ig .IE si ' 7 .2'2' 2r'2f2-:E ' . 5 Q 5 eg 1 ta- is ,, f ..... .... ... g .... , 7 f .. - ....... , . ii i gl .., .. I . :i:gfg:,gAgIQJ Ee .......,.. I .. ' Q w igs . A: ....... A ..... SE ig 5 5 e ff? . . 7 if , H 75 ,. ..... .. .. I, ..... - gg' .sk ... . .I xx . .. .,. . ' 35 X .,I. .I.,.I ........... . ,. ....... .... .5 .. 7 65? .:: if .... S . H W 'T ' H ...... ' . .....,..... . ........ . ......., . 'HV 5 .,... QQ: ' .-.-. 1 .-... 5. 13 . K II gig .:-as..-:.:.-:--.: - bi 3 E Q ------ lll- I .1 .2 s ' 2 WH .... . .... . 5 ' -:: '::: : ..Eg: fz-:- :2 :2:':Eg g.:'iL':i ' . i w' I W .... 3. ' mirg cv -. :5:2:2: 5:i:':: :::.:- If 5: ---- --: X . gg .... . . 8 ....... , ......,.. .-.. I IIII . ..... .I...I I II gk I - - ..... '....... -... I l 'K ' 'Y' 2551 7 7 'W 'F 1 5 N' 2 vs 25.5439 Y iw It .... , I K+ .. 71 33556 .... , I . T. ..... SES? .572 . Eg g .... . ....... ..... ........... . . :Sw 529-53 j:::. E E... .::15?':fQ f:j.jg ':'f'fff ff' ff. .g:j: :j,:g-- ez .... : .. :.:. 2EQE2E2 . -2 2522 a n .Ejgg m.I.I.j.'..II..'II.IIj'I,Q ' ' 2:-.: I H Ei , ........... ,I ....... 55 ?f2:e7f::.:f H' - Im 7 'f - if N 5-5:fE:5'252 ,msg 55 I 521 . I 'III' ------ : -:- x A' ' 'ei ' .... .......... t 'Q . .. 17 wr I ..... ff .......... .. , W ........... , f.. , . .:.5:. :5-35... ...... .W 4: III yi .......... .. . .... ..... 5 ww? 5: Q gm 4' W? S ki Eg ' f sgwim If -. mr' f ...... 2 . gm IIII- gzvjsggfg :E-. 7 ---- Q. .. ......... . -- I ..,. .. . ...... . I M ff IF ...I I... ..... .. .... . . II :. ..... I .7 ,. .- '..:.: :::::.: -- -gg 7 I ': . .............. . ......, . . izgigagwig MI Q ...Q ......... ,, gin Eg g .. .. :5-:r- S . . '24 ?:,: :z - . Ziff! wb. 13 7 .. -: .W wi ?g1g:?S' 54'QQj ?g?g: 55 Q55 - 3. Q 5 5 .... Q Dim ig '-'-'-' , 4 gg . . ....... .... .,.,........ . . 5 gi? .Sa 3527 :ff ' ..... W, W K ag X Q ,I . 2 2 ' v Y' as .-.. ,I...,....I,.If.g:g I I I ,., Ea: .......... . . .::YE 55' .. . ' -755-12.222f'2-2. ...... s:::g2 f- fs- ff:':' ::g:H me--5-'Q-f'rf'5r. 1... . N : .-.:::: .12 .... 777 77-7 75 21 .M 'ii '-'-' . I 7 . .... ........... ........ , -...Lis .... :.- fig wswgwsimwsggssgwf gg ' -... T 5: 7 wif' :Iv 577 7.3.9 A ff ...... A 5 P ----- I- :ZW W: 'N' 7 F ----- :f--:-:z W 'Ss :5::-.5... Q. uw, .0 wg .. '. ' as aes 'H III ' s.IiQw7,.EffgI,g.M.:.....7.m ,. I. if Q gs .gr . 6353 Q fi, Q E551 iw ........ .E: -. -..-. 5 5 '-Wiififii' ---- ' ff 3 3 .. . . 52? ........ if 257 . .,.. ........ R 'Rig ..,...I........... ,.... Q 5, 3 ---- '22'5f'E1E..., Z:-5E:::'E:. if Sw 55 7-?5 ' is 7' 2' I:'::aug 55--55 5525322 -EHE'E fi 55 I Sig ?27s?E'f: . Eg!! E ggggi I :5::ErPig2i2' ':. Q gg H 3 5.5 iii? fi :Ss 2? 5 55 515335 isp Z I Q FE 7 BQ I-IE... 23953 I 1.::.9f5fQ5iQ33 K iiai ggif 2 Sgggiggggggg 5 I.,., Qi . W Q7 w 7 mmm .7 .ez Q, Www ' 1 we www 'mm asf., M W .-::':-:-:: 7... 7 ggi? 275. .-XM, 52g2?j.5Q.,.gi ykggpgaqmgggggg ggdSgg?55:.g5:Qa5g5Igg55H U... 1.55 :sm fw:x. ww7e,Mw ...MW A E www .4 ...I ------ 7 ziiiezfiswwagiiszgi ix gfm 2 'B' '5?E:sf4z'i?5Z??525S'5SZf1zEEm3R'?'3 ?i25252?V m 4 .Wg Q.. a., ,Q W., I, mf., I, V .: :2: 3 55: f 'simwfe w '52?5E333giPf 55 3353qWEgzmfEQ73'5S12'Q..q 'B23?iE5aQI'53'5S3 W gy:5sy3Qf'3QggSgQsaz: 5i?535,5553313537:2..23g:zIg5?IZa:::s25ge:i3f'Y55L-giwfxzg . : ' ..., g::: :-zm xikmwwwwegg gg. WQZQSWSQII-.ga -2 if ...W -.-. .M W' .. ..... -WW M -':s-:E-1 :....... mr: 1.7 V IW: 2 IWW. ,. f.,.I.... 7:77 :- :-.:::-- ,E Www. W--H M, '?-mtmp Wm w,w...s??,7f..... W ...... . .1 ,?.m5QQHwQg ag g5g,mQLgEwg igwg?mg, A355533-gg Wmigggggifggngggeiggbjgfsi..,...gfiZ,fgI,I 75,2455 'W,.iM,,Z W H -Mn .gas 7 ..m SR .... ............ . .:.7-:.:.7555.1 .f: : :f-::: aIqIfI5. ..-: Q I ffgawwf-f7ja375bgfg5'i 1-EQIIII wggzwfzg m7w..,.,.......... ? '... MWEQ? 7 2sQ:? 'Z7i'iQ:M. 77.77,ws.f ,. at sw gi- ff .W ?yi3 w zfsgzgwv Wm ...ig3..Q,,.,g..g,, ,Iiagywbw 2:wf....3W22EE5.,..,II...4:s..z.7:i7...2...z.9..,w5?M?,:f:z.5 7, fix...-.... we 2.7. H 9 WET' W4 www ,5 1.w.wf7-f I, mx , I .... 7-T..- 'Q' ,M . -:fiflw :..1.:'::1:': .:+:.:- M ':'x I:II'II:I2:I'Iri'I' ': 1 wiv - W '-A ' --I-E NE .,.................., -4-: mTT.:MAL:luvZEgf3 I, W'm 'gg, . w aEi?':::.i.Q 'f' - -7-- W-M wir. 53725 7 si? H Ria if 5: gh? 5552: 5 Hg V-35:5 Q . :.:.5s15 5 ix 2.55 A fE:.E::gI.., :-.::.:'ge5g: J Ef'tEE? 777- . g Ii 'N I 55555 W 2.52557 Q H 7 5 2 QR. wi mf 'Q . :saga . Q... I -xffissg gn Siisiief 7: 'Wifi-5542? Q ::.s::'ei if' 4 Qi gf. E 775 i' ai 335 ,W .. 2355 .'5 giQ W if vpn Z' mmiiy + 7 5' -1-.E5l.iEf4:E1.:5555f7 gig wg gge' wg Il :iii 2 1 BQ? gg? E 55 7 ' se 1 1 5 mai!!! Y iw '55-7 'i ' ' WEL?-.ww-fisff A' ,'5:1wI , ww: :ms gt' M ::S:775!h fSi'f:egg,,7 1 Jaw 7m.:gz77m.gI,w-ww W ' ' :g3: -: Zz: M 7-w ww gy :gzZH2gg77g.?4?2,.gg5Ez53gg5,gZg?z:2f5Ed gggigli-1:zm5g3:2i5:g?gg wQg IfggE?g,g5S3I5.3I.W5gIg5gQ3,,I..,...gg.5?E5 Nw . : 1 Wm. M :.:7::?:3 , mms: I, fgw ,III .fm E .Q ,W gf M7 IW 2 7 Im ,L I, 3.5,-:II as ,,,,,,.Igw7m QI, 7., 7 IIIIIIWW I .f.::2:v:: mT9m Sf2EQ?fEf3QSi3zigm0?322?3sa15m:2?i52HSa5a,1?5E fa :12?kQ5.f..i52f 3'Le'EfgSK3,asZfkfES:4e:s:,sz:Qw7.?i:gzfwgbiiszez?5f?C7k3:x.sw1MW2'3i2W '?s:5Aw77-M fm 21,13E-g':,c:gEz:gzQis::i ,.,,.,.- 522-'5Q55EgEE::fEi 5:5:15'f?QE::':5' ::'::? gf:fj5f'5E:5' k: si . . , H H4 , .::.:., -.v::.::: E .:..::.,..:.::.- 5Ef.,1:-1- ,:,... ii3:,.5g! 1 if ::. -.:.:,: 1 rm-i-... 'Uh'-new iw' S im--M M KW ww wflhgg mg M ' ' '- 1??1: : '..i' Wm .... 1-,-:L-,-,:-s-a::::::'.:,::,:1.:.g::..f,.5,: ..., .,.-is-2-22-':-:Q 5 X' 222- '1-W -:-:--s-:s-:-::a--- W '5'5'i5'5:'5555'5?f55f 4-'15 L Ja Y K a , ffl WWA v f . : l Q MQ EX Q x wma Rwmk M Wk k k A W-162 .W krgzie' . ' AX M- 'PWW' . ,..,.... , ,W . ww , 7 -,gyms ,gig 5 5 W M'V 'WAQNN ' 2 ' H F qi 55 gm 3 mm li sm 25555 f Ei k W , , , i f 2 rze ::: :Sz -.-,s-::2. i5'a3j33i55 ,:2. 5 '2',s:::2 I :,--,5 3-i EEE Q' 'M if Q ,Q , , a 411.2 Wm .s- Wm ' ax Q lea gs v u? 1 Bi 9 w s Qs asf 5? Sw 1 ig, E Ei s .5 5 fi E .... ,Q . :Q .,.,... ., W. M- :::::1'a2a:1 E NW 'M M .. mr f 2:?fff:'51 Er' -Aa-: '-2522225 mmm was F- .. ,iw A 1 Wg ------ If xi M , V,im...1.'.Ni?..iii X w Ea 5 'gl W , A M ,Y at 1 5 sz if 5 E 291 'E rg 3. 5 SE M QX Q fi 3. 2 S3 .x .. a. M, .: :.5g:,.: ..:::::. ,E .,., H Ei: 35: .... ' :- ,. . 3 .. ,.,. . .I , H ., .. ,.... , .I E - as ,,j:L E X . 1 Z ' 1554. ...:5: 5: .. . .. . .:.. . .... : S .. nz. :.: :G :L :keg Fit. . ' . ...,.. ..... Q 15: --------- .11 :5.:5:- .:.:. Zz., - .:2:I. : f 1 .. 5 :Ii fi 5122: in --,.,., .. ,. E :.::.-:gc 5 .,., w b .... QL ' :. . 5 ? :Q .sig :am .. mb 5-4-2 s 'Q 2 Ei as.. 3 5355 Vx'X ' M FNMWQEQSXSS 5 55? 1- -5g:g :fg-hm.:-::: :: qgggg: M33-:I-:.-:::,:,.: :f.-252.-::a:..: -E:-:3:5:::5f ::': .:.:: :g:g. :5.s::-:: H ESE '-'-'- mibff- :5eh:2.-2:2 5,-g':5 -- W ig EE 25:25 :5: :ix ug 9 S 2 2 Z 325 fi Q gig ,-,-,-,-, .,.,. :.,. ,.,.,. , mm ..... Q iiggsbmsg Q55 ,M , 5 5 . .,... .,.. Z? 315 ---,im I i 'figfw i ssiisif ..., E m gma gg 1 ,gi Em 53 x X K ' W ' ' f- 5 X W 'f 1 el 2 l Q Q ggi .. ', 3 E 5 2 ii E Ee t ig 5 1 f it gg 3 I. I U ----- , I2'I5I2E2E'i2E2 - 2 -: , egg-g:5:jE . W . 1 22 F ' f 5 1 K E ww N23 3 is Sw Si 2 i s Ei? 23335 1 Q .M ...-.-.- ,.,.... : . .,...,... H W , H 1 543 -Q, ,,., Sn Ria gg Fw ,...,.,.,., ,.,., ,. ,i ,,,,.,.,..:.,:.:.--. ,.,.,., ,..,., .-.-. , ..-.-.-.-.- - Q ..-.-.. 1,11 ,,.,. , ., ..-.n Q Him W EE Q W A3 533 g EiSv '1 YSY5i3Ef5mmgY-ww M 53 V V sf --'--- --'- .... ii .... -. as ' EQIQH ' vQEzw25W'?Q22?mf35??2?E::z:2?i:::gs 255551 555-E: :::Eafaf2: 51 5515 ? 3 2525523352 , i w ngg?g2gg?,43QE 2ggggz5ggwmgg53gf g?g gwggQm,mfwwggwgz?5Egqw?2,ggggg wgmgg 35 55-gwwiewasszwm ..... ..... 5 35gy5 555g 21 L, igwg gmf . flsmw 5E's 555.f5?ffff- -55 ,izzegz fi2'20 Q52gg5wm5E2EEi:,:wf gs give: m y ffygwifffzfz? iswwf zf' gg a i, :ff gi gg vga pg ,, if y 'Q lsegg H.-5 ....: 3 may .-.- ,. sfgwwgmw' 135. . W 2 qw weggggvmf wig ,F -,Ei-g :.E. :1WK ggi ig bg m x:-. , ,,:,.,,, Q e g? Q 5 59 .5 ,,,, A :W 425215-5: wz3i2?gQ,Qg..:::a ':'3'5:5: 2555? 82555 gb ml' 52 5555? hm? S N52 ' 5 W 32 .f:-:-za. fz-:s:s,a::E.:s-5 f Ev 513 gfa ?5Q3X iME 'B2,,fwf 3: 2224 is 2 ::gigQ5g 5gagsQv f:1 '::':' frfa ---2:-E:::m x:Q. ww 255555 iiisn f gifs' 232135 sm 33135 ggwigw gi L if ff -52 :2-53 v X ggg,1,eg5,ag,5i gw e5iiZgZgg1w?'?2 Q? Wi? 22552522553 ig? 325: 225 05235553 625353335 21 5i1fi52555515555:5E mg? if 142 Q Q S X , E - -'-' . ' we W Q ..::: .-.- :s: Sw U ---z-nn: 1.-5: www 2: ' f Q: wi V A W fb H A ' .:::: 1:-:gif 2- rr--mm , H .......... : , -ang asf- g 1- sxgaggigigggg gwiifisgigiigggigggfgg izzgssiiiqyim 5 355 QEESEEZQQY, A 2252 35351322215 agwyggggi 13 :fm-5. wg 12 .....: sg.: gv gw 2.53 vyg, 0 ::::g.g:.g-..: .-:- Pwafw wgifdgggg gvmimagwwfifdggihgjggim 'gi ?mswwg,gA 453 'gifs 331 gigzzggmfff WSE ,.. -5:5: 'K zg:g. :.: -SMA 5323 4 S H I, .,. A -1: ::-- M 1 IE 12 ,:q35'E 1NZi'31QiZ2 332276423 as W Z? E3y'Q2,gQf35MW3f:QQ migggssggggzzwgii',1'?r,J59Zh Gaia? Qiiifgggfiggqggzg .ifgggii 'zmiwuw Wgwlgyiiii Lmislf Q5 gmzfifj' Agjy , ,. Eg:EgZ,. .-. ,.EE:. -E --'-553555 53 ZS ag? Q-,,,gEjEgf::Ii.:-::5.:::3fjf : 51'5'fff,fQfff',f, 'E ,ff 2525Ei3: :ggjE'ji:Eg.5g2 4va1Z2SEZii5h5fSZ3?A'E553v:iE ?EE45giQfiggHevi?55?'3 Zi wv1'g5Qfzz1M 'fiZfAiSZEZxZ1,g55?-Q5M,mq,, ,wwwwg-1WyQQMQQFZQQJS5m3ggM,,x5,5wwSi555gigg,f?gW'gggswgkggvwzzsasgggggfwesfm' w mwwefgwvwwm ...-. : 52 '55ff5555f3 :':-:2f:-:I -I2-E2:25I525?5T2 H, 525552 I aka ...... ---- W qgisggaigigggw iiifgisgggggiiizzvzkg ---.--- 1 W lbw Qi 'yffiwz gfiiggggg 537 i5 H smpwiiffw sz3f'1iffwfif'f Qi2?.v , , ifwyff'-fe! - wg: - Jef ff :: ---. Ss: S23 Q W v 4 5 wnmw 'fvgbv w ,. 4 migpgif-g g -- Q -- f::. 2:15513-3: Sziifw w .,.,.,. 1 ..... 4 sk-,qfvgwy ..:.:., ' M,25? 2fzzzsaaW SSS? gg0wg,4,:,g,,3,:,f :...: - -f:55:f:.::-.: q5:::Sf51 2 2 ------ afmfgg ----- Qggg , 351255 S gnyiagiizgxifaieiifzn izwggggwiiggizaiwwdg ....- ,gags m :: :, g.:.:..g5?q4g:-.:: ::, F K fg,gggw:ggm,e :g gggg .-.-. ::.:g:g:.':g:?::-:-::'- -.-:g- s: :. :f.::- -: ---- 1 1' :K -.::::::':::::::: :::-.'-' E f -5s::' :r-2- QW E .,.,. 5 ,.,. , 5 .... Q M f iii? 5 gg lgifsggggfiggw fg '?vg :Wa x Q W Fifi ' WQEEEWI E ' Yfz' W u 1 xv 1-1-.. AW M ,, ..... www of .... .-..1 MM --------- : -:-:-:-:.::-- - 32 vi .-.- ---- Q iii, .-.- 5 v U ,S Q Qui? l izfsl FS, giggigvwg -a. g:::.::: e:- .... : g gggaifaigii --------- :im Kg km 253252 PASW ----- 5 Q 3453 :-:-:-:-3 ---- 5 -a-a-'F:2?1- :- -.-. f- :I ---- ' IE! 52? ai-2: SH :-:-: :. H 1 W X ff iv 4, '--:w:::2: 2E'2:-2:?f- 2a.:f:..::.:::.:.::.--5 -2:::' -I-2. - 5353222 ::+::'2:2'2E M E 22' ig' -:- I f IE E 5.222 222 kgs' K ET! S Q 113 Qgi ' -'Yu-'-I- -5:5:g. 3:1--5: 4, M 'Q -'.::::g'::2-:5J55f5:5g 5?gg,:?5: -':g:2:2 ai gs 522' gwfgmfg - -1, ' EEE?-'g?gqgwej,'13 S I -If- 'Q- ' -ff2:::-' :-egg 5??gg,5i:g:f'-': s5:5:5 ga -2 ft vs 'Hg 23 ifisg S 53 5 , b 5 Eg N YM 1 W SW -1:a:agag.:g:::f , ,255-'E5.- gi ww, W ,,,. f1gx4rE1fSQf3??0K 2 gi,Y 1fEE?Qw5QQQ31fg Gai w if Z!! i H'4'.17ggw'5f W ...... ' 5 2 f 912 Q 2 ---- - fffgigaggigiigiggfsgg gxaizm gzsziziggwgigfggii X Q,,,,g5g1,?S11'6 Legg, ggbigbwgwgg. 1 ,Q ,za i3,.b,,gw, 4 .... W.-:.:. :.5:.:. :M .,., z ...,. 3 gg? X .mga-:::a:: ,QM - 2 z:- M , ,.,W ,sz '5' :1.'1:::.. 'Km' ,H f ,,1, 31-:z z -.--: - 31.1. -- - ' .1 ---- -21.-51,31-::::.:2a': figggwwzw, 52' W wi A Q, ,iw Q EQ E ?Qwi5i ,,,w,ffg53 - ' ----- Q Q' fr., :wg - ki? .,1. i uuuuuu 1 ----- . ws? :EEN '7W2ZZiy1a' ,,S?:a.,fs3g2wfW .,. 55?5E fEE ' m' f,,fiEm HSv 9 .W Zwilffg'??fE?:'gi'3iii girfisfifz :fszMi'g1Exf v?9w f,r ,,, REE? Wa Fe w m?S2: W 1 3fLzEw 2 lg 2 ggi is m e HE gf img L5 :1:e:52-zefriggg g efz uwxai gg: ,sl WE g3a5gg' 5W.?3gWf1 Eg W 52 E255- . .. 5EgEg 1: gg2g3bs51 15525 Ez'531QfgEi M 133 arg was x 52Qgw5, 2ssa ?Em252Q M5554 52 Emg H R - 255' ---- ww e 9 gl Q. -v3 ff..:. . 52 -4242 2 f' .' E:s Ng: -2:421 15 if E25 1 giifi H :::E5. :s'2 Ei. 2553 2 E.: 255522:2:':2II'I2E 2f2'525:5W 1 2.522522 ' fi'-5?552: ':5 25522 5555 55-f?fE i2:252':' -:-: ' 2 ' 12 5 .- gg 3 25 51 29 QE X555 5 Q 2-I-2-I-2-I - ' I Eg Q. ligase? , Q55 25 2552 I 553-gwggfgis K ' 5.55- 5:1 2-I-5:': g-53, 3 .fi mg ' ... .g-5: 35:g,:g,:g:,g5ggg:g5g:5f:: a gggg i: -g5gggg:5h:f5: :g: :a: -: s:gx5g E':5. :2jj '25 g .,., Rm 5 ,:f RSM, :Exam 51:'55 5f55:5E5E:EE?55 M EH in .......... f::: ,, m i5?if'2W-N152 ipvi gglilggigii , ,. :,55: .... 3 fs: E gs aq- HQ If 5-- Qi 22 5 ia:-:g.g:-:::.. :,:, .....,.. : Em g5m8SQ .g.., .... . : .... g:f:,: :f:. 52222 . -- .... ......... : .,E.,:. :::-:?g5 ::-,.:5:.f.: .1.- ga ... ..d 5 M.. -: A35 hi s xiii? g,g V v - gg ggi ! 2 Q E , i5f5Q :ai'g:.:fE '-5 ..... :::'::::ss5: w3?m,- ----- 532-wf59g2X:g ----: s,:g::. ..,:. .:-.' ----1--- '- --M - -5:-I Q : ':5:- Sseaig ig ii '-: sd AEE R5 - 351542 555 5 :522225 H '222?E,ig:E:g:5:2':2 sz H 5:,-55:2:g:g.-2:2522::5:5.:s:..:::'::-ig?:gg:rg:5:-5:ggiwivii-'2525222-55555'5aE., 1.,., A Fl 'Eff' 1 z 'll W -.M ' f : fi 712 5 iv .. b A EE X3 'Q s-:: 5f ' 5335 iifgaxfg 1 K W :: :-:: :-:ar-ff-5 -------- 1 in 23431232511 324 3 -.-: -I--Iii-:- nw? 53 35 2: :'e IE is -- Q 5555 Eg E Dwi! S 5 ' 2 522 W ' E 515 Kgigfki 551315 Q 5 Maki 2 5 1 5 3 G 2, 5 1.1. 'I.Z.Z 'ig5 Sgs i ig ggiiw gigiar 3 ig 5 52 255 y E Q i ijijiffj i 5 524552256-sg w gwmwssgaqzgkg .r kyiigggm zggzasiiggwgigifg ---- 5532 5 Es Q :aa -2, 2 Q Egg .H 1 .... Q Q TE 35515 :Niggaz W H 3rmiiiiaissziigwizzgzaggfigg mi se: 2:32 ' 2 Ewfgg g are-112+ Qfiizaimxzr MSW 'gif ..... Pg 525251-2' X ggi J I Sw .-.- 5 ----- gg --------- gh ng, hw .g.g.g ...,.. : .:.-: -, gg- lm, , , .5-g.,: 1,.1 I.-::.:,..5: Q gggqgw 5:--:g-gb-:g.g.gf.g,E. .31 rm g,,.g.g.g. .:.::.:g:-:,-:fgm ,..,. Q QL, up ,L ,gm ?3'Q.,2:5a?ggz5ZM 5?Xi? Sm is Q -1:55 ---f..g. gg -g:5:5::::.g:g:g:Si..afa3gmg y5g-gg4,,g,::.- :-- 2 - ,Qi 2 H 11 'ff' , giz m-fb VER? MWQQVN giMSw,,:5?2M :: : -? Q q 55 ii Q 5 ...... -'-' 555 E H EEE ' QYGKQS EQ :Q .: :gr-5 ::-2ffffkf:5g:::5s::::?E: ig: ggggggfjg gfgggggg ::'2.:E5g :: gigggi5fi'bZiSiEfi3gg g WEkg5g ingsfigw 5'3MHi1's . 'g: gm wal ix gb 5 E 21 ?- EY EE ES gfigg gfi E! W i? ?EB35Hi1S1?5mE2 ,,?iS5g g5,A 526 12 f 522 EEE! 5 3 Q H ffm :g:,:,::::: HW 1:11322 -Q.:--1.1. 1: --.1.f.f-11:19--5: zz.-:--:fi -1551111 2:fa:iaf:is1mg3,gg:,,.2x33 aw?-,fgz'Eiy:'Q re-1-1- f: E gu ixz wiwcs :fir S ' B HE QE? 'gif EH 1, fi ::::::.::. 2Sg'1E9g3'W5g. fe H, Himiiggfiq wggy gi-5: mga 31333916 Wgggg -g.-g:5:i:,:g W :5. 21 -2 f- 612133 wggg, 5' 'fm dw! :Sw wily .':2:s.:.5.: .,.g?g. ....:. :g 5:. .g'2,:. -.- :-2: 5-:iz-Q.: ::-' ,if ,gsm ..... M355 E 23, gE:?:i?S:i2 2i2 Q ,Q 153 LE , 3525 3 535 55222 5555533 ,.,,Q 3 fi 5 I X ------- mzmesw WmwwgwfswwgzzszsfeirlSwMyaszgzszmzwWgms:1za::a:z:sxw1Swgggag,w,:z WQwg?fgfszziiiswiimemwzsl'swfMfw1es4i:MsS42iHV-mefs g5W?.15QfMg,,,,Q4':mwQiggswgfwsiwmiag- mgfigmff- ---- ----- 1 .-.- : ..... 2--f-2:1 mm522355553221-912252wE2ai::::z::21:5: ig22iiEE:::::?::22i gsfxiiyiimzzzss5223521222:YS:1?siizszimfiixiihssialfi12211322Sginwiirimiimigivfigiiil2E1iM2:55Qw??Ega21S552sE22 Xiiizzym W SWS 2552'E :a-:: .- 'Es-22 52:--I 225 . 1: -1. 55255Zaggzxigggggggsiixgsfagggggg131555:15155333Z3gggg5,:,zasz55g3ggg:1Lsgsszzzgszyslfggiggggggggasx23535553azz:zigesaziiiiifgiggf-ifgsrixlfsi' ifif332280PW X:2:2i2'eqa25'2QQ'5ETi54iiiE3Z2,iSCId WM RHXQMSQWQZ SEQ 1: 2 :QS -'-'- 2i??'i: s5S2b2E 52 w fwia ig 22253 Q Nf E:FE :::.:1 rfrf2E1E3:E:E wi W2 9 'Mf5W 1:'-::::'E:E5 .- 2, ,,5.v.ge. 5? Q W ,S H uSQ'5s'553q3 W EE? ?21'.xt:TTxf1.::rf:K'wm21if2 2,.i? ma W 'sei 334, wg fggf v gi' ,. ga -:Q ,, 'IQ W y i ' 1 X 1 'H ..,. .... , M 25 .-.-.-. -.-.- - Q W? ,NS ne. . .... M digiiaassis QM- w as R Ng Miii m ----- W H X. Mgmt .,., 5 3, - .... E Wa, MQ, A 4 .......,. f I Eg X2 N gm ? I mg Q H gi 53555 H53 m y ii Ss iaiiwi X 25 gg E g g? 4 G H 2 ---. 1 ..,.,,., E3 1 5 H W ,,,. Q H 2 A .... .,.,..,. ..... ..... as w s Q23 wig af. ...... .... ...... L ,iz ,Q ..... as ........ z ....... .... Q .. ... . .. I 5 .. I g . -Q-Eg: -5-. :-:wg ----- ---- 2.:::'::-:.g.,:. .:.-.fag 53232 8 -:naw-:-:-:-.: '--': ::.:5:::: -'- '-: g me-:'-2 ---- : -:- 2:-' a Ag - ggi 'EH X 3 -H 3 if U 1 2 X 35: 531-5-gg:?5g- g:ggg5g:g5g:5: ga?:::-::::-:fgfmggggggga: ,. -,-5, 5 53 :g:g:-E: .:g:: ,EM-55-g? g:,. H -.: 5-ag:g.5:g:,-:5::.g:.::.:,: Mg:555:5:55-g:qg.,:g.,:g:gfg:::. ::.:::: 5-15553-5 -5,g:g:gE:E3ZE.'Q:I:Zg 55: K fp ,.gg:g:g:f.5:-:-- .f X3 , NEW' -3- - '::.-2:55-:ff:5::g,,545, ., 5, ggi . if , ', if 9 -2: - 2 M 551 -- If 5. E 1 - Q p A 1 :5 g 5 ----- 5 ,:1 0 w 1 53V:,1.. 'ifav af ik 41 'f2 iii 55 5 5 vi 5 H ' 5 if at 1 ' I E' 3 - vf',wnM ?2M ' -' fis siw ii. - - 2 -ff SU 1 5 I EM 'i ,.,.,,., .... 5 5 V 2 I X 2 . 15 '22 ,-, eg? E gg 5 4 Ei Sf 2,5 I 22124525 .. Ei V E 551 2 iig 2 5 gig Q If Eu 3 K 2 Q -: :- 22-'fi :I :2:2E2 .-22 252-2??2E'2E-E RW Z 2i ?2Q2:4Q,, fi? 5-E 5: .,,., - rfSF:'-::::::Ef::::-2: ::::I.:i::': ,gg W II- -52'LlQa4:f2:.':':':.::::2: .- ,f Wg? ::a:i::::-:E2:2':2 -' ----'- 2 AE X Y: f K :ii I ij M ggi I s 'ii H 5 2,1 5 22? gf QEQQV3, 555522 v ii igggggg gg F5155 35522 3 ' eww X wi Z 33, lx 433 55,5 gi F E m F55552E'2EiEQEE: 55-:5E.'? :EE 155215515151 E2 if if 'flwmsg . P Ke lis W :Egg 3 5 E V H 5 1' W SU W X X 2 , 1 L ? Fifi 5515555 EW? f W ifgg151f?2W E Q 1 . ., y eu 2 iz S HX wwf' N Emil f X 5 'f if iw w , Q M 2 25 1 3 1 I 25 535 S555 . H 'i5a'H ' Wwm?E3Q'g?W2EE25Q 5? Efgwfwiiw? .-N? ifil v ..-:r e ffz-ff M 9 ggi! iifs-- Ima:-:s:.s::. 1 lie f 155113 3 Yi e is g:g:g:g:3,g.g-5.5. .,. ...:.f:q:5-:::, 535,35 wgfgamixkxMg1G:,EqigmB,gmgwggJ2Ew'Q ,K .... 5 . :.:- .xx Wxawgk-Algag g:gi,. , ., gg,:5gg:,g:g:,:5:,: 2 ? : 5 ' g ! 1 3 Q is 2 :?:::'::.i. - Mi? II 5,1,,5E2E?H23Zi11555?QQS,Em EZHPEESXXSSSEESSEEEZEEH H I:' W -H z : aM3aS' 3 GiQh'52g5SE 3E 3 5: 32-I f-:: gmwl ':,':g'z'ia::: ::- ---- N 5,5 : E2 5:55 4 ,, 51 M5 A gf -5 'zzg sj gif ,.,. Eggmgig fsgi gififgf il mwmm wh wgiggm?gHQsfQ W5zQgggg3xgvm3?1li2iQ':3aV 525,55 323.5251 bggg,si?'Smgkgqawwwv ?Si.f553ga3 :ar:ggi-g2'ga,gg:gg:g-:5:j.:::.::::: 2 2 ,:,:':5 2:22E2 --2: '-'- .: :Ezi 5 HE 55223222 f '5 Q S Q .gg--5g:5:-:..:-ji-5555 5235 1513i Q 3 g: Qwgzgqgwppizyssffmwfa wfb'I+gxE'f5g,g:2Q2.-5519: bgww-a2i:,2Sw'3iW H5 ..-. -.--- 2 .1.. img ---- S ga E- Lg if Xin .W z W 2 353 522335555559 :wr-I.:-.-1 M4:2?Q Gsfaet4sw:-:-2: wfzzsweasi 6 s -' wg MS Y 55 ..::::.'-' Ei--5: '-' hwfgfdvmwipgazisxsiaais f QSWGWSP aww 2 ::-':',::.'E::: ZQSQSSEEGH gi, ' vvws5:iE2Zx5iHiW1 ,gggm E ZX ::.::: ':..2l ' H f gg Q ,, E 5 SEE ., ...... 5 .NMXWS 55E WS2i5Sp iiww wm ......... W amiaigwaiigm ,X ay Wh .,........ ,Q mf-wgwkgggi M Q :-:-:-:-Mx.: ----: QQ'QQ'b ------ ---- Q Q ,, Ei .-.- 1 m...x.. 2 3 - s-a--'- Q vw gi 1 2 ,mf i'Sigf22E ? ' 3gwsw2g25N wggefsizsggimiwiwxg zzygggiisssgmw :K gwiffflfiyrf 22 . rig 51,:,fsg ff:Y1,w : , ga 1g,:::: g:,gf Lg ---- 221 52 W 3325? ix if. :::a:s:::.-1:31-1:.: s: Q.-12: -5:5.:5: .. sa5ggg2w2SSESfi2M22m2S9 imkwm -5: ,.,. . .. ::f:5 1935 W 342-Q 5 Eff WM if 5 232 E 353322522 EMS L3 A93 H 1 23 jiagzi a T5 55 Rag 5 1523 E- zgiifiiiies iggigieggwzggii Hwggiigiaggziwggiiwxg swssaiwgg 25235532Swswimw siwwmfwg f w 1 w ggfg1 4 Q.Q w :g.1 e a, gimp lah! ax Sf L5 ig gm 135 ig W in - Wgwfg A qg'e?2EEQ?siWH 5?EE2EQ w iiiiiiiiiwi BBS Waiiiw i EM 22525 Q2 2 M53 W if W: EE 2535 QE .. ----- g ig Gi ff 2 :1 E252 gig gs? ii i if ' fe W: M U H :sw w'9'2Sfwl .W-we, :rim wifi ' w'wf::f:.,:.zfe5mm5Ff Nvfia Q5 ww 95 Sb K 'Y '3 6 wssy:'fHW?,W'W Www A :wwf ii -..- 2:-1: .....,.... Y M :f:sr.::::?2 H2:1-2:f:?Ea:::: .:::sa - E? 'Z25 IE-52.52-::.::::a:-rzf 22- 2: I ' . Q ' 2 2 ..,.,. if . . ,mm wszzsssigk Sszwzazzzziwszsgz fmssznamizf ,m:e::1:J2Mf55EEz3:22mW wwfw '22 wifM'f2'51'M:ziW Wff'Wf.,a: M Tf '?sf:w K- Ms:f?'fi fs5 I-I-2. in R' E:.E...:5fg: ---- f '-'- H If f ' as 223332gigggigiiim-gzgfzsgggggggiQggggmggiggiiigimsggggfz555ggHwgggieggggmggigzaksiivaxwigsigXiang 2 mzgaiiswggswgi -f isfeig :La sh 5.5 15. 2 55 -a : Y ? 1 'X Ei gg ,.., i s 3 ---- Si sgig fifiifsw e Si g n E' M ? Q Si Q5 Ei! Y 3 2355? fi Z?'2mw.f9f w Qgwfggg mi fi.-ZQEQQWHQWSW wlllslli' fa :i5ff5?5 i:. .: z-:1 :- H1 2 -:...E'252 LJ, ...... f E55 1? 142552255 M WF ---- - .. Ei ' Q h ,zsewi-? W'YPW'Hm W?ff5?13332S22mi1?'Vfgwiiismzw fi?5WEE:ia,Z W W ww fp W Qsffefxiw 2255? fifwiqlmfgqf '22 wf'i T'? 'WfW'iMf wwf xi Yiwl., 52f52.5f1fE5E f f'f -':ff'fr2r5rf. E ...:::gEQIEQE.: .... - --- - J Q ,-ggLg::g.::::gzg.::-E:5:-5:- 2-I -gg ::::-: - 12:2-: W .,., , , ---- I- ':.'a: M, fi 25,52 wigs-in ga ya lag wmv M :sm M Q gm mm Q gg, 5, :: : .-:.-. gi ::: :::: :5-j':r ' Q wigssgglggkii Egggggggsgiiggg '-5:3-':-3-::::-zz ---. . ::.'-r w sigma .-.-. :..E mg gg ,eixsgzf ggimwg 1525 g Wgsgm E, ,gzixemg me 5? 533 jess QQ gf wg, , 5 gs zx wig, WSW mm MSW Siffig alma?Mws2SS?:Egg'?SSl51Q35Qixiegsekizmgw :wikis P mwizfigibg wg-Jil G LG ffl 5 ----- 1 -:mm -a Q2 :ga I H5 iii? X ESQ E mp . M EM 5 1 ig Q2 39? A' as W W 21535 SM ' ig '35 QW 325 532236 2 ww Hs? ', i9 iM B iii 2? ,4 3 f. Q .QA iw ' 'Y' 5 W 'g wgig aw 1 ,mg xigpx Yi, igkgw wifi 22,511 iwkiwg 5 ' Qmgggd ig aim ZA iii :Sis ' A 5 kg 5 fl, , f 'fT1,, 3:3235 ,dwg Q g 3 QE fm M: 5 S if with Mfg 9 SEQ Mx W5 Q52 WE: 41' 5 4 Sw Y my qi is sm wig, qw, SRM A Xi E aw Q MQ Q, M vw 5 wx X Q wgggmis F gm si ag CW wg? QW WH 9 Q dw 3 1 'M 3252 5' 7 5 EQ, 1 5 Y 1 QE Q s ua gg 23 S KB ,gg W H S, Q 535 65 5 ff 5 Siam' mi S bmi 'S is is 'iw H 'YS + 2 W ,fb -1 V is . z, ff k Q 25062 22 ..... .... w5f3q?Si24 S H , H2 ... ..... 71 iw H H WfL'5fL QW , 35, Y, gf f ,i W 3 hunfggif 5522 ':f.::E: g:.. rE2. - S H g 43 aa Wwmg Wim ---- W MD 1 H W wg Tm il: 4 W Z ---- Q Evgyggg .. K igiiaggm 3 391135 8 . . zgigggisggkgigkgggg gg? M? . . Egg .,.. J. Q E . .... g.354,a,,H..L .. ...... . mg .,.,.,.. , ge if 4 F ,frm ar g E 5 A 5 as 5 2 Qi? S2351 as i s fy is i Q ' gg SQL X 53253, be mug? Q Wx: za: S8 if wa s Qmwgqg an gg 5.3 44 ,Y S 1 .W fi g 15 ,ginm Y :Sm 33 gs 3 s ,.,.,. , :.:e: - :::5: Q -: . 5 g m in 35 1 WEK A' 5 vi. pf? '1's211fT'?' i.,,. Aj? H gg 2 Eggs? 34 E535 ,f . 51 ii? ..., . ,.,. .. 355 .. Q ....Qw.,4' ,xg 55555 Ei? 4 5 iff' Sigh E3 34 we PL 5 + 35 QE 1 M Q35 ' 9 +A I S55 32 if QE, -af.-:eff-zz, :ref W as A 9 Q, H wisiiw 5 nf, 'f M, .: :E 'Eg -be- :rg M a E::.... f Q Zsw W wmv sf W ez Wa G G wfzgbiiesw MW-fwig ww Q 'af Q55 SWS 5 - R 3 Qigwiigggvmwgagawg Mass., 3 3232 mikwff A Q Wwwd E 5 225 2 W Q a g g ig w e gg EEE 253325232 ggi 5? a g gmgg .E.,E.E2I :' ill H J-+ Ei . F 1 F . f .1.1.1. , 1.11.1 9 QW E :-:xg-.:. ..:. 1 H . 5 2 f :g: 2 555222 - .... 'Rf M522 ...... :.:,.:,.. 4 gi ,I : .:.:..:.tE.:: 6 552.25 ., if: 4 ., , . ::' i . .,.,. :. 3 .3 Qeiggiw sgi Q ---- . 2 1 , ,,, W mga ag few, 2 PA Mm , EQEWFWSQWQEEQEMESE 55 :Q E 222 is E ,E 5 123.2 322 nga an f5S552iz?e if SEX Haig? is Q EEZ SE 4 555 gig? H5 5 :.. 5 E: 'Ex 15 iss: iam .: 1- :'- +16 :?g:.E:-gif! W5 162533 . ,I VH NZM aww, Q' Gaim ,, ,, :55j55jj '- - 'g:,::.::f' S0 'W -:::35:5: ------ 555555 : :H E me A .:.g. 1, 5.5: ,,,:, .... , 3 ,--,., : :::-:g:.f.-: V W ak 232 ::: fE EE'i::?5 3': :2 ??5f5ff E2, ffff1f5fi5 i:E:. 23fE1a2 -f-12:E2:EEi 5553EEE552555252,-:,..:E:' faihiiimigimspgyf N3 3?Q53ggz:s:QiS2i2??EE:' s2fSf:'?3iS?5EEEEE:?S?525?ii552555 saw fligaqisigibgimggiw W 1292?-EE? 2ff'55f5?55 E5: ::2: EE?-EE...:s ff-25'E2'EfE5555'55.EE'EE 51 355 iii .fiEE.fE.fE2.. . .... H M .. W .-..-.-.- .4 , , , , .W , ,, , 11.1. ... ..... . . .1.1.1. ,Z , 4 ,11 .1.1.1........1. , ...,,1. ...1.1 ,Q ......,.,.1 1.1.1 ..,.. .1.....,..1. .1,.1 -.......1.1.... , ........ . , , g , , 1..............,...1. .1.1.1.1,.. . ....,... . , .1.1... Q,gfiggf2Sp .,.1 ,. .,.., mwzaaazazg ,.,., Qg3gggQxgsggggg,,g.LgHg,2g, W E ....... z ..-.: ....... , .1..1. A w e ------- 55EisJg?gS222E22i3 w Sww'9 y 522.2151 fm: gags: ,423 i f-eg wesiszsssiiggzwgi 12: 11- 2253 525125-15252553 sf:f: :g fff1 :r f L age: 4 gms? E W 222. ww wggfwfszxah a y: - :g :fs: iw www BM -r a:-:a aa -'-' 1 :s:a:af a me fm 'iixzfmzi aid 3353993 high 2 M 32531 ---- N E2 :---::::.-:::g.-- :,:: g.:.: .-.-.- : wg? 5352 .:':.-:-: ----- M f -.-. : .- :gvf:,,:, ' Q -.,., gg g3g,,g? g.f -... .-....... Newegg-12? 2052 QQ P, Wm, 5.312 '?EZEmwS1af5e,4iw. wggiw -m. was Wiwwwg, sf .g.,.,. ...,. Hs.-:-: ----- - sw gs 24 Q -.-. ' :. w arg ?-gf 8 :- E25 ,,,,,,. , SE . .,.,: W 4 6 , .. ,,, , Q , Q, Q , , S Z, x ,,,, ,.,,. .,.,.,.,. , B, ,I 4 .,.., ,,,,:,,,,,,,,:,:,.,..,.,.:.,..:.:.....:. . ..... ,:,:, ., ..,,. . g5EgmgggQw,,1 552l3?Qggwgggiggfw-fggiggsmemgiisiiiiwgsgsgzmggdgg mgggggiggxfigl 1.3.3.-. BQ ,.,.,.,. : ,,.. QHB Q EQSSQQQSQEE S ..,.. was Q WEQW QW zafquagwggggiieigizgissaiwSiiiwssswggigmgggsgegizagm Vqggfeimiiligiii wseswsmggssggs .,.. : :a:a. wig-wxgiiewqie X'iQ'SgE2bf?E:?E2?2i5Se1 WME5Ig4izz0 EggQ:iz21,L223SES22?::mS2iSEzz2M2g2mV13Q5?3iiP2525:2SSQQSWSZ??fQff?Ei22iEEf52w3:.fg,w. 23 2332252 v2F5 ZS'1-SEEN Q Q :Q V fm af Qf:f::f:.::: ' 4 000000000 000000000 0 J 4 T5 Shore fo ' 5 ,:E5'A vm r ga.: Nl, If I M. 'U v 113 2 . W 34 1 IGCQ n s. 5' Q YI 'f' 91-l 1- 4, ,H -im fi' 5' L:-Aff. H52 'J 1 1 I . reetlgeem 1 fngrsvfvf. '1' ' ei? E595 . ,ww ' '- '- 12'-ifhffigfsgc ,-'..,1':nA:-.ffeg f . , 15 . 4. Q JJ . . Fi 00:50:14 .5 2 N V ,, J! ,J ' , , Ai. NF , , 5 Vr6'SsfeffiF.,.f 'g,.a,- 'WW' swq 4: 2 09 px .' F.'!S5:1525!ff.w'.-7 vfffwtff '..' S-T-'Z'.w:2v. - 59322. - 5 Q ' 9 1 f 'f' -W 4' 9 0 f ' x i 5 N ,fq.Ag,..,,'ggi4g:,Vf5w 1 gix 1- 1 . If :WIDE L X f . QC K - 'Ps 14572 51.15423 SW ,www , ' X ' ' 4 1 M5 A BY . , -3 ' 1. V ,annum .g..4 M-Ws QxRi,v,, n 1 Y W. gg. C ' --ni' 12:52-A-, ' Wfak 06-PQNXQ - w fiS'7Q'w- -i '-' 0 - il'vq '1 f2iZ45'6!r9iv.v . .2gSfQQQx:2::2:9mg.3 ,gotifwgfagg THQ:-1913 RC-Y - A -M--:M..gs-9:3155 55-mg-I-1-warm! TQ F' --- - 9, 1 A -yrs gwg- - I - . , Q 4.92. Qftgi pf' - S 3 7 Q 5 X sv 3'?0'K0' 'TMEIWEI S 4 'ffm lr? f. vs: 000 o X X, X -Aw 1 9 'ii5K'lff5W IE' A 'fs ff K f fl f fi W . Lan LD-fd gaixr ziig . 1 X X QB 'X X ' Ti la all Q E ' I V V0-4 X gm '5 '4 5 - , ,, sl x .I ll 1 f - ,JDM , wx V id QSM K ,Y Q .uf ' 44- Aw 0 62'i7'Y Q Q egg. l Fr U xf Ye ' X' 1 V5 bfi 'I 1 1 X 3 W N 5 K' lx ,z N: ,V X . 212 X E E! Q v f 41? I' Q .S 2 ' V 4-4f'4-Effazrgxg 'gg hi K4 'V-f5TuQf 3 N Q Q All - .4 '. . ..f A l. The oarloon Professor was crealed by Corey Bayless Srr Growalof' was creafed by lan' loyeday. 2. Dracula was drawn by Erneslo Calderon. 3 Asnour Youlcana drd lhe Nolan paper clrp project 41. Schools Open Drlye Carefully was a posfer done by Tobias Jenfzscn. 5. The expandlng square ls a Nolan asslgnmenf done by Andy Messcnaerf. 6. Fiona Grayson drew fne plclure of Mr. T. A459 3 K 'Q 'ff' -E3 X x..gy1,,.f1'-'f,A1?49 .V fl .T 1 V 1 , 1' Q C 5 Y J I M ox' T 6- - f Nu sv 1 E ' 7 Q. 1 . :..2f f . 4 ' 1' ,- ' f Ms . Wx A qi' fx Q N.: of -.,'1Qv A .XA .ii s in-N, If 4 - .i,,Qt'u' X X , 4. W A - '.,, -7 ff-T Q ..9 h X ii O I 'if '5 wwf? Q Ai- f-1 AT ' K iff , 1Y7'e2f' i of .. K .4 1. 'Jr' Lwuivj. --. xv, ' X xzfkm Y T e . X N 'g N fr' Ziiief V.. . f iff' ' lf V+- . r ., 1-4 :Eff ' all THQ 1- -. :Sis ff 14 .FQ Tr 3 33, ' .K 2 Ng -X Q i N '32 -211 ,-- Q X K 'T I T' fffff cf M91' ,,.! 18 ' Q 10 Dr QUDLEWQEC Wo DDA bs h in the facu lty lounge is 4, Eating a scnool lunc t teacher Robert Srnitn, art still nasn't beaten A Governrnen 24 Counselor Maralyn Stew lectures on SA T Rcnard Erler hu- tne . 3. Health teacher 1 rnan anatomy. A Teaching pan' time, Catherine Baggett ln- her three junlor English techniques 3, structs one of lor, contemplates a pr class, Wissman, sen 5, Dale calculus problem. Broin over brown by Geoff Sprinkle Dovis overcome much odversiTy To Topple rivol Downey by A135 poinTs ouT of 60,000 possible in The Acodemic De- coThIon. The Teom ploced firsT of 46 schools in The counTy ond wenT To The sToTe TournomenT oT Chopmon Col- lege in Oronge, Colifornio. Advisor Ken Adoir sold, llEoch Teom member con- TribuTed o greor deol To The Teom's vicTory, ond l'm very proud of Them. The Teom consisTed of '12 members, six of Them olTernoTes. There ore Three coTegories ThoT sTudenTs were ploced in. This depended on Their grode poinT overoge: Honors 3.75--4.00, ScholosTic 3.0-3.75, ond VorsiTy 3.0 ond below. Dovis come owoy wiTh 34 indivlduol owords wiTh Rondy STrouss plocing firsT W wif overoll in The ScholosTic division ond lvleri VVyoTT plocing firsT overoll in The VorsiTy division, l j'W7 H'2 xl V , W5 g df 4' M W if Vs J V 'rf 3. bi M ... 1 Look oT our school by Geoff Sprinkle AbouT every six veors, o high school needs To become dccrediTed. VVASC, or VllesTern AssocioTion of Schools ond Colleges, does This by evoluoTing oil ospecTs of The school. From This evolu- dTion, o Thorough reporT is compiled, conToining The posiTive os well os The negoTive ospecTs of Dovis, Through VVASC, we were dole To look oT our school from onoTher person's poinT of view. This self-exominoTion helps sToff members improve Dovis. Advisor Wil- liom lVlcI?iveTTe believed VVASC wos o A gizvz V good progrom vviTh good inTenTions. Tflfw 1. Nick Pefrulolcrs' brief cdse slfs idly by while od- vrsor Ken Addlf confers wlfh John Alford, Sfdnrs- ldus Counfy Schools superinfendenf 2 Sfudenf VVASC Commiffee members lviclc Pefrulolcis, Dove Thompson, Michelle LGWEGDCG, Lelgh Loeffler, Kofhy Vlfeolcley, Corie House vy- righf John Guerrrni, Eloine EZUQOEOWS, l-leofher Beoil, Poulo Corfer, Molly McCormrcl4 3. Lynne Monrioue fdlces The English portion of The Acodemic Decdfhlon A Academic Decofhlon fedm Meri Vlfydff, Kd ren Jensen, Jill Eddy, L ynne llflonrioue, Sfocy Elo- res, odvrsor Jdrin Jenlcrnson, Gdylond Eorsoerg, Por Gufhrie, .llm l-lowlclns, lvlclc Pefrulolfis, Deon Gollowdy, Rondo!! Sfrouss, ddvisor Ken Addir, Chris Ogden. 5, VVASC odyisor Bill lVlcQiyefTe folces flme To pose for The comero o, Ddvld Thompson prepdres his reporf during d WASC meefrng. 7 WASC sfudenf cholrmdn lvrclc Pefrulokis con- fers wifh Cone Housewrighf df o meefing DecoThlonfVlfASC 'I73 4 E151 id - X :sf it 2, 1. Catherine Baggett discusses the major points of a well written composition. 2, Frank Allen, i?aui Fitch, Tamm y Siaven, Jeff Mann, Danny Carvalho, Roger Pease, and Jeff Carr gather around Lynn Berry-Hudson. 3. Since money for readers was cut back, Bob Benjamin must read more compositions, 4. Gwen Larsen listens to a student perfor- mance of the play, The Brownsville Raid. 5. During library orien tation, Louise Aiberti had to show Paula f.!Dj Eaton and Dionn Martin how to Nil out a library card application. Kenneth Adair Government, Competitive Speech BA - CSU, Stanislaus enjoys tennis, riding motorcycles at GDHS 5 years Linda Beamer Student Body Office Secretary enjoys golfing. horseback riding at GDHS 5 years fi Patricia Beauchesne Office Secretary enjoys sewing, reading at GDHS ll years 15 5 Louise Alberti English BA - San Francisco State, UC Berkeley, University of Hawaii enjoys many varied activities at GDHS 16 year Bob English BA, MA - MJC CSU, San Jose enjoys listening i music of the 50' and 6O's, readin traveling at GDHS 20 yec ' ..,A Edfherine laggeti nglish A, MA - lowa tate, Drake niversity njoys traveling, amping, ocializing, ttending the wakespearian estival t GDHS 19 years. ' 21' ,,:...... Nancy Barr English BA - Whltworth College, UC Davis, CSU, Stanislaus enjoys reading, sewing, jogging. cooking at GDHS 8 years ri.. W' i T I . ? , 'W 45'- J 1 1 f regon golfing, ys, and Odd David Bllckenstaff Color And Design Ceramics Metal Industrial Elements BA, MA - C U, Fresno, Cal Poly enjoys handball, fishing, hunting, gardening, Dan Boer Adapted PE Cross Country Sophomore Basketball BA - UOP, CSU, Stanislaus enjoys golfing, fishing, and more golfing and GDHS 40 years backpacking at GDHS 'IO years at GDHS 3 years Class sizes up: students desire more English by john Guerrini English department succeeded in overcoming many problems while it also managed to keep classes func- tioning. The major difference for teachers was handling much larger classes than in previous years. Gwen Larsen, chair- person of English department, said that an average class should be centered around 20 students, but classes were at an average of 33-35 students. English enrollment was up, and Mrs, Larsen felt that the increase was due to more and more students realizing the need for English courses. Students were required to do a specified number of writing assign- ments to pass courses. English depart- ment provided challenging courses. The American Studies Program pre- pared students for writing and litera- ture at the college level. Seniors wel- comed a new course called GATE Senior Grammar, which was taught by Nancy Barr. lvirs. Larsen also had a busy year. She had to manage a large budget, co- ordinate all the English courses, and act as a liason between department members and other school employees and parents. She also represented the Davis English department at district meetings. .. --- . is 5 English 475 Math functions: summing it up by Geoff Sprinkle Many departments added an array of GATE classes, and math depart- ment was no exception. Three GATE math classes were offered: Algebra, Geometry, and Advanced Algebra. Math recruited veterans to play new positions. Government teacher Robert Smith and Spanish instructor Rena Niet- mann taught general math classes, along with John Cosner, who was hired in mid-October. Sammy Jenkins, math chairperson, was optimistic about the new classes and teachers. She felt that now the math department was capable of offering math classes that met the needs of most students. ' sssss i if 2 , ' tt,' W E Johanna Carvalho Cafeteria Staff enjoys reading and gardening at GDHS 7 years 476 Math Brent Bohlender Earth Science, Biology, Water Polo, Swimming BA - Stanislaus y State l enjoys that is at GDHS 5 years mmm-M, Phillip Bravard English BS - Minot State, North Dakota enjoys cooking, gardening, woodworking at GDHS 20 years Elaine Chadwick- McKee English BA - Whitworth College enjoys racquetball, movies, motorcycle riding, dog shows, traveling, water skiing, and spectator sports, especially football at GDHS 16 years Kenneth Brink Dean of BA - Quincy College, MA - San Francisco State enjoys dining, going to plays in San Francisco, Dixieland Jazz, professional football games, swimming, golf, tennis, and sharir his life with his family and friend Wendell Chun Counselor BA - Chico State, MA - Stanislaus State enjoys water skiing, camping, coaching youth soccer and baseball at GDHS 10 year Mary Borst Attendance Clerk enjoys sports, especially softball and soccer: and crafts at GDHS 3 years fs CQ f A .rs A N is 3 ms as 5, M Qs Rh Bs is Qs Sir! PQAQNQQ MCMBQ Q1 52, il sg fs P151 gow orl Bryhnl eginning and ltermediate lance, Dance roduction A - Stanislaus tate rnjoys dancing, wovies, traveling, and water skiing it GDHS 7 years 'atrlcla Crllasl tafeteria Staff njoys football ames, watching Blevision, reading t GDHS 3 years Arlene Campbell Typist Clerk enjoys sewing, crafts, church youth group at GDHS 2 years Don Curry Assistant Principal BA, MA - North Texas State University enjoys music, backpacking, traveling, investing at GDHS 8 years 1, Aaron Graham and Dan Starck joke around ln math while Paul Podesta listens carefully, 2. Sammy Jenkins expalns vector addltlon to one of her pre-calculus classes. 3, Chemistry assignments always keep students busy as is shown by John DeNino and Chrls S tal. 4. l?obert Stuart responds to a students ques- tion about a lab assignment. Changes occur by Lynne Manrlque Several changes occurred in sci- ence department according to Rob- ert Stuart, chairperson. GATE Biology was added to the roster of science courses. Taught by Fred Manke, this class was designed as an accelerated course for those sophomores who had taken GATE Earth Science in their freshman year. Other changes includ- ed the addition of two teachers: Rog- er Dickson taught Biology, and Sue Sweetman taught a science-health competency course. Both were also instructors in Agriculture Department. Mr. Stuart expected more changes in the department following the imposi- tion of stricter high school graduation requirements which call for two years of science instead of one for all stu- dents. Seemingly in anticipation of the new requirements, enrollment was up in all science courses, added Mr. Stu- art. He attributed this increase of inter- est in science classes to what he called a generally more serious atti- tude toward school on the students' part. Beverly Dahlgren Assistant Principal BA, MA - Chico State enjoys traveling. reading, collecting model clipper ships, camping, people watching at GDHS 24 years Q M...-vvrt' ' 7 Wiflrarn Thompson, along with the other U S Histo- ry teachers, faagnf about the Cryi! War 2 Yvonne Tay!or's freshman Woria Cuftures class learned about mass media 3. Besides nfs government ciass, Robert Smrfn aiso taught two matn classes -4 Displaying their eagerness fo be pnofograpnea was inrs 57h period government crass Michael Deffley Custodian enjoys listening and playing music at GDHS O years Bruce Emerson Basic Math, Geometry AA, BA - CSU, San Francisco enjoys scuba diving, camping and most sports at GDHS for 6 years , rfWr,Ws, I' 'f r:srff,r A' Richard DeWoII Basic Math, Algebra 21. Geometry 23, Advanced Algebra 25 BA and MA - UC Berkeley, CSU, San Francisco, Reed College, Oregon enyoys backpacking. saiiing, cyciing and working with Boy Scouts at C-DHS 211 years Richard Erler Health Science, PE, Coaching BA - CSU. San Jose enyoys racquetbaii. tennis and bicycle riding at GDHS for 20 years , iisrsi iisrrsi ,M ,,.. , ,,,,,, ,i,,f,,r,,, ,.,, , ,s,w,4, , ,,i ,MW ,,, ,,,,, ,, I , ,, , Z --,,' 14, .. I ,151-, . I. 'W 4 Roger Dickson Biology, Agriculture AS, BS - CSU, Fresno enjoys grading homework at C-DHS 8 years Bernice Finley PE BA f- CSU, Humboldt at GDHS for 17 years Rlchard Doll Consumer Law, On your Own, Advanced Typing BS - CSU, San Francisco enjoys playing golf, classical music at GDHS 18 years Rlchard Flnn Industrial Education, Woodshop BA - Montclair State College, N J enjoys woodworking, building large scale live steam locomotives, flying qtlight instructorj d OD YTNUSIC at GDHS for 2 years Cynthia Free Campus Supervisor enjoys traveling, dance. photography at G-DHS 3 years Dorothy Gallo Cafeteria enjoys golfing at GDHS for 8 years L. , , ..... . K 3 5 ' , -M 1 X s Y s X x -Q ts 8 :- Qi' ff X . Q? X15X.. sa ' Si '-: f C. . ,,.. .L , .. ti 'tit ,MQ it W 'U .W A at tr tit, W .wi X MM i .war Diploma rules could upset Social Studies courses by Debbie Maxwell As l sat and interviewed Social Science chairperson Robert Smith, I began to get a good idea of what kind of person he is: an enthusiastic teacher with high hopes for his stu- dents. Having been department chairperson for eight years already, Mr. Smith said that there haven't been many changes in that time. One major change, however, that goes into effect next year, is the requirement to take an extra sci- ence course in the freshman year. World Cultures would be moved to X Y iii: ii r 'f x 'iQtiit,,:jla fs: ti? Donls France PE, Driver Ed, Career Decisions BA - CSU, Chico enjoys tennis, camping, traveling at GDHS for 11 years Erlka Glbbs Cafeteria enjoys baking, music at GDHS for 3 years the sophomore level. Since this year's freshmen had already taken World Cultures, it would appear there would be no World Cultures courses next year. This meant that some teachers would get reas- signed to other classes. The Social Science department was also in dire need of new textbooks. Some are 30 years old, but, due to cutbacks, teachers were unable to purchase new books. Despite these setbacks, Mr. Smith felt that Davis has a superi- or Social Studies department and teaching program. Social Science 179 M9 l Y K W I 3 M, , ls, 1A Sv 24 180 ArT Toleni shows in ori deporlmeni by Michelle Ocken Arr classes include Color and Design, School Display, Drawing and Painring, Jewelry and Enameling, Learher ond Fabrics, and Ceramics. Airhough The deparTrnenT's financial siTuoTion wasn'T very good, HenrieTTa Sporkman, chairperson, Thoughr Davis had o superior arT curriculum. I Think iT CThe deparTmenTj has more varleTy, and our Teachers reolly do a grear job. ModesTo Junior College Told us ThaT our sTudenTs come To Them very well prepared, remarked Mrs. Sporkrnon. AfTer The reTiremenT of Glenna An- derson, iT was necessary To find o Teacher To replace her. David Blicken- sTaff, indusrrial educaTion Teacher, ToughT Color and Design and Ceram- ics. ln Mrs. Sparkrnan's opinion, The mosT imporTanT aspecT of The deparTrnenT was 'iThe unify of our deparTr'nenT and how well our Teachers worked TogeTh- er as a Team To make people more aware. Bev Gilmore Biology, Earih Science BA - CSU, San Jose, STanislaus enjoys Traveling, gardening, sailing aT GDHS 11 years Gary Giovannoni World CulTures BA - UOP enjoys flying, skiing, boaTlng aT GDHS 21 Sally Grayson Cafeteria enjoys kniTTing, crocheTing aT GDHS A years Margaref Hodge Healfh, PE, Volleyball, Diving BS - Idaho U, MA - Illinois U enjoys NaTionaI Ski PaTrol, sailing, reading, Traveling aT G-DHS 17 years Gary Green Custodian enjoys music, phoTography aT G-DHS 1 year Gertrude Hog Yearbook, Newspaper, English BA - MJC, CSL Fresno enjoys friends, church acTivlTie: horse shows aT GDHS 11 yec hella 'OFISGIVQS :hool Display, 'awing and Jinting, Color td Design X - Ball State U uncle, ind., Calif. 'ts 81 Crafts 1 erkeley ijoys painting, etching, theater Jing, playing uno, creating afts, attending otball games id wrestling Jtches GDHS 13 years Dan Gonsalves PE BA, MA - CSU. San Jose, and Stanford enjoys activities with friends, entertaining friends at GDHS 23 years W' Students use languages by Khris Epperson Foreign Language Department has undergone many changes. After the retirement of Betty Sacknitz, Rena Nietmann took over as department chairperson. David Rancano, from Mo- desto High School, filled in for Spanish teacher Dorothy Lacoste during her leave of absence. Mr. Rancano taught five periods of Spanish. Another addi- tion to the staff was Jenise Javaher. Mrs. Javaher, who would have normal- ly taught freshman World Cultures, taught three periods of French. Miss Nietmann felt Davis had a supe- rior department. Not only because of the successful years in the past, but because of the many students em- ployed at jobs in which they use a lan- guage learned while in high school. Lncy Green ist Clerk ioys reading, edlepoinf, lecting seashells C-DHS 5 years rry Houser reer Decisions, ach - Soph. otball, Frosh ,ketball - CSU, Fresno ys sporting nts, movies. Q out to er DHS 10 years Mark Harmon Custodian enjoys sports. traveling at GDHS 2 years 4. Henrietta Sparkman instructs Cindy Hodge on the basics of Notan, an oriental study of design. 2. Andy Messchaert, Kenny Morgan, and Dean- ette Rocha study a model to be drawn in pen and ink. 3. Students John Vanlier, Kris imteld, Brett Clark, Dave Leonetti, James Swicegooal and Chris Hampton attend to their various activities in Coi- or and Design. 4. These co vers give foreign language students a preview of what's in store for them. 5. David Rancano spends many hours preparing for his classes. Foreign Language 181 182 Home Economics Life styles demonstrated by Sharon Graham What's new in Home Economics? Ex- cept for some new textbooks, not much according to Myrna Westmore- land, department chairperson. One of the problems faced was that students did not have enough time to take more elective classes, but surprisingly, enrollment was up, Home economics classes presented the most up-to-date use of modern equipment and provided students with an idea of ordinary life style. Mrs. Westmoreland commented, Students were outstanding and en- joyable to work with. lt was a great pleasure teaching them. ss, i , llil x ' M. ,ie i Ralph Irvlng Ag, Welding, Metal AA, BA, MA - Chico State, San Jose State enjoys farm work, teaching, backpacking at G-DHS 20 years Judy Jessle Custodian enjoys camping at GDHS 5 years Robert Jackson Government BA, MA - University of Denver, Iowa University enjoys photography, racquetball, motorcycle riding at GDHS 12 years Beverly Johnson Applied Science BA - CSU, Fresno, UOP, CSU, Stanislaus enjoys making quilts, camping, traveling at GDHS 16 years Harold Hubb Career Center ROP. l it ,i ull limi l lily l W il i Wk li l ii i llwl il its 1 lil: , V V , li i will will it X iijl X Wi ki Xl iivl -, l jly Jenlse Jo French, World Cultures BA, MA - University of Redlands, CSU Long Beach enjoys tennis, traveling at G-DHS 7 yec Health Footb AA, BA - MJ Stanislaus Stat enjoys garden , ' ' i e Larry Johnso , CJ C 6 work swirhmin coaching Bas lan Hudson Cafeteria enjoys travel, golf, grandchildren TG-DHS ll years Wi El ff lammy Jenklns lathematics A - CSU, San ose injoys reading, owing it GDHS 20 years ienu Jones iustodian njoys traveling, amping t G-DHS 8 years Jann Jenklnson American Studies, English BA - CSU, Stanislaus enjoys going to movies, playing the piano, playing Tennis at GDHS 6 years 1'5 Patrlcla Jennings Secretary enjoys traveling, recreation in mountains at GDHS 8 years Tom Weber Graphic Arts AA, BA - USF, CSU, Chico, UC, Berkeley enjoys golf, fishing, bowling at GDHS 1 year ,wp fsls, 1 ij ii 5' A X M ss 1 'ff vfz 154 hifi-, if Health is way to happiness by Renee Dixon Stay healthy and physically fit to be happy, campaigned health teacher Richard Erler. Health class enrollments were very high and at times as many as 80 stu- dents were in one class. Sixty new health text books were unable to be used because there weren't enough to go around. Mr, Erler's and Larry Johnsons main objective was to teach the students to the best of their abilities and to make it interesting. Mr. Erler and Mr. Johnson teach their students informa- tion which will help them now as well as later in life. Health is both educational and fun. Many of the students commented that they've never learned as much in a class as they did in health, 1, Myrna Westmoreland smiles for the camera. 2, Mike DeClcco listens arlenrlvely fo directions, 3, Jim Cagle pays close cffenfion. 4, Larry Johnson with Richard Erler and friend pose for the camera, lie Health 183 Industrial Ed promises opportunity 4, 2v Advancing further into The Techni- cal world of many opporTunities was drafting instructor Ted lVleyer's re- sponse when asked To comment about Industrial Education. Basic background for technical areas of work was what Industrial Edu- caTion's main objective was. The de- partment received a new graphic arts Teacher, Tom Weber. lvlr. Weber Taught aT Live Oak High School in Mor- gan Hill, California, before coming To Davis High. Enrollment was down This year as compared to previous years, 'iand iT's a shame To let good Talent go To wasTe, Mr. Meyer said. We, as a department, are hoping for better enrollment in These next years so we may learn as well as The sTudenTs, Mr. Meyer commented. MII . f:ttZv,rQif:'lzz'ri1 .1,fi.xii':WiYi?r?:Wss2SisLi,ii, 1 2 r',igews,swQfff7,1 Don Lanphear Physical Educatior BA - CSU, San Francisco aT G-DHS M years MQW V ' r-' , 'Z is , in 5 2 0 gpgilr , , Q Ad 184 Industrial Ed Larry McDonald Algebra, Geometry, Advanced Algebra BS - South Dakota State, Black Hill State, Nevada University, Portland State, CSU, San Jose, UOP enjoys boating, hunting, snow skiing, handball, pistol shooting at GDHS 48 years larry Loltnor Basic Math, Algebra, Advanced Algebra BA - Port Hays State, CSU, San Diego and Stanislaus enjoys reading, gardening, sports at GDHS 19 years Wllllam McRIvofIe Govemrnent, World Cuttures, Assistant to the Principal BA. MA - CSU, Sacramento, Chapman Colege, University of Alaska, Cal Poly enjoys goiling, reading at GDHS 7 years Sr, , is Vernlta l Snack Bar Attendant enjoys listening music, reading, camping at GDHS 22 yec Gary Meegar Concert Band, Pep Band, Marching Band AAS, BA - Syracuse University, Temp: University, CSU, Hayward enjoys reading, traveling at GDHS 'I year 'iwen Larsen inglish lA - csu. s and San reading, skiing, GDI-lS years ssisss Lomax Electricity, BA MA - College, Chico, UC, tennis, traveling '12 years ICC! renda source Studies - CSU, San nncisco joys reading, nrdening GDHS 2 years Marie Lawson Instructional Aide in Special Education enjoys going to basketball and football games at GDHS 3 years Fred Monks BiOl0Qv BS, MA - CSU, Fresno and San Jose, UC, Davis, UC, Santa Barbara enjoys dinner and dancing, racquetball, staying home and listening to good music at GDHS 17 years Theodore Mayor Drafting, Wood AB, MA - Northern Colorado University, Colorado, university. Colorado A 8m M, Arizona University, UC, Berkeley, CSU, San Francisco enjoys istenhg to lassical ' and c music opera, traveling, reading at GDHS 24 years AA v5 A6 itil!!! Students beneltt from ag Agriculture classes range from wild- life and forestry to welding. Roger Dickson, department head, said the main objective was to place students in a job situation. Besides having stu- dents work in the classroom, they also did much work in the shop, green- houses, and on the farm. The other in- structors were Ralph lrving and Sue Sweetman. How do college bound and voca- tional students benefit from the agri- culture program? Mr. Dickson said that students develop many useful quali- ties, the main one being the develop- ment of leadership. Agriculture is unique in a sense when compared to other school depart- ments. There was no problem with money. The problem they faced was students who had to take many re- quired courses and therefore found they didn't have time to take some of the elective courses offered. 1, Drafting instructor, Ted Meyer, keeps on top of things. 2. Whr7e enrolled in Drafting, Donnie Rowan can fulHll his practical arts and Hne arts graduation requirements. 3. Sue Sweetman explains the fundamentals of plant growth to Steve Bettencourt. 4. Roger Dickson discusses some aspects of ag- riculture. 5. Students, Sutton Price and an ROP student from Downey, analyze a garden layout. 6. Brian Stiles gains work experience while weld- ing. Agriculture 185 486 Music 4 4 51555439 l 2 ..- r Working hard to catch UD by Laura Gundlach The Davis High marching band got a late start as band director Gary Meegan was hired only a week be- fore school began. But that's okay, said Mr. Meegan. This is go- ing to be the best band Davis High has ever had! Davis Band really had to work to catch up with their rivals Beyer and Modesto High who by the beginning of school had al- ready put in 80-400 hours of prac- tice. I know we can't beat them this year, but maybe we can scare them a little, said Wendy Johns. The determination of wanting to be 4001, better can really be seen in evening rehearsals where they spent two-and-a-half hours of marching and playing every Tues- day and Thursday evening. Many band members appreciated the work and discipline Mr. Meegan made them go through. He's alittle crazy, but he wants a good band, and he's willing to work, so we are too, commented Shauna Thurman. Besides the changes in a new direc- tor and band staff, the band mem- bers were also wearing new uni- forms. The old ones looked dingy under the lights, said Mr. Meegan. They were also playing a different style of music. This is the beginning of a new tradition for the Grace Da- vis High Marching Band, said Mr. Meegan, and the 4983 marching band members are going to start itl 1. Gary Meegan conducts the band. 2. Drummers are waitrng to perform. 3. Glenna Mori answers a students question. 4. Studen fs warm-up. gui? IS'-'59- ' Q. yr ekisfn 't- 9 fx. .: .. K - 'f' 4 Ronald Nelson Special Education BA, MA - CSU Humbolt and San Francisco enjoys music and movies at GDHS 48 years Kenneth Oxley Custodian enjoys cooking. swimming and watching General Hospital at GDHS A years HOHODSQ Nichols Cafeteria enjoys square- dancing and camping at GDHS 5 years Charlotte Peck Algebra ll, GATE Algebra. Advanced Algebra. Computer Literacy BA, BS, MA, MS - CSU, San Jose anc Hayward, UC, Berkeley, UOP enjoys reading, Bridge, theater. opera, symphony. and travel at GDHS 7 years ff .39 1 .,,, f , ,. ,, 1,1 fi Lois Line Nurse RN, AB - Akron Universify, Ohio, CSU, STanislaus enjoys golf and Traveling aT GDHS 7 years j j , . ivi Zzgj f Rena-Grace Nletmann Spanish, General Mafh BA, MA - UC, Davis, UOP enjoys playing golf, singing, sewing af GDHS 22 years Darlene Peterson Cafeferia enjoys fraveling af GDHS A years 31 1 9' X , .M 4 , 1 1 2 Glenna Mori Shorthand, Clerical Office Procedures. Typing, Computer Literacy BS - Oregon State University enjoys enferfaining family and friends af home, hiking camping, Traveling, going ouf fo dinner ond To The movies af GDHS 13 years rggrrhcigyr Business pupils enjoys reading Time wiTh fr' develop skills Y aT GDHS 5 years Jerry North Aufo Mechanics BA, MA - CSU, Fresno aT GDHS 7 years George Peterson Counselor AB - CSU, Chico and Sfanislaus, UOP enjoys ballroom dancing, singing, golfing af GDHS 20 years John Ollls Cusfodian enjoys sporfs aT GDHS 2 years arf 'i by Erin Barry A Teacher aT Davis since 4974, Glenna Mori Teaches Typing, shorThand, clerical office proce- dures, and computer liTeracy. Before coming To Da- vis Mrs. Mori subsTiTuTed, Taughf nighf school aT Mo- desfo Junior College, and Two years aT Downey High while rearing her Two children. She became involved in business Through a Teacher in high school who encouraged her and because The subjecT came easily To her. Commenfing abouT whaf she likes besf abouT Teaching, she said, The aTmo- sphere and associafion wiTh The sTaff and sTudenTs. When asked if There was anyThing ThaT she'd raTher be doing besides Teaching she replied, l enjoy iT very much here and can'T Think of anyplace else l'd raTher be. A r , , ,f,, , 5, , ,if 241.1 22 Meri M ' r cf -' , - ffr ,r - , as 33 pe ril Kel, ., s m , 7 'L 7 wifi., :...,. dn-,m,,.,,.Im,,,z,11',r,, . ,v iggf ,ri -'M:,1jn:, 'f 1 s f f,iv'f' u. .5gQ5irW', , ,, if W- - ir - -, -1, - . -- 'sf,,,g3gi,s,, ,, ,,f, 1':4::,+:l,:f,- J , T , ,mf 1 2 A ,rfsA:r.f,' , af f ' ,,,, - Y, 'f ' fiikfsiwgfs M , 1 , I ,g,, Z 3 ? , , ,,.,. -,, 1 ' , , -- ,V ,, ,W .W-111 ...V ff --41wr,:.1.,.y,,f-11 1 . . 1 111114., .,1111,11 . 3 W 1 T ,Wigs 'V 'X sf , ff,fm1,. I fy. ', 'z1z141f f , 5 if ,off s ff ,,1 1 1 11 W, 'X 1 1 M ,717 Z1 W 11W,,1,f, 0 ' 4 ,. ---- ,M ,. 43 v A Business 187 James Piper Custodian enjoys fishing, Camping at GDHS 17 years 1A 2v Dorlta Roblnson English BA - CSU, Stanislaus, UOP enjoys reading. cycling, backpacking, movies, photography at GDHS 15 years Dlck Ralph US History BA, MA - CSU, San Jose, Stanford enjoys reading, traveling, Qolfing at GDHS 23 years Jean Roland Learning Handicapped 9-12 MA, PPS - UC, Davis, NAU, CSU, Sacramento, Stanislaus, and San Diego enjoys golfing, bridge, tennis, bicycling, swimming, and caring for her three daughters at GDHS 3 years Davld Spanish Language Program at Habana University, Kansa University, Arizon University enjoys planting vegetable gardens at GDHS 1 year Jacqueline Romano Custodian enjoys collecting antiques at G-DHS 2 years lobert laingruber Xlgebra, Beometry lA - UC, lerkeley, Jostgraduate at ISU, Hayward and ltanislaus enjoys movies, ports it GDHS 16 years ln.. arthd ldgeway afeteria Aanager enjoys music, eaching Sunday lchool, going to he mountains ut GDHS M years CfQOYQf Rose erman, English lA - UOP ianjoys sailing. wimming, raveling, nicycling, hiking. stening to erman music t GDHS 20 years Z Bobby Roberts Theatre, English BA, MA - CSU, Fresno enjoys theatre productions, golfing, reading, gardening at G-DHS ld years Robert Ruehle Physics, Chemistry BS - Delaware University, UC, Davis enjoys weight lifting at GDHS 16 years 1. The werght room rs used regularly by stu- dents enrolled in PE 2 Calistrierilcs are an important part of warming up. 3. Weight lifting was an available choice in elective PE 11. Department charrpersori Darryl Torre is sho wri taking a break from supervising his PE class 5 Basketball was one of elective PE's most popular choices. PE keeps movin' by Katie Harmon Physical education underwent several changes during 4983 and 49841. PE de- partment cut its program from roughly 410 periods to about 37 periods. Roller skat- ing and racquetball classes were com- pletely cancelled, leaving only the more traditional sports. Football coach Nick Chipponeri, left for Downey High School in February. In the fall he taught PE at Davis until lunch time and then traveled to Downey for the last two periods. The problem that occurred most was the overcrowding of classes. Classes sometimes had as many as 50 students. Darryl Torre, chairperson, stated, The main objective of the PE classes was to give students recreational activity com- bined with a mental release. i Richard Salter Counselor BA - CSU, Stanislaus, Advanced work at UC, Santa Cruz enjoys golfing, working on old cars at GDHS 20 years Physical Education 189 and 4, sq.. ,, we' 14 24 Sv Robert Smith General Matn. Government 2 , .M ,.. .. , ,A , img: ,.3Q.A.- 5 If ,kxtvai it sg if 44? 1mA . hrs, sismi l. Tom Nipper enjoys his studies in the library. 2. lmogene Engebrefsen takes a moment to flash a smile. 3. Candice Catorino and Christie Earle enjoy the library patio furniture. 4. Agnes Schoonover. Imogene Engebrefsen, and Sharon Fujii demon- strate correct library procedure. Rlchard Stafford ResourcejLearning Handicapped BA - Chapman College enjoys golf. traveling at GDHS A years Wllllam Thompson US History. World Cultures BA, MA - UOP enjoys golfing. traveling, reading. gardening at GDHS 14 years Barbara Steele Counselor BS. MA - UC Berkeley. CSU. San Francisco. CSU. Stanislaus enjoys sailboating, snow skiing. golfing. UC football games at GDHS 21 years Leota Toal Career Center Assistant BS, MS 4 University of Oregon enjoys tennis. backpacking. racquetball. symphonies, lignt opera plays. reading, building at G-DHS 19 years .iQ 11 Maralyn Stewart Counselor AA. BA, MA - Hartnell JC, CSU. San Jose, CSU. Stanislaus enjoys attending plays, reading. traveling. entertaining friends at GDHS A years Darryl Torre PE, Drivers Education BA, MA - CSU, Fresno. Cal Poly enjoys fishing at GDHS 20 yea enrietta parkman olor and Design, ewelry and tameling, aather and Jbrics, Special 'udies A, BA - CSU esno, University f Kentucky tjoys boating, cycling, art work tGDHS 11 years - X .Q 1 t ,sf L. fi J A-f Ergstry ,...,- ii: s X ' f n smart Susan MA Y New vm Sweetman e University. Harvard. Agncunure Lcuse University. CSU, i Francisco ys being a church eling, attending San isco Operas. sto Symphony. festivals 8: shops, being active Lodge work DHS 20 years iry Trimble 'OUYCS SYUGGS MA eds - Michigan e, UOP ys golfing, traveling, S 4 years BS, AS - Cal Poly enjoys spending time with hubby at GDHS A years Tlm Tweedle Principal BA, MA, ED. D - CSU, San Francisco, University of San Francisco enjoys tennis, fishing, family activities at G-DHS 2 years is S 1 Yvonne Taylor World Cultures BA - CSU, San Jose enjoys family activities, sewing. gardening, camping, reading at GDHS 12 years Helen Valk FoodsfNutrition, Parenting, Child Development, Clothing BA - CSU, Fresno and San Jose enjoys traveling in a motor home, fishing, hiking, stained glass, reading, cooking at GDHS 19 years New faces in familiar places by Elaine Tzagarakis One of the many new faces was Mrs. Imogene Enge- bretsen, librarian. Mrs. Engebretsen went to the University of California, Riverside, and the University of California, Los Angeles. She earned a Bachelor's of Political Science at UCR and a Master's in Library Science at UCLA. Mrs. Engebretsen has been a librarian for 13 years and said she thoroughly enjoys her job. She has worked in the reference department at the University of California, Da- vis for three years and at Roosevelt Junior High School for 10 years. Davis is an exciting challenge, I have enjoyed seeing all the students I knew at Roosevelt mature and develop, she remarked. She finds the students friendly, inquisitive, and well behaved. Several changes were made in the library. Patio furni- ture was bought with Student Body funds, books were bought for remedial reading students, and the bookroom system was changed. Mrs. Engebretsen would also like to develop a large fiction section and to set up two com- puters for faculty and student use. lf I receive funding, I will purchase programs and printers. Library 191 Dedication is key to student by Khris Epperson wseg -.sswsxsf - SWAC koi se .v.. W. George Peterson, head counselor, felt the coun- seling staff was outstanding. Counselors were George Peterson, Maralyn Stewart, Barbara Steele, Wendell Chun and Dick Salter. Because of the lack of funds, counselors were unable to hire any extra help. Therefore, counselors often became overworked and Bill Honig, state su- perintendent of schools, was concerned about this. Mr. Honig felt that counselors would be too over- loaded with work to aid students who might need counseling. Not only do counselors advise students on school, but they also advise them on personal matters. When asked about the responsibility of being a counselor, Mr. Peterson felt that counseling, at times, is indeed very difficult, but it also has some satisfying and fulfilling moments, he commented. A1 v3 wi. . ..s. K W ssgggsS . ...V we as A is . ..lu ,,.., W , s Z I si W yogi f x 1 in 7 ,,, 1 fwgf i. ,.' w M Q. lm --if W ---f ,,.. , .. ' x K ' fair J 1' . , .fn vain- iii , Frank Vandervort Computer Science BA - CSU, Chico enjoys raising Cattle at GDHS 15 years Janice Wallclc Cafeteria enjoys golfing, walking at GDHS 7 years ef-'WED V. i 4. Head counselor George Peterson looks over the informational packet given to freshmen at the beginning of the year. 2. ln addition to his counseling duties, Wendell Chun is Key Club advisor. 3. Assistant Principal Beverly Dahlgren spends much time updating her Hles. 4. Counselor Maralyn Stewart and Campus Su- pervisor Cynthia Free are caught hamming it up, 5. Counselor Dick Salter's duties include parent contacts, programming changes, and enforcing school policies, My . .aft Herbert Weavlll US History BA - CSU, San Jose and Stanislaus enjoys riding trains at GDHS 17 years Stanley Wolden Math, School Service, Career Center, Work Experience University of North Dakota enjoys racquetball, golf at GDHS 21 years Tom Weber Graphic Arts AA, BA - CSU, San Francisco, UC Berkeley, CSU, Chico enjoys golf, photography, design logos, fishing at GDHS 1 year Marcla Wright Principal's Secretary enjoys water skiing, walking, working with plants, gardening at GDHS 5 years '91 17 U is 14 4 'affa- Myma Westmoreland On Your Own, Morric And Family, Creative Living BA - CSU, Socrame enjoys going out to dinner, shopping, pla cards, being with he husband, Ray at GDHS 16 years Marlon Zoodsma English BA, MA - Dakota Wesleyan University, University of Denver 9niOvS DICYVWQ bfi'-194 traveling, reading at GDHS 21 years Nancy Vlatllng Orchestra, Fine Arts. English BA, MA - Drury htty Ward College, Mo., CSU, 5f QliSh Stanislaus, Denver BSE - Arkansas State, University, University of CSU, Stanislaus, UC, Illinois, Texas Christian BSWGIGY university enjoys reading, cooking, enjoys performing in the gardening, traveling to WIS fT1OUf11Glf1S at GDHS 17 years Dwayne Wostphal Business Orientation, TYDir1Q, Freshman Football, Girls' Varsity Basketball BA - CSU, Fresno enjoys golf, tennis, reading, swimming at GDHS 9 years Modesto Symphony. sailing, traveling, reading at GDHS 16 years Merlin Vlhlflord Accounting. Typing. Machine Calculations, Record keeping AA, BS - CSU, Fresno enjoys riding and training horses: collecting clocks and repairing them at GDHS 12 years Q f . 21 'zz .21 ,5 VV?m,,,W V, , 'W . WJQWV 2 . ,f i f ' 'Hai - Q ,,,, ,, t ' RA ' N ,Q 1 'V ,V n if , Wm F ,fd , A ,sw ,, V. Q' mg' 1 is ,' t, M'-st, fin lr ,. , , S ,s 1 i Md P f . iv! , , ,lm f nl I Y W 'Dummy Counselors 493 So maybe This wasn'T The firsT page you Turned To. So maybe you don'T like The picTures. I really don'T lVly favoriTes, or The one ThaT goi away Very seldom do I geT The chance To express myself wiTh words raTher Than wiTh picTures. Now, given The chance, I would like To relaTe a few graTiTudes ThaT have piled up over The pasT year. I believe iT is safe To say ThaT you would noT have purchased This book if you Thoughf ThaT There would be no picTures in iT, Basically. ThaT is The general idea behind yearbook journalism. WiTh This in mind, allow me To inTroduce a few key people responsible for The phoTographs found beTween These covers. Seniors Randy Bakker and Lisa Dunker played viTal roles in The producTlon of This book. ln order To meeT deadlines, They spenT many hours over- Time, boTh in The lab and on assignmenT. The personaliTy and humor They broughT wiTh Them was greaTly appreciaTea. Special Thanks, as well, go To Julie lvIarTin for her addiTions To The cause. AlThough Julie was involved in oTher areas of producTion, her parT- Time work was greaTly accepTed. OTher conTri- buTing phoTographers were sophomore David lvlessinger and senior Jim Wall. This said, I would like To Thank you for Taking The Time To examine This end resulT. I hope ThaT iT offers a source of memories boTh now and in years To come. Yours for a greaT 19811, lvlaTT Bowers, chief phfographer ,W , IA oi 41 .,, 46 lifitizciif fifiwug fic!!! fe 5252? gli? lil? Sv X K ff X 4911 1. The one that got away. Soph football vs. Central Catholic. Photo by Matt Bowers. 2, Frosh-soph girls'basketball vs. Beyer. Photo by l?andy Bakker, 3. Splashdown. Photo by Matt Bowers. 4. Pandy Strauss at the academic decathlon. Photo by Matt Bowers. 5. Darryl Torre - elective PE Photo by Lisa Dunker. 6. Yearbook wants you! Michelle Dilkian, co- editor 4984 Olympian. Photo by Julie Martin. 7. Senior candids, Photo by lisa Dunker. 8. FFA chicken dinner. Photo by l?andy Bakker, O. Coach Gonsalves at the Oakdale game. Photo by Matt Bowers. ocal Events Sv 1. A tour ot our exciting city wouldn't be complete without a trip to see the great Arch of Modesto bearing the words other cities have stolen as ' their siogan f VVater, Wealth, Contentment, l-ieaith. 2. Many students could often be found studying, eating, or just talking to friends at this freauented cate. 3. Punk bands brought music lovers as well as police ofhcers to the Moose Lodge during a War in 84 presentation in January. 4845 More new restaurants opened on McHenry to make a big hit with the Locals Shown here are Bookeys and McGoo's. 6. Modesto was stunned when it heard of former Beyer Patriot Randy Garcia's death in Beirut. l?andy was serving with the U. S. Marines 7 A touch of class was broughtto the downtown area when the newly- renovated McHenry Mansion was opened to the public. 8. A celebrity guest arrived in black cape and helmet with a wicked weeze. You guessed it. Darth Vader, of Star Wars fame, paid George Lucas' hometown a visit while heming out with a Coke-afthon for ceree bral-palsy at Mervyn 's. Q. Many buildings and businesses found themselves being cleaned-up or renovated as the city elected to rehne the appearances of many of do wn to wn 's dilapidated cons truc tions Local Events 497 ' 5 i- X ' The Year in Review if in W Mi x 2 3 .al we 4 TEQND A7 65535152 62 fm gh., . T, g AA cross The naTion This year, shoppers wenT Trying To geT a hold of The newesT Toy craze iiTTle people grown in The cabbage paTch. ons of children begged Their parenTs To lopT a Cabbage RaTch Doll. The pudgy ba- s came wiTh birTh cerTificaTes and adopTion iers. A compuTer designed every doll's face arafely To insure ThaT no Two were alike. Fin- E, Toes, and even belly buTTons were de- ,d. The creaTor of This craze, Xavier RoberTs, used all The frenzy by saying, l'ln an age of eracTive Toys, Theres a need for a doll ThaT -sn'T weT, cry or roller skaTe. n The morning of Sunday. OcTober 23, an aTed 2,500 pounds of TNT were driven inTo U,S Marines headauarTers in BeiruT. The resull ToTal desTrucTion of The headauarTers and loss of more Than 200 lives. Many memories we To people aT ThaT Time, buT The mosT prev- il was This one: They were JUST kids. The ble facT was now realized ThaT no one and Duilding in BeiruT was ever safe lT would be iy weeks unTil The crisis IifTed, buT unTil Then, all merica would sTand behind The marines and hope for The day when They could go ie. Uwe pasT year held many firsTs, buT one of osT Terrific was Vanessa Williams f The firsT k Miss America. ln realiTy, Vanessa was seen Enly as The 5oTh Miss America, buT as a sym- f social change MosT of her days in The pasT ' have been full of Things To do. Said one of VVilliam's companions, 'lYou can'T sneak her anywhere, she's always recognized, liTh a 38-O Superbowl loss, The VVashingTon skins saw The besT Raiders Team ever Jghouf The game, The Redskins were domi- ld by The Raiders - parTicularly Raiders Run- Back Marcus Allen VVashingTon Fullback John Riggins desperaTely aTTempTed To do someThing wiTh The ball, buT his efforTs were fu- Tile. Because of The Raiders' upseT, The STock markeT in New York wenT down, some Las Ve- gas bookies wenT broke, and counTless argu- menTs and fighTs occurred around The UniTed STaTes. Raiders Howie Long sTaTed, l never had l-log before. TasTed good. 5. One of The mosT shocking evenTs of The year Took place when a U.S.S.R. war plane ruThlessly shoT down a helpless civilian 7417, Korean Air Lines FlighT 007, killing 269 people, including al Ameri- cans. The world was appalled by The SovleT violence and inTimidaTion. AT firsT, The Soviefs denied any connecTion wiTh The Tragedy, buT laTer acknowledged shooTing down The airliner because of fears ThaT iT was a spy plane or The like This was a barbaric and senseless acT, said PresidenT Reagan. IT shocks The sensibiliTies of people everywhere. The weeks To follow would be filled wiTh demonsTraTions of The world's anger Toward The U.S.S.R. 6. A fury of nuclear debaTe was creaTed by ABC's Television movie The Day AfTer Aired on November 20, The movie aTTempTed To show The aspecTs of nuclear war' No escaping, no hope, and no happy endings. ABC sTaTed be- fore The movie was aired, IT is hoped ThaT The images of This film will inspire The naTions of This earfh, Their people and leaders, To find The means To averT The TaTeful day. 7. ln a lesson of forgiveness for a chaoTic world, Pope John Raul ll pardoned his would-be assas- sin, Mehemel Ali Agca. The Ponhff mei The man in his Rebibbia prison cell in Rome. According To NME magazine. John Paul Tenderly held The hand ThaT held The gun ThaT was meanT To kill him AT The end of The meeTing, Agca eiTher kissed The Ropes ring or pressed The Popes V8 hand To his forehead in a Muslim gesTure of re- specT. The Pope hoped his meeTing would acT as an example To The world of The healing pow- ers of forgiveness. 8. Videos made Their major impacT on The US. This pasT year. Videos became one of The hoT- TesT iTems for a musical group To produce. ln- creasingly. American audiences demanded each song have a 'lfull audiovisual confronTa- Tian. Many popular videos were performed by Donna Summer, Michael Jackson, Talking Heads, David Bowie, Billy Joel, Van l-lalen, Rick Spring- field, and in The picTure, Quief Riof. Q The invasion was TexTbook smooTh, JusT days afTer The BeiruT bombing, a mulTinaTlonal force of paraTroopers sTormed The island of Grenada To rescue iTs inhabiTanTs and prevenf a possible Iran-sTyle hosTage siTuaTion. l'BuT even before The discovery of arms caches and Sovi- eT-Grenada miliTary TreaTies, The 'rescue mission' had become a preempTive sTrike againsT an- oTher CommunisT ouTposT in The Carribean. Ac- cording To UFE magazine, when 'lOperaTion Ur- genT Fury ended, T8 Ll S servicemen were dead and Ol wounded. ln The picTure, a flag aT half-masT in WashingTon, DC., honors The ma- rines in The invasion T0 The year marked The debuT fllghT of The Eu- ropean-builT Spacelab l. Following an almosT flawless launch, asTronauTs sTarTed To acTivaTe The 72 experimenis inside and ouT of The 23- fooT-long module and on Themselves. De-spiTe being plagued by many problems in The shuTTle and on The ground, The mission came ouT a land- mark success for space-age Technology World EvenTs TOO 4 ' ,f E, f ' ,ffv. 4- 252 'W' 1 :ii2ifs,Q ' mr I M WemOl'ieS . by John Guerrini The pasT school year was a year full f many memories - boTh good and ad Sally Ride, in The Space ShuTTle, be- :1me America's firsT woman To go inTo 'biT. JusT afTer his reTurn To The Phillipines, 3posiTion leader Benigno S. Aquino Jr. as assassinaTed aT Manila lnTerna- Jnal AirporT. One million mourners aT- ended his funeral. SecreTary of The InTerior James WaTT :id of his coal-leasing commission, I :ve a black, I have a woman, Two ews, and a cripple. And we have Tal- wT. ThaT descripTion cosT WaTT his b. He resigned afTer increasing pres- Ire from The public and The WhiTe Juse. The drowning of Dennis Wilson, 39, Tded The acT of America's mosT oubled supergroup. The Beach nys' drummer ended his fasT-paced Ein 43 feeT of murky waTer aT Marina I Rey. He was buried aT sea soon Terwards. The Tough Television newswoman essica SaviTch died in a Tragic auTo- obile accidenT in The Delaware Ca- lzl. IT was a sudden, shocking end To ceIebraTed newscasTer whose life onsisTed of public Triumphs and per- nal Tragedies. Many naTion-wide circuldTing maga- Ies had a TribuTe To John F. Kennedy. venTy-one years ago, The youngesT esidenT of The UniTed STaTes was as- 4ssinaTed by Lee Harvey Oswald. On The soap scene, General Hospifai IW The reTurn of Laura Spencer - ily To bid goodbye To Luke and Laura Ter a few weeks TogeTher. AfTer meeTing and reminiscing old Time, The couple decided To go Traveling - never To reTurn To Genera! Hospifai. A 65-mile human chain, composed of more Than 200,000 WesT-German anTi-nuke proTesTors, was made from STuTTgarT To Neu-Elm in WesT Germany. DespiTe Their efforTs and The presenT poliTicaI opposiTion, nine Pershing II mis- siles were sTilI insTalled in The counTry. In Koyunaren, a village in easTern Turkey, a devasTaTing earfhquake sTruck aT dawn on OcTober 30. Mea- suring 7.4 on The T2ichTer scale, The quake desTroyed 4117 villages and killed 4,336 - many buried alive as They sIepT. Sean Connery, The original James Bond, renewed his place by reTurning, aT 53, To play James Bond in Never Say Never Again, his firsT Try aT 007 since leaving The series in 4974 afTer Dia- monds Are Forever. FifTy years afTer The original King Kong, an infIaTed 841-fooT replica of The ape rose To The Top of The Empire STaTe Building. IT clung To iTs famous perch for a few minuTes before sTarTing To deflaTe. The film The Righf Sfuff broughT seven Mercury asTronauTs inTo TheaTres across The counTry. Brisk-cuT. TesT-piloT heroism earned a second Iook in America. Boy George, 22, and his Three BriTish rocker companions released CulTure Club's Kissing To be Clever, and iT wenT plaTinum. QuieT RioT's Meiai Heaiih became The highesT-charTing heavy meTal de- buT of all Time, beaTing ouT Def Lep- pard, Van Halen, and Led Zepplin. Sfern ediTors made a S38 million pur- chase of HiTler's diaries and called iT The journalisTic scoop of The posT- Dlympics prove challenging While The exacT origin is unknown, AncienT Games were held in a sa- d valley aT Olympia in Elis near The sTern coasT of Greece, and The rIiesT recorded Olympic compeTiTion s in 776 BC. These Greek Games re ceIebraTed in The belief ThaT The lriTs of The dead enjoyed such 'enTs. The Olympic Games became e greaTesT fesTival of every mighTy rTion. CenTuries passed. The Games sTiII nnfinued buT The high Olympic ideals Ere enTireIy discarded and profiT ne was The incenTive for playing. In '3 A.D., The Emperor Theodosius for- Ede The Games alTogeTher, buT They d survived a period of aImosT 300 ympiads or approximaTeIy 4200 ears. In 4896, The emergence of The mod- 'T Olympics Games Took place in AThens, Greece, wiTh The 43-naTion aT- Tended firsT Olympiad. ThaT brings us To The 23rd Summer Olympic Games To be held in Los An- geles on July 28-AugusT 42, 4984. WiTh 40,000 aThleTes and 2,000 coaches from 450 naTions and 8,200 accrediTed members of The media, iT will be The mosT widely covered Olympiad in his- Tory. The Olympic Torch will be carried by a 40,000-man-woman-and-child relay Team. The games will mean abouT S4 billion To California and Los Angeles' local economy. Americans have Trained beTTer Than ever for This Olympiad, and IT is felT ThaT They can win The mosT gold medals. Americans are eagerly awaiTing The opening of The 23rd Summer Olympiad so They can geT on wiTh Their Olympic dreams. As for The 4LlTh WinTer Olympiad held World War ll period. BuT, afTer all The exciTemenT, The 62 volumes weren'T worfh The paper They were forged on. The FBI cracked down on compuTer hackers who were breaking inTo gov- ernmenf compuTer sysTems proTecTed wiTh previously-believed secure pro- TecTion codes. Many of The hackers Turned ouT To be Teenagers. The year's Number 4 LP, Michael Jackson's Thriiier, provided The music for a 411-minuTe, S800,000 horror movie shorT and made iTs sTar 4983's Top en- TerTainer. The movie Fiashdance broughT in several looks - Torn fash- ions, oversize sweaTshirTs, and shoul- der-exposed shirTs. ExoTic popcorn appeared - pina colada, grape, or sTrawberry flavored. The U.S. Then proceeded To consume 112 popped quarTs of popcorn per per- son. More Than a million youngsTers car- ried i?efurn of The Jedi lunch boxes, crushing ouT The previously Smurf-held record. ScoTsman David Niven, 73, who re- defined debonair in such films as The Moon is Biue and Separaie Tables died This year. Paul Bear BryanT, The mosT vicTori- ous college fooTbaII coach ever, passed away aT 69. Sovief presidenT for only 45 monThs, Yuri Andropov, 69, died while in office. He was quickly replaced by 72-year old KonsTanTin U. Chernenko. When The Space ShuTTIe wenT up in February, The asTronauTs made The firsT unTeThered space walk. They floaTed freely around, propelled by bursTs of niTrogen from Their backpacks. The year was filled wiTh many evenTs - which made iT a Time noT To forgeT. for U.S. in Sarajevo, Yugoslavia, during Febru- ary 7-49, 4984, The UniTed STaTes' didn'T do as well as expecTed. The UniTed STaTes won four gold and four silver medals. Gold medals were won by Bill Johnson in downhill skiing, Phil Mahre in Slalom, Debbie Armsfrong in gianT slalom, and ScoTT HamiITon in fi- gure skaTing. Silver medals were won by STeve Mahre in slalom, ChrisTin Coo- per in gianT slalom, Rosalyn Sumners in figure skaTing, and KiTTy and PeTer Car- ruThers in pair figure skaTing. The USA Hockey Team finished unexpecTedIy in sevenTh place. EasT Germany was The biggesT winner wiTh 2A medals ToTal. The American performance was quiTe a conTrasT from The numerous Ameri- can vicTories aT Lake Placid in 4980. - Phofographs courfesy of The Moaesfo Bee World EvenTs 204 MUUWIIIES 1. Terms Of Endearmeni 2. Flashdance 3. Hoi Dog A. Risky Business 5, Educdling Rilo 6. Yenil 7. All The Right Moves 8. Prodigal Q. Porky's ll :mornin WIIIDIEDS 1. Thriller - Michael Jackson 2. Tell Her Aoouf ll - Billie Joel 3. Hungry Like The Wolf - Duran Duran Ll. l'll Tumble For You A Culiure Club 5. Tolal Eclipse - Bonnie Tyler o. Beal ll - Michael Jackson 7. LeT's Dance - David Bowie 8. Land Down Under - Men Ai Work Q. Billy Jean - Michael Jackson 10. King Of Pain - Police I -I And ihaT's enieriainmen or 4983- 'I 984 AIIIBIIJMKS 'I Thriller A Michael Jackson 2. Pyromania - Def Leppard 3. H20 A Hall 84 Oals 41. Business As Usual A Men A1 Work 5, Kissing To Be Clever - Cullure Club 6, Fronliers - Journey 7. LeT's Dance - David Bowie 8 1999 A Prince 9. Lionel Richie - Lionel Richie 'lO. Flashdance Soundlracl SIINEIIIES l Jump - Van Halen 2. 99 Lufioalloons - Nena 3. Thriller - Michael Jackson 4. Karma Chameleon - Culture Club 5, ThaT's All - Genesis 6, Holiday V Madonna 7, I Wanl A New Drug - Huey Lewis And The News 8. Sornebodys Waiching lvle - Rockwell 9, Owner Of A Lonely Hearl - Yes IO. Running With The Nighi - Lionel Richie vw 1 z 1 li 2 sz 1 1:22 .Nik 3 ww: 3 2, 2 A P W5 W,.m ,M .,,U M WMS-' WW gzwf aww wfzggzzizzszzzefza Wg, W 4 Q 2 A fe as H3 H3223 'adliiiiifm 'lv' 165:51 0 ,W U :g::sSS?2E?5 zzzzzigiiizi z1f:?EEE5.., ai 12555233 zzmziiiiiiizii 4,g2iQ3m:z: 'masses gg,1g:,Q14m::g:gg2gQz illiiigzisgzrzzzzazifw wzvgafygqgzsezsxtigi ggzzimffzigsvazzzgzaaeiggaggzzfi Niifrzazzzzazzzmi :SSW :2'::-522251 aiiiflififb' H NQWEEHWEQSZQZZZWQQ, 2:-'E-21 wa55f f,2? wsiiewf- QS? 155 ggzxazzggegwggiwmzsss gzwsmsswizazzzz Wamrm 'szlatszmfgiex Hz: gm iiigzzzz giizzzfzfzg j :ageing QQ 1 ifzggiigiggziyi 'qfgggggsiggifi QEYQSEZSBZ3 3953, . Uffussw fig? , h f1222225wgwzliigizzgsawi g gggweig g, 15:4 4z,z1a2xgEgME:z1.g if giggssizzszg zzgagwggiiz zissazzsgzzigswigpggagzsssez:gain iiizqzszmazx L Q asggeg 1:sz:1s:f:2S1MMf1:::s222 sfzifiiiigiffz lES:,:w22g?'f2E w::z2W 2 gh wwzzsm 255222221 5253553 99,3 19 and L Vz N f bf ' Crm ww n, w, G, ,,,, mx wh ' 3-le 'friIfi'79iW.zif Ewfzfli m , 57:75 'W . Varsity Wafer Polo 2nd in CCC M, I f ' ' me izzif iwfiffwwif V WWMMS wsmsfgggfggzzzzavzmpf 4 zzzzxsghw 0 Q Hi W a Eisrfmsfzli fmqmnmwf , in Q51 wa 225212312zz:zzzfsggggggiiissggfzf.gmsw Q 8 is ,Emp ,ga 5' smimiiiiszzzgaiiiiiiwiiasfi Z 1 2 ws a,g,f F .2 ThoT's dll folks A speciol Thonks To. . . PuTTing TogeTher on Olympian re- quires geTTing good help frorn excel- lenT people. The Olympian Thonks: Les PeTerson, our JosTen's soles re- presenToTive, who dlwoys supplied us wiTh onswers for our endless guesTions. John Bell, from Johnson ond Bell, who Took The cover phoTo ond helped wiTh picTures ThroughouT The book. lvlorgo Pocock, our pldnT orTisT frorn JosTen's, who helped us design our di- vision poges ond opening secTion. Lindo Beomer, STudenT Body office secreTory, who helped us wiTh our money rnoTTers. The Dovis High foculTy, who ollowed us To conducT vorious surveys in Their closses. Colophon Copies: 4500 Publisher: Jostens American Yearbook Company Cover: True life Type face: Avant Garde Type size: headlines - 30pt. copy - l0pt. captions - 8pt. Text page: Gloss lOl Advisor Gertrude Hogue Editors-inechief Michelle Dilkian, Andrea Dixon Photogrophereinfchief Matt Bowers Contributing photographers Randy Bakker, Lisa Dunker, David Messinger Ad manager Marlene Youngheim Business staff Laura Gundlach, Suzie McGuigan Sports editor Jamie Nott Senior editors Debbie Maxwell, Michelle Ocken Undergraduate editors Renee Dixon, Sharon Graham, Julie Martin Faculty and Index editors Erin Barry, Elaine Tzagarakis Organizations editor John Cuerrini Staff Sean Byrne, Khris Epperson, Katie Harmon, Lynne Manrique, Anita Parker, Geoff Sprinkle, Shauna Thurman, To the 4984 Olympian staff, Thank you! Thank youl For all of your hard work. Without your help such a top-notch book could not have been possible. We hope this year's Olympi- an will bring back a lot of memories because you were part of it. Your co-editors, Michelle Dilkian Andrea Dixon Editor's Closing 207 DHL 9 LeeW Mettler ng I H ,Lclbsnen J 5 af CATERING 1..Q.... ORTHODONTICS L I-I Bob 81 Ann M d I CA 95350 Togneffl QQOQD 577 4090 Coffee Road SUUC F 6 I e Calif 95355 P ace H I OPEN M d T CA 95350 . y TRUDY 84 JOEL SOVVDER Ph 12095526 0403 APPT i WALSH J CONIVIY D D S QQTHQDQNTIST American Associoiion of Orihoeioniisis 4243 COFFEE ROAD SUITE E IVIODESTO, CALIFORNIA TELEPHONE 526 01162 X 9 s a ahag' V N 5, V , - I . g.0f:i' is ' Y V I I I Q iz, II I , , 480 evelomd Lone, Suiie 2 Qevelond Lone ci Mc enryj --- . -...i . - I , 1213 Fashions for ' . Th Peiiie Women 7 the Mod csto , -. -- 2- . E l . . 5 ' . I . LD JL , f 'H V .u ' ' Q 480 I ci Lone y I I Civic Oerggg Levelondj j Q 5 , E 2 'H l l BY - ' A 'Ig 5 ' ' ,- fb - . X Congratulatrons Class of 84 VITO S Tarlorlng 84 Clothlng FINE MEN S APPAREL Western Plaza 2625 Coffee Rd. Suite 4 Modesto CA 95355 C2095 524-6484 ' 1 I n n I I , 1 Phone 523-7496 DeLuxe Cleaners lno CARL A. GAC-LIARDI 532 McHenry Avenue CHARLEEN GAG-LIARDI Modesto California your future storts today! lllll I Commerclo .Ill IIIIIHIIIIIIIII College ITIEHNS BUSINESS 940 Twelfth Street Modesto CA 95354 C2095 578 0646 4 .1-'f ' - rr J I X . fl Congratulations! 7 ff Merlin predicts ,I K you'll have a YNY e ' great future! f ix f N -lu Y l1mmh l'uhleI N P1ZZ2lRBStEiL1I'3.I'1tS S 2001 Tully Ru. 14:4 vintage rf' 'rc Mmiqtro Modesto W D27-650 C890 IVIR. T'S DELICATE DONUT SHOP MONDAY THRU FRIDAY 4AM to 7PM SATURDAY 84 SUNDAY 4AlVI TO 4PM ACCEPTING ORDERS IN ADVANCE ERONTIER TOWN 3507 TULLY ROAD IVIODESTO CA 522-4644 I Congratulations Class ' I CHUCK s Poor A I L SERVICE chemicals cleaning repairs Chuck McGuiQan Box 4084 522-2600 Modesto Ca. IIIIIIIIIHIIIIIIII- , Hu 7 I Ili. .nl I I K ray: ,A Of '84 1 .E 7,6 QL? 2 I 446 , if QuesTlonnolres were dlsTrlbuTed To rdndomly selecT ed groups of sTudenTs whlch represenT o cross sec Tron of The sTudenT body 4 WhdT IS your fdvorlTe fdsT food resTourdnT'P Tdco Bell Mc Donold s Wendy s Burger Kung Jock ID The Box 481 0 36 A 2 WhoT IS your fovorlTe beveroge'P Pepsl Alcohollc Type Coke Ml MT Dew 36,6 X fo A 0,6 3 How ofTen do you go ouT To o fdsT food res ou rdnT'7 2 or 3 Tlmes d week 4 Tlme o week 3 or A Tlmes o week everydoy once d monTh rorely 2 2 76 ok A STudenTs lmpresslons of Dovls IT s o greoT school everyone IS dlfferenT DOVIS IS greoTl mole freshmon femole freshmon Awesome school besT ln Town GreoTl mole sophomore femdle sophomore There IS Too much Trosh on The ground mole freshmdn A. B. ' 494, C. ' 4 0 D. ' 440 E. ' 970 A' ' O B. ' 2200 C. 440 D. 'Ik 440 E. Dr. Pepper 4096 F. . 4 0 . T - A. ' 81, B. ' 496 C. ' 4 0 D. 4 O E. 970 F. 91, :L N 14414 JN 1 2 'ig E. Time out to Gilberg Flordl 2422 College Ave. 529-2449 picTured below: l'2oberT Somers 84 JoneT Boer Picfured above: Van Prom, Linda Paradis, Tim Fifzgeraid, Laura Gundiach, Rick Taylor, Dana Leafherwooa, Suzie lVicGuiQan, aria' Diana Norcofi. I The Wardens Office 2 KeIIer's Fine and Casual China 0 Crysial Sierling ancl FIaTware ' Gourmei 0 Fine C-ifTs Julie Keller 4700 Ivlcl-lenry Avenue Ivlocleslo CA 95350 QQOQJ 577-2590 Associafed Adveriislng Service FULL SERVICE OFFSET PRINTERS ART sl LAYOUT DEPT COMPUTERIZED TYPESETTING Office Supplies 0lFurni'rureI DAN PARKER Drafhng 84 Engineering' Supplies - Business Forms FREE CONSULTATION Rubber Siamps v Gifts for 153235 W -wh Sffeer Mod HOV09 84 Office - Newsletters S,f,,.O,,e,y 2097523 2674 Tracy, Amy, 84 Jenifer make The difference af The Wardens Office. FINE A-COLOR PRINTINGLCOMPLETE BINDERY-DIRECT MAIL eslo 1 IVIQHSVW STORER com., YIIGQS rreANsPoRrf-mom SERVICE - SINCE 4952 WE'RE A NAME YOU CAN TRUST ........1-TL CHARTER BUSES ANYWHERE IN USA 84 CANADA DAILY SCHEDULED BUSES TO LAKE TAHOE SAFE COURTEOUS 84 PROFESSIONAL DRIVERS Breeze Through summer and everyday Sllp rnro Blrkeh CONTPETTTTVE RATES srock Sandals and go' Q Pictured above Geoff Sprinkle and , 524-8250 Marlene Youngherm FQQTWEAR CLEAN AIR CONDITIONED RESTROOMS CL UDING ROOM RESET? VA TIONS 84 TICKETS 35 19 MCDONALD A VE. MODES TO . CALL CQLLECT TOTAL TOUR PACKAGES AIQRANGED IN- 20 . I I GD MCD0l13ld'S I-I ao AND YOU 24 48 McHenry 4800 Prescoh DRIVE THRU BOTH LOCATIONS Picrured To The right Erin Barry Elaine Tzagarakis Efw Congratulations To The Class Ot 4984 0flOs1 BH Award winning photography 522-4057 Ne wish to express our thanks for the opportunity of .erving you photographically Model Portfolios lortrgitg Childlell Qmily WeddlDQS graduation Restorations td Commercial u oor Oil Paintings JOHN BELL 4700 McHenry Ave., H43 Modesto, California 95350 C2095 522-4057 Sundial Restaurant 84 Lodge 806 McHenry 523-5642 Fine Dinning Banquet Rooms available Pictured at the left Randy Bakker mfe Notf JOSTEN'S AMERICAN YEARBOOK COMPANY Yearbook Design And Printing Representative Les Petersen P O Box 4384 Fremont California 94538 Phone C445j 657 8486 - I I Elaine Tzagarakls, Khrfs Eppersan, Jai Queshonncnres were dlsTrrbuTed To rondomly selecT ed groups of sTudenTs whlch represenT o cross sec Tron of The sTudenT body 4 WhoT IS your fovorrTe sporT'7 fooTboll sofTpoIl bosepoll A soccer Trock O Tennrs boskeTboll swrmmrng 2 l-low mony drfferenT clubs hove you been rn volved wrTh oT DCIVIS7 5 O 3 If you could chonge one Thrng obouT Dovrs whoT would IT be'7 PuT o drorn rn The ocTlvlTy courT femole sophomore More pdrklng spoces mole lunlor Chonge The school colors To hoT punk ond hoT purple femole senror Seohng chorTs mole senlor lvloke IT opTronol mole freshmon The przzo ITS Too greosyl mole sophomore The Tordy pollcy femole lunror Al 327, B, - 'I 'Ks Q. 4347, D. ll A E, ' 407, FI 'IOCZT Q, ' ' 4072 A. 0 07, B. 4 4547, C. 2 456 D. 3 QTL E. A 77, F. 5 279 G. 6 W, H. 7 'WT Volley Sporling Goods 41148 J STreeT 523-5684 Picfured above: Louro Gundloch, Sfephonie Brofz, Von Prom, Chrisfie Earle and Rick Taylor. CongroTuloTions To The Cldss of 4984 ., ell l T Aword winning phoTogrophy 522-4057 We wish To express our Thonks for The op- porTuniTy of serving you phoTogrophicolly Model PorTfollos PorTrolTs CIWUCTFGVW Fgmily Weddings G-roduoTlon ResToroTions OuTdoor Commerciol Oil PolnTings JOHN BELL T700 lVlcl-lenry Ave., 4413 lvlodesTo, Colifornlo 95350 Q209j 522-11057 E 5 n- T Tullyb C1 VG A Smmdiforcl 'I 424 I L XJ 'M' cusrarvi nssiem ' Cusiorn Designed Jewelry CQUnTryfT1Gn'5 ' Diamonds 84 Gems ' Rernauniing ' Jewelry 84 Waicn Repair ' Class Rings rm. HP' k . ' ' MAryiLL:aCLjiSD1LJRLsLrTlL31QfLiAN Hee Rm CKWQ 4700 Mane-my Ave. 462 ARTCARVED lvlodesio, Calif. 95350 CLASS WGS' 'NC- Phone 578-'l 'I77 CFD 'AWE ALL GET OUR I-IAIR CUT AT HAIR FOR ALL SEASCDNSV' Ellen Sanders, Elicia D'Accardo, Diana Norcoli ' 'las Lisa Vi 30 'l2 lvlcl-lenry Ave Congralulalions class of '84 W the ultimate temptation PAUL'S REXALL DRUG ' Marguerite Engelhard I E Ed ' ' gifrs - cosmerics - cards ve Wards Sue Wllhlte 523-32417 4034 W. Orangeburg lvloaeslo, Ca. Rossini's Formal Wear Gentlemen's Apparel 1209, 529-5860 3224 M HENRY Ave 524-2543 Moossro cAuFonNiA 95350 lVlcHenry Village 524-5966 Browsing above is Aniio Parker. Exclusive Tailoring 0 lvlodeslo Bowl is open 211 hours a clay for your Bowling Pleasure 9Kx 6lg, Aulomalic Scoring o . Open Lanes For Praciice Bowling 9 We Qgmae 0 Q The Wayslalion Reslauranr OPEN 24 HOURS fi 524 rllfiflcljienry Aevxenue , o es o, ,al . , 577-3466 ,ff g ' 1, Equipmenl - Trophies fi Hals - T-snlrrs Q! Design - Bowling 9 We've GolWhal's Hail 0 And Now Bigger 8a Beiler f I ' . I l Joe 84 VVendy's Bowling 8a Trophy Shop ' I wilh Bowling Equipmeni - Trophies for All Occasions Cuslom l-lals - T-Shirts of Your Design - Bowling Shirls Records - Tapes - Computers - Software All Localeol Downlown ,Q-,A Oh 'I3Th ST., Belweeh KSLL 1209 McHenry Avenue - 522-9050 523-94 M ' 4 MODESTO I n A Questionndires were distributed to rdndomly selected groups of students which represent d cross section of the student body. 4. Whdt is your fovorite movie? A. Risky Business B. All the Right Moves C, An Officer ond d Gentlemdn D. Fdst Times E. Stdr Wdrs F. Porky's 2. Whdt is your fdvorite musicdl group? A, Police B. Journey c. Def Leppdrd D. Quiet Riot E. Rush 3. If you could chdnge one thing dbout Ddvis whdt would it be? Better looking guys -femdle sophomore Need o footbdll stodium -mole senior Definitely the otmosphere -femdle junior A. Students impressions of Ddvis: School is d big competition between dll the dge groups. -femdle senior A good school, better thdn Downey. -femdle junior An interesting school full of opportunities for d good time. -mole senior Too mdny clicks -mole junior Q7'1:Z,4.1 - .A il ' . H I Q I - 1: :mai-f. Scholdstic Division Credtors of fine cldss rings, dwdrds, dnnouncements, diplomds ond cops 84 gowns Keith Crow PO. Box A275 lvlodesto, CA 529-2952 r Trdcey Ugdr nn'Q,,,g m ,,Q.,1LWf Soles Service pgig :litem 1021 McHenry 527-4800 Cyl 84 Jock Ugdr Modesto LORMUN JEWELERS THE CENTRAL VALLEYS AUTHORIZED CCIrTier DEALER UNIQUE CUSTOM JEWELRY DESIGNING ' FINE DIAMONDS KNOWN FOR TREMENDOUS VALUES ON OUR EXOUISITE 84 EXCITING JEWELRY fIRTC ZIIWEDQ CLASS RINGS INC PROFESSIONAL REPAIRS CONVENIENT LAY-A-WAY TERMS 2625C COFFEE RD. WESTERN PLAZA Mike 84 Neydc Murwnelly MODESTO MODESTO BACK SCHOOL IVIQQGSTO Bgck School A REHABILITATION CENTER .,,....,u..w-- Rehobilifcnion Cemer QD, 'io fy 6 2004 McHenry Avenue Quo oil SuiTe D Q5 ModesTo, CA 95350 C2095 578-4806 PHYSICAL THERAPY Douglas C. Cloussen RPT S .II 4 . . ..,g1:.':m:' QWUIOQQJV 133 BUFINEY STREET MODESTO, CALIFORNIA 95354 209-523-5326 GRACE DAVIS I-HGH BCDOSTERS CGNGRATULATES CLASS CDF '84 , :yr K E 'wi V 2.41, FFA Week FOURTH PERIOD WINNERS Hay Buckmg Danielle Snarr Tuna Tan auary ana Karyn Fax Jeff Reed ana Drno Welch Equipment Idenhflcahon Raberr Bumgaraner FIFTH PERIOD WINNERS Hay Bucklng Becky Lee Danielle Shank ana Tina Tanauary Jason Brooks ana Jerry Saunders Equlpmenf ldenhflcafion Nickie Hay 2A 11' 57 1. !f's easy fo see fha? Karyn Fax and Trna TOD- guary are fn a fesfive mood, 2. Jerry Silva 13 a confesranr in rhe hay buckrhg confesf. 3. Sydni Mrhder he4as cohresfanfs In eaurpmenf ldenffhcaffon, 4. Danreffe Shorf and Karyn Fox are having a hard frrne movrhg the hay. 5, The conresr in The acffvify courf draws many specfafors. FFA Week 223 A Abby, Darrin 43 Abernathy, Stefani 37, 60, 61, 145 Academic Decathlon 172 Acker, Stephanie 80, 157 Acord, Chris 157 Adair, Ken 172, 174 Adam, Zaia 133 Adamakis, Peter 46 Adamakis, Sammy 98 Adcox, Christina 98 Adcox, Jerry 157 Adler, Michelle 157 Adshade, Shelly 145 AFS 23 Ag 133 Aguilar, Dianna 145 Aguirre, Andy 157 Aguirre, Bryan 37, 70, 71, 98 Akard, Chris 145 Alameda, David 145 Alameda, john 98 Alberti, Louise 174 Albor, Tomas 157 Armstrong, Audie Arnold, Keri 133, 136 Arnold, Liz 98 Arnold, Mark 157 Arp, Ben Art Club 39 Asbill, Jon 157 Assad, Paul 71, 98 Atkinson, Jody 49, 157 Atwood, Melinda 133 Atwood, Steven 98 Austin, Melissa 26, 98 Austin, Roy 31, 145 Austin, Shelly 26, 98 Avila, Julie 157 Azevedo, Michelene Aziz, Amjad 133 Aziz, Deiana 157 Aziz, Sobbah 145 IB Bacich, Amy 145 Bacich, Michael 98 Bacon, Teresa Barrett, Terry 145 Barry, Erin 5, 14, 17, 19, 35 1 132., 133, 214 Barr, Nancy 175 Barton, Brett 99 Baseball Varsity 88 Sophomore 90 Freshmen 91 Basham, Kimberly 157 Bashor, Jesse 51, 99 Basi, Pinder 72, 157 Basketball Varsity Sophomore 65 Freshman 66 Girls 69 Bassett, Karol 99 Bassett, Pamela 99 Bateman, Angela 14, 23, 57, 132, 133 Bates, David 133 Bauer, Barbara 157 Bauer, james Baughman, Mark 157 Baum, Tim 145 Bauman, Carol 157 Alcantar, Elizabeth 159 Alejandres, Elsa Allemandi, Gene 37 Allen, Faith 133 Allen, Frank 174 Allen, Regina 145 Allen, Tena 31, 157 Allsup, Michael 157 Allsup, Russell 133 Alonzo, Kim 23, 73, 133 Altadonna, Brian 145 Altadonna, Vanessa Alvarez, Marina Alves, Lorraine 145 Alves, Paul 43, 143 Alves, Sherri 98 Alvidres, Cruz 39, 98 Alvidres, Elvia Andersen, Renee 35, 60, 144, 145 Anderson Brad 98 Anderson Christine 157 Anderson Janet Anderson, Karen 98 Anderson, Monica 133 Anderson Sharnel 157 Anderson, Stephen 133 Andrade, julie 157 Andrews, john Angle, Mark Anglim, john 20, 157 Anglim, Melissa 98 Anshutz, Sieglinde 132 Anthony, Jennifer 133 Arcala, April Archer, Charles Arias, Frank 145 Arias, Raul Baggett, Catherine 171, 174 175 Bailey, Doug 133 Bailey, Kathy 157 Baker, Barbara 36, 76, 133 Baker, Debbie 157 Baker, janet 98 Baker, Kelly 145 Baker, Larry 43, 45, 98 Baker, Mark Baker, Michelle 157 Bakker, Greg 99 Bakker, jeffrey 51, 154, 157 Bakker, Marci 35, 145 Bakker, Randy 17, 51, 99, 215 Balara, Matthew 126 Bales, Serena 31, 35, 133 Band 31 Bandy, Lisa 157 Banks, Mary 133 Banks, Mort Baranski, Joey 145 Barbe, Cynthia 51, 58, 99 Barber, Anthony Barber, Laurie 145 Bargas, Mark 46, 145 Barker, Cindy 145 Barker, Kasey 157 Barker, Kelly 133 Barker, Kelsie 99 Barner, Debra 37, 157 Barnes, Annette Barnes, Mike 49, 51, 157 Barnes, Robert 46, 47, 145 Barnett, Gail 157 Barnett, Scott 99 Baroni, Greg 43, 99 I Baumgardner, Ginger 157 Bavaro, Shannon 38, 157 Baxter, Mark 157 Bayless, Corey 49 Bayless, Lance 133 Beacom, John Beall, Heather 20, 33, 99, 173 Beall, Terri Beals, Anna 145 Beals, Tommy 133 Beam, Kim 133 Beamer, Linda 174 Bean, Anthony 157 Beasley, Mary Beauchesine, Patricia 174 Becerra, Pepe 43, 45, 75 Bechan, Anita Beckwith, Brian 49 Bedford, Grant 133 Beeler, Kenneth Beeskau, Lori 133 Bejarano, Steven Bel, Angela Bell, Earl Bello, Denise 37, 145 Bench, Melissa 99 Benge, Celesta 145 Benjamin, Bob 140, 174 Bennett, Carol 145 Bennett, Greg 46, 47 Bennett, Mike 133 Benson, Carlton Berbena, Felicia 157 Bernard, Benedicta 157 Berry-Hudson, Lynn 174, 175 Bettencourt, Kristi Bettencourt, Mike Bettencourt, Steve 99, 185 Bettenahusen, Ben 99 Biagini, Cynthia 31, 145 Bigelow, Curtis Bigham, Deborah Bigham, Phillip Biglieri, Kevin 145 Billington, Michael 72, 157 Billington, Niles 157 Birchfield, David Biron, Sheri 99 Bispo, Danny 46, 145 Black, Deshawn Black, loelle 133 Black, Rich 157 Blacklock, Angela Blackshear, jimmy Blanc, June 145 Blanchard, Anissa Blanchard, Tami 38, 157 Blankenship, justin 145 Blevins, Anthony 31, 157 Blevins, Natalie 99 Blevins, Ronald Blickenstaff, David 175 Blood, Michael Bloom, Dianna Blount, janel 26, 27, 35, 99 Blue, Kim 31, 35, 57 Blue, Michele 133 Boatman, Jon 54, 133 Bodiford, Mark 133 Boer, Dan 175 Boer, Kristin 157 Bohlender, Brent 176 Bohnstehn, Tim 133 Bolles, Michael 157 Bonnell, Procton 133 Borba, Melodie 157 Borba, Patty 145 Borba, Tony 145 Borbon, Paul Bordanaro, Brent Bordoli, Clancie 99 Borst, Mary 177 Boucher, Ioan 133 Bourque, Scott Boutelle, Troy 43, 133 Bowden, Margaret 100 Bowen, Dean 51, 133 Bowen, Mary 145 Bowers, Jill 17, 157 Bowers, Matt 19, 133 Bowers, Rebecca 10, 31, 38, 157 Bowman, Angel Boyd, Myka Boyington, Veronica Bracken, Theresa 145 Bradford, Gerald Bradley, Chris 35, 54, 100 Bradley, Kathryn Bradley, Melissa 57, 156, 15 Brady, Danielle 133 Brady, Julie 133 ranch, Darren ratz, Stephanie 51, 73, 133, '216 ravard, Phillip 176 iray, Deborah 133 remer, Gregory 100 rennecke, Lane renning, Kristin rewer, Beverly 35, 100 rewer, Don 100 rewer, Jeffrey 31, 145 rewer, Lisa 145 ridgewater, Alta riggs, Judy 157 riggs, Michael rink, Kenneth 176 risco, Kevin 46, 145 risco, Thomas 133 ritt, Deana ritt, Diana 100 rirt, Robert 133 ritton, Paul rockway, Patrick 145 rooks, Garth 157 rooks, Jamie 26, 133 rooks, Jason 100 rossier, Tabatha 133 roumas, Jennifer 26, 145 rown, Bobbie 157 rown, Greg rown, Jackie 133 rown, Jim 49, 157 rown, Julie 157 rown, Ken 157 rown, Lisa rown, Michael 145 rown, Sharon 14, 156, 158 rown, Vanessa rundage, Kevin 100 rundage, Valerie 145 lrunetti, Melissa 145 rrunswick, Cherise 38, 100 ryant, Charlotte 158 ryant, Crystal ryant, Michael 158 ryant, Richard ryhni, Lori 27, 177 uchanan, Sean 46, 145 ucher, Sharon 133 uckmaster, Melinda 158 uckmaster, Theresa udjen, Aaron 38, 158 udjen, Lisa 24, 145 uer, Steven 133 umgardner, Robert 100 unch, Chris 43, 100 rungard, Sherry urckhardt, Diana 100 urford, Jerrad 145 urk, Krisi 26 urkett, Julie 58, 100, 121 urks, Stacy 145 urleson, Jane urton, Jill 100 ussey, Chris 37, 100 Butterfield, Debora 31, 73, 145 Butterfield, Rachel 73, 158 Butz, Keith 31, 158 Butz, Tom 71 Byrne, Sean 17, 51 Bystrom, Gregory 158 l Cabral, Mike Cadrett, John 133 Cadrett, Paul 38, 145 Cadwell, Kellie 158 Cagle, Jim 183 Cahill, JOl'll'1 36, 100 Calderon, Ernesto Caldwell, Julie 73, 133 Calvillo, Jim 133 Camelio, Kari 52, 145 Campbell, Arlene 177 Campbell, John 101 Campbell, Mandy 158 Campbell, Robin 38, 154, 158 Campos, Diana 133 Canevaro, Debbie 78, 133 Cantwell, Duane 31, 51, 77, 158 Cantwell, Michael 75, 145 Capps, Karen Caputi, Damon Carattini, David 158 Cardoza, Anthony 158 Carisoza, Maryann 133 Carisoza, Mike 158 Carlisle, Jill 158 Carlson, Phil 101 Carmichael, Susie 133 Carney, Tonya 101 Carpenter, Janice 31, 133 Carper, Wade 49, 158 Carr, Jeff 134, 174 Carr, Stephen 134 Carranza, Lisa Carranza, Monique 145 Carrillo, Chris 43, 77 Carrillo, Raul Carrillo, Yvonne 158 Carroll, Michelle 14, 19, 56 57, 59, 101, 127 Carter, Kevin 65, 146 Carter, Paula 35, 58, 101, 173 Carvalho, Andy 158 Carvalho, Daniel 134, 174 Carvalho, Joanna 176 Cary, David Cassell, Michael 29, 145 Cassle, Mary 35, 145 Castagna, Mark 134 Castro, Frank 51, 101 Castro, Joey 131 Castro, Victor 158 Catarino, Candice 38, 134, 190 Cathcart, Kimberly 134 Cerda, Karen Cerda, Roy Chadwick-McKee, Elaine 176 Champs 204 Chand, Veerend 158 Chandra, Kamlesh 158 Chang, Alan 101 Chang, Bridget 146 Chang, Donna 134 Chaplin, Dale 101 Chaplin, Tina 158 Chapman, Kimberly 158 Chastain, Susan 38, 146 Chatfield, Debbie 101 Chau, Duoc Chau, Le 134 Chavez, Debra Chavez, Martina Cheary, Lynn 31, 134 Chebotarewich, Sharon Chess Club 38 Cheek, Donald Chichester, Daniel 101 Chichester, Eric Chilton, Beth 146 Chin, Paul 38, 101 Chipponeri, Todd 158 Chirrick, Curt Chituras, Johnathan 49 Choate, Jerry 134 Choate, Melissa 158 Choir 33 Choppe, Thomas 102 Christensen, Cynthi 134 Christensen, Karen 73, 158 Christodulis, Connie 14, 20, 102 Chun, Wendell 176, 192 Chyles, Janet Chyles, Lori Ciccarelli, Judy 38, 80, 158 Ciccolo, Sylvia 34, 35 Ciraolo, Lisa 24, 146 Ciraolo, Tina 59, 102 Clark, Brett 181 Clark, Eric 46, 146 Clark, Karri Clausen, Michael 134 Clay, Denise 134 Closing 206, 207 Clowers, Sherri 146 Cocannouer, Amie Cochran, Shawnda 146 Cody, Brian 49, 75 Cogburn, Tracye 146 Cohea, Shane 75, 134 Collett, Roger 146 Collins, Gary 134 Collins, Jerald 102 Collins, Korinne 102 Collins, Rabecca 158 Colvin, Curtis 46, 75 Combs, Buzzy 71, 158 Conover, William 134 Contreras, Lucy 134 Contreras, Roy 43, 134 Cook, Christine 5, 19, 158 Cook, Stan 37, 46, 146 Cooper, Shane 46, 146 Cooper, Shawn 102 Cordeiro, Jaymie 134 Cordrey, Mark 43, 102 Corgiat, Gina 35, 78, 134 Corgiat, Martin 158 Cornwell, Rachel 158 Cornwell, Raymond 145 Cortez, Henry Cortez, Louie Cosgrove, Jeffery 159 Costa, Jennifer 158 Costa, Kathleen 146 Couchman, Suzanne 146 Courtroul, Stacy 49 Courtwright, Chris Covarrubias, Lupe 146 Covarrubias, Teresa 158 Cox, Brenda 38, 158 Cox, Paul 158 Cox, Paula 134 Cox, Richard 146 Cox, Wade 51, 71, 134 Cox, Cox, Wendy 6, 73, 134 Wendy L. 146 Crace, Shannon 134 Crandell, Julian Crandell, Karen Crandell, Sheila 146 Crane, Debra 19, 35, 102 Crane, Katherine Cranor, Tammy Crawford, Andrew 146 Crawford, Betsy 102 Crawford, Patricia 158 Crawshaw, Kristi Crews, Tamara 14, 156, 158 Crifasi, Patricia 177 Crismon, Blaine 20, 51, 77, 146 Crisp, Milo 146 Crist, Michele 81, 146 Cross Country 51 Cross, Diane 146 Cross, Janel 146 Cross, Sabrina 134 Crossman, Kim 102 Crossman, Robert 72, 158 Cruz, Raquel 52, 146 CSF 23 Cummings, Diana 146 Cummings, Jayne Cummins, Robby Cunningham, Kris 158 Cunningham, Lori 134, 209 Curl, Brian 31, 102 Curry, Don 177 Curtis, John 158 Curtis, Scott 146 Curtis, Shelby 102, 121 19, 35, 103, 127, 209 Doll, R D Accardo, Elicia 19, 38, 102 Dadasovich, Robert 54, 134 Dady, Parry Dahlgren, Beverly 177, 192 Dahlin, Kiersten 102 Dailey, Christie 26, 58, 102 Daily, Todd 102 Damm, Kathy 134 Dance 26 Dandy, Karen Dang, Nhut Daniel, Simone Daniels, Curtis 146 David, Curt 43, 45, 103 David, Lisa 35, 103 David, Rony 65, 146 David, Sandy 5, 103 Davidson, Dina 158 Davidson, Ronald 134 Diaz, Dora 146 Diaz, Marlo Diaz, Ramon 134 Dick, John 159 Dickson, Roger 179, 185 Diep, Binh Diep, Chau Dietrich, Brian 134 Dilkian, Michelle 10, 14, 17, Eaton, Pamela 52, 68, 146 Eaton, Paula 52, 68, 146, 174 Ebright, Cindy Farris, Shawn Faughn, Colleen 68, 107 Fenstermaker, Loraiei 134 Ferguson, Brian 49, 77, 159 Fernandez, Anna 159 Fernandez, Fernandez, Fernandez, Fernandez, Irene 147 Laura 134 Mike 147 Serafina 159 Ferreira, Kirk Dimper io, Darcy 159 Dinh, Thuy 146 Dinh, Trang Dirks, Roberta 19, 103 Dixon, Andrea 10, 17, 19, 103 Dixon, Cheryl 159 Dixon, Eric 49, 59, 66 Dixon, Fredrick Dixon, Keith 103 Dixon, Renee 17, 134 Do, The Docter, jennifer 159 Doll, Chris 146 ichard 179 Davis, Allan 49, 66, 158 Davis, Chris 103 Davis Heidi 134 Davis, james 146 Davis, Mario Davis, Michael Davis, Michelle 103 Davis Pamela 158 Davis, Tracy 73, 158 Davis, Virginia Davison, Lori 146 Davison, Robert 146 Day, Douglas 54 Day, jennifer 56, 57, 68, Day, Kimberly 134 Day, Michelle 103 DeCicco, Mike 103, 183 DeCoster, Kristi 158 1 Flores DeHerrera, juan DeNino, james 49, 54, 77, 158 DeNino, John 77, 177 DeSignori, Sheryl 134 Dean, Debbie Dean, Randy 158 Dean, Sherry 103 Deatrick, Chris 6, 70, 71, 103 DECA 36 Deeter, Greg Deffley, Michael 178 Dekelaita, Tina 76, 134 Dominguez, Carlos 159 Dominguez, joey 77, 103 Doorneward, Greg 37, 158 Dorman, Daniel 19, 146 Doshier, Cheryl 146 Doshier, Donnie 159 Dossey, Stacey 38, 146 Doub, Bonnie 103 Downing, Darbi Doyle, Daniel 31, 134 Drama 24 Draper, Sharon 24, 60, 61, 146 Drobnick, Bryan 71, 134 Drummond, Lance 146 Du Amarell, Laura 19, 159 Duckart, Alex 146 Duden, Brian Dufton, Mary-Noel 146 Dunbar, Clint 24, 146 Dunker, Lisa 17, 19, 36, 103 Dunn, Chris Dunn, Freddie 146 Duong, Mai Duong, Nghiep Duong, Phong Duong, Phung Duong, Tu Duong, Vinh Durbin, Diana 146 Durkin, Marcy 68 Delgado, Delgado, Denson, Denson, Roy Ximena 33, 38 Maggie 36, 134 Mike 158 Dy, Geoffrey 103 Dyas, Reggie Dykun, Natalie Deatherage, Robert 103 Devore, William 46, 146 Dew, Marilyn 52, 68, 146 Dewaal, Nancee 58 DeWolf, Richard 178 Earle, Christie 51, IE 134, 190, 216 68, 103, Edwards Bobbi 146 Edwards Dawn 35, 134 Edwards, jenny 147 Edwards Kim 38 Edwards, Sandie Edwards, Stephen 159 Edwards, Steve 106 Edy, Amy 159 Edy, Jill zo, 106, 173 Egger, Daniel Ehrlich, Ruth 147 Ehrlich, Stephen 159 Eidschun, Valarie Eisenhauer, Janeen 147 Elam, Leon 159 Elam, Matt 134 Elam lr., Larry 51, 147 Elliott, Bunni Elliott, David 147 Elms, Sherrie 159 Elting, Brian 70, 71, 106 Elwess, Anne 159 Embry, Pamela 106 Emens, Kristee 81, 147 Emerson, Bruce 178 Emerson, Stephennie 106 Emery, Alane Emery, Steve 147 Endicott, Melissa 20, 35, 80, 159 Endicott, Sue Eng, Melissa Engebretsen, Imogene 190 Engelbart, Karen Entriken, Angela 147 Entriken, Ronald 159 Epperson, Ken 71, 147 Epperson, Khristine 10, 17, 19, 35, 106, 215 Epps, David 49, 159 Erler, Kristie 20, 103 Erler, Richard' 178, 183 Ertassi, Jennifer 147 Ertrachter, john 147 Espinosa, Chris 134 Espinosa, Gina 147 Estabrook, Noel 106 Evans, Darrin 159 Evans, Paula Everett, Dana 159 Everett, Teresa 106 Evers, David 134 Evers, Shari 78, 134 Evers, Timothy 107 Fairbank, Tiffany 159 Falletta, Peter 19 Fallquist, jeremy 49, 159 Farris, Edward 134 Ferrell, Joel Ferrell, Scott 107 Ferrera, Jim 107 Fetzer, john Feuerstein, Maralyn Feuerstein, Mike FFA Week 37, 194, 195 Fiato, Mike 159 Ficklin, Michelle 147 Fields, Craig 134 Fields, Sandra 38, 147 Fields, Sherry 107 Fifer, Curtis Filippi, Laura 51, 159 Findley, Devon Finley, Bernice 179 Finley, Janice Finley, Richard 134 Finley, Robert 159 Finn, Richard 179 Fischer, Eric 9, 54, 59, 107 Fischer, Melinda 134 Fish, Kelly Fisher, Richard Fisicaro, Paul Fitch, james 134 Fitch, Raul 174 Fitch, Rod 147 Fitzgerald, Tim 37, 107, 213 Fitzjarrell, Michae Flake, Erin 134 Flanery, Joy 35, 38, 134, 140 Fleming, James 147 Fliehr Lisa 107 Flores, Elsa Flores Graciela Flores Joel 147 Flores Leticia Flores Stacy 107, 173 Victoria 38, 147 Fogel, Avrarn Fonda, Debra Football Varsity 43 Sophomore 46 Frosh 49 Forbes, Randi 159 Forbis, Kimberlee 159 Forgey, Paula 135 Forni, Traci 147 Forsberg, Gayland 107, Foster, Shelley 139 Foster, Sherwood 147 Fountain, Garnet 43 Fouts, jeffrey 147 173 mx, Karyn 135 'ance, Denis 179 anzman, Kurt 107 edell, Heather 'ee, Cynthia 179, 192 eeman, Paul egoso, Marisa eiberg, Gaynell 147 eitas, Rodney 135 'ench Club 38 iedman, Stacey 57, 73, 147 'iscia, Kevin iscia, Michael 107 unz, Todd e, Jonathan 107 ientes, Todd 71, 147 ijii, Sharon 190 irr, Rammie izie, Mary 6, 107 ibba, Charles iiney, Jennifer 61, 147 ileazzi, Serena 52, 156, 159 ilindez, Christina 107 illagher, Leo 51, 107 illi, Kent 6, 71, 107 illo, Dorothy 179 illop, Joelle 107 illoway, Dean 14, 20, 132, ll35, 173 Gilmer, Johnna 147, 159 Gilmore, Bev 180 Gilmore, Michael 38, 147 Gilmore, Steve 159 Giovannoni, Gary 180 Gip, Pau Gisler, Michelle 159 Giubbini, Leroy Glancy, Evelyn Glidden, Matthew 147 Godard, Michelle 108 Goff, Stacey 135 Goldberg, Lisa 35, 135 Goldsmith, Gail 31, 108, 147 Goldsmith, Janet 14, 31, 38, 147 Gomes, Wendell Gomez, Jesse Gomez, Paula Gong, Debby 148 Grindstaff, Bryan 108 Grindstaff, Rodney 135 Grinsell, Maureen 135 Grorn, David Grondahl, Chris 135 Grove, Michael 31, 108 Groves, Kimberlee 148 Grundy, Jodi 108 Guajardo, Candy 148 Gualco, Kari 108 Guernsey, Joe Guerrera, Robert 109 Guerrini, John 17, 135, 173 Guerrini, Julie 159 Guilbert, Mike 146 Guiles, John Guiry, Marylyn 159 Gundlach, Craig 31, 49, 75, 159 Gundlach, Laura 17, 19, 31, Hansen, Erik Hansen, Kimberly 139 Hansen, Matthew 36, 148 Hansen, Shawn Hanson, David 148 Hanson, Jonnie 135 Hanson, William 160 Hanway, Stacy 35, 135 Hanway, Stephanie 35, 160 Hardman, Julie 160 Hargrave, Shauna 73, 109 Hargrove, Debra 160 Hari, Jennifer Harmon Betsy 156 Harmon Elizabeth 51, 68, 160 Harmon Katie 6, 17, 51, 109 Harmon, Mark 181 Harmon, Shane 65, 148 Haroutounian, Angel Gong, Edward 149, 159 Gonsalves, Anthony 108 Gonsalves, Chella 181 Gonsalves, Dan 181 Gonsalves, Gina 135 Gonzales, Marty 108 Gonzales, Ron 148 Gonzales, Sonia 159 Gonzalez, Mickey 108 Goodman, Melissa 148 Elizabeth 35, 148 Goodrow, Goodrum, Shawn Goodson, Donna 36, 109, 209, 2.13, 216 Gunn, Kevin 46, 148 Gunn, Ronald 46, 148 Guptill, Scott 65, 148 Guthrie, Bruce 109 Guthrie, Patrick 109 Gutierrez, Andria 135 Gutierrez, Christa 5, 159 Gutierrez, Dan 6 Gutierrez, Katherine 148 Gwin, Steven 148 Harrington, Carrie 148 Harris, Billy 49, 160 Harrison, Judy 148 Harrison, Norman Harter, Bill 38, 148 Harter, Tinna 24, 39 Hartgrove, Ron Hartlett, Cassie 148 Hartman, Annesa 144, 148 Hartman, Ron 109 Hartt, Timothy Harvey, Maria 160 Harvey, Sandra nnji, Ramsin 6, 107 msel, Tim 147 nrcia, Angelique ircia, Eddie 39, 107 ircia, Jeff 147 nrcia, Raymond 159 ardali, Dawn 159 Srdali, Tom 159 Hrdner, Karen 108 ardner, Rayme irdner, Scott xrrett, Susan 108 arsaro, Maria arza, Robert awrichevsky, Kelli ay, Serena ytan, Teresa esey, Becky 147 is, Victor 147 lsimino, Jamie 51 orge, Kristi 159 Goodwin, Sarah 60, 131, 135 Gottschalk, Ken 31 Graham, Aaron 176, 177 Graham, Robin 148 Graham, Sharon 17, 135 Grams, Darin 59 Grandstaff, Tammy Graves, Kevin 24, 135 Graves, Leanna Graves, Pam 35, 148 Graves Jr., James Gray, Helena 159 Gray, James 135 Gray, Mary 108 Gray, Troy 51 Grays, Ann Grayson, Fiona 148 Grayson, Robin 19, 159 Grayson, Sally 180 Green, Gary 180 Green, George 43, 108 II-I Ha, Liem 148 Habblett, Marcus 65, 148 Habeeb, Kevin 159 Habers, Anne Hackett, Alex Hagen, Christie Hager, Julie 26, 35, 58, 109 Hagopian, Jill 35, 38, 135 Haht, Julie 148 Haight, David 148 Hajek, Heather 148 Hajek, Melanie 31, 159 Haley, Cynthia 148 Hall, Stacy 37, 148 Halley, Amy 35, 57, 148 Ham, Celeste 160 Ham, Maline Hamilton, Aaron 49, 66, 160 Hamilton, David 148 Hamilton, Janice 135 Hasty, Lisa Ann Haub, Shannon 35, 135 Haugen, Jennifer 148 Hawkins, Jim 6, 109 Hawkins, Laurie 109 Hay, Nickie 37, 148 Hayes Beth 135 Hayes James 46, 148 Hayes, M'Lissa 60, 61, 148 Hayes, Robert 135 Hayes, Tina 135 Hayes, Tommy 9 orge, Scott 57, 108 rgiannakis, Mike 49, 159 rmain, Roxanne 159 rman, Kelly eyer, Pam 135 hio, Robin 20, 108 ibbs, William iddens, Stephen 9, 31, 49, 159 idley, Carol 20, 31, 135 illen, Teresa 159 Green, Georgette Green, Kellie 148 Green, Kim 135 Green, Melissa Green, Nancy 181 Greenburg, Jonathan 135 Greene, Willie Gregory, Jennifer 5, 51, 148 Gregory, Steve Griffin, Martin Grimes, Bobby Hamilton, Hammitt, Steve 148 Todd 66, 160 Hammon, Daniel Hammonds, Velma 135 Hampton, Chris 181 Hampton, Eber Hampton, Stephanie 77 Handley, Stephie 31, 109 Haney, Tami 61, 148 Hannah, Shaun Hansen, Christine 20, 35, 109 Haynes, Allee Head, Michelle 160 Headrick, Jeff 135 Heckmann, Robert Hedges, Rusty 109 Hedlund, Kathleen 135 Heimburger, Randy Helm, Randy 135 Helton, Monica 52, 68, 148 Hemingway, Darla 160 Henderson, Karen 148 Hendricks, Shannon 57, 160 Hendrix, Lori 135 Hendrix, Teri 135 Henley, John 160 Henley, Mark Henson, Mark 46 Heppner, Gina 68, 109 Hernandez, Angela Hernandez, Becky 135 Hernandez, Eliseo Hernandez, Tony 160 Herrera, Kathy 160 Herrera, Roxan Hess, Benny Hester, Michele 160 Hewitt, Cynthia 135 Hewitt, Kevin 109 Hiatt, Jamie 135 Hiatt, Rebecca 38, 148 Hicks, Shawn 160 Hiemstra, Cindi 148 Higginbotham, Brad 71, 135 Hill, Donna Hill, Erin 148 Hill, Mark Hills, Kent 109 Himes, Darren 72, 148 Hinton, Kristina 36, 127, 109 Hirschberg, Urs 54, 109 Hite, Georgia Ho, Buntha Ho, Bunthy Hoach, Barbara 135 Hoagland, Greg 72, 160 Hoagland, Kristen 73, 135 Hubbard, Chase Hubbard, Harold 182 Huckaby, Joe Hudson, Rick 160 Hulick, Paul Hume, Jamie 57, 149, 160 Hume, Kimberly 52, 160 Huncke, Stephanie Hunter, Donna Hunter, Sharon 135 Hussey, Mike 43, 75, 135 Hutcheson, Julie 20, 24, 35, 38, 135, 140 Hutchinson, Cherie 140 Hutchison, Bobby ll Iloq, Marjevita 160 Imfled, Kris 156, 181 In, Daly Ingleston, Marshall 51 Inskeep, Dee 160 Irving, Ralph 182 Isaac, Fairoz 160 Jensen, Tammy Jentzsch, Tobias 135 Jertberg, Scott 110 Jesperson, Laura 135 Jessee, Richard 135 Jessie, Judy 182 Jimenez, Christina 52, 149 Jimenez, Jesse Jimenez, Kathy 68, 160 Jimenez, Katrina 52, 149 Jimenez, Lisa 5, 160 Johal, Lakhwinder Johns, Wendy 31, 149 Kanon, flora 136 Kao, Shane 160 Karabinis, Danniell 160 Karabinis, Tamara 111 Karam, Shelly 76, 160 Keener, Brenda 160 Keener, Gina 149 Keener, Lisa Keener, Michael 111 Keeney Deane Keeney, Jo Ann 160 Keeney, Mark Keeney, Todd Isaac, Rebecca 135 Keith, Deanna 149 Keller, Jonathan Kelley, Scott Kelly, Darrin Kelly, Kevin 46, 149 Kendrick, James 149 Kennedy, Steven 72, 160 Kenyon, Pamela 52, 136 Kenyon, Shirley 146 Key Club 35 Khan, Huseena 160 Khan, Zubair Kiep, Chantra Hobbs Brian 49, 160 Hodge, Allan 49, 66, 160 Hodge, Cynthia 135, 181 Hodge, Margaret 180 Hogan, Laura 19, 57, 109 Hogg, Guilene Hogue, Gertrude 180 Holien, Coral 109 Klein, Cindy 20, 35, 57, 136 Jacobsen, Andy Holland Clarissa 148 Holland Richard Holman, Denise 148 Holman, Nancy Holmes, Mark 49 Holmes, Tonya Holroyd, Angie Holt, Lori 148 Jackson, Brian Jackson , Debbie 149 Jackson, Jerry 109 Jackson, Jon 149 Jackson, Robert 182 Jackson, Scott 43, 135 Jacobs, Edmond Jacobs, Najib Jacobs, Stacey 149 Jacobs, Steve Jacobs, Yakop Johnson, Aaron Johnson Beverly 182 Johnson, Cathy Johnson, Dana 149 Johnson, Debbie Johnson, Deborah Johnson, Gregory 110 Johnson Janis Johnson Jerry Johnson John Johnson Karen Johnson Kristy Johnson, Larry 182, 183 Johnson Michael 38 Johnson Mitch 135 Johnson Nichoel 160 Johnson Ray 49 Johnson Raymond 160 Johnson Sandra 78, 135 Johnson Suzanne 135 Johnson Tracy 160 Johnson, Walter 111 Kiep, Sam Kim, Misook 35, 51, 136 King Brent 51, 149 King Claudia 26, 27, 35, 13 King Eric 160 King Jenifer 26, 136 King Juliette 26, 61, 136 King, Randall 43, 136 Kirk, Russell Kish, Adam 160 Johnstad, Ronda 136 Johnston, David 149 Holton, Michele 9, 29, 52, 58, 59, 110 Hooten, Tammy 135 Hopfensperger, Core Hopper, Carol 110 Hopper, George 135 Horman, Melissa 110 Horne, Daren 162 Hornsby, Kathy Horsley, Geoff 110 Horton, David 19, 135, 140 Hotchkiss, Clint Houser, Jerry 181 Houser, Tom 135 Housewright, Corie 26, 35, 78, 110, 173 Housewright, Stacie 148 Howard, George 148 Howell, Richard 35, 110 Howes, Barbi 35 Howes, Becki 35, 149 Howl, Brian 49 Howlett, Stephanie 20, 110 Jacobson, Holly 110 James, James, James, James, James, James, Angela 51, es, 135 Charles 49, 160 Jean 38, 68, 135 Michele 160 Patti 68, 110 Vicky 160 Jolley, John Jones, Bengy 149 Jones, Brenda Jones, David Jones, Dennis 31, 160 Jones, Gary 72, 160 Jones, Lope 31, 33, 160 Jones, Quetta 160 Jones, Rebecca 160 Jones, Rena 183 Jones, Shawn 160 Jones, Theresa 149 Jarman, Bryan 43, 110 Jarrell, Beth 149 Jauregui, Ramona 149 Javaher, Jenise 182 Javaher, Troy 5, 14, 35, 43, 110 Jeffers, Doug 65, 149 Jenkins, Kim 110 Jenkins, Sammy 183 Jenkinson, Jann 183 Jennings, Joe 160 Jennings, Patricia 183 Jennings, Rick 51 Jennison, Kelly 149 Jensen, Karen 9, 26, 58, 110, 121, 173 Joseph, Stuart 149 Joseph, Tamera 149 Juarez, Manuel 111 Juarez, David 136 Judd, Danny 149 Judd, Jeff 136 Julian, James 31 Julius, Anna 149 Just, Douglas 51, 77, 149 IK Kabella, Mark 149 Kailes, Marc Kalm, Randy 149 Kleinert, Marlinda 149 Klopatek, Craig 49, 66, 160 Knaak, Eric 111 Knaak, Heide 149 Knight, Shonna 136 Kobayashi, Yoko 111 Komar, David Kopp, Karla 14, 35, 132, 136 Kosky, Alan 136 Kraft, Jackie 52, 76, 111 Kraft, Preston, 49 Kralik, Charles 136 Kretschmer, Eric 160 Krigbaum, Brian 46 Kubota, Jack 136 Kudrna, Danny Kumar, David 36 Kunishige, Kevin Kyle, Danny Kyle, Robert 149 ll Lacey, John 6, 43, 59, 111 Lam, Binh Lam, Mam Lam, Tai 38, 160 4 1 im, Toan 111 ambert, Laura 57, 68, 160 ambert, Nathaniel 49, 66, 160 ambert, Sandi 78, 136 amkin, Danielle 35, 136 anders, Eric 111, 154 andron, Lawrence anphear, Don 184 me, Cynthia 136 Lee, Laroyce 136 Lee, Pamela 136 Lee, Robin 111 Lee, Ronnie Lee, Tiffany 58, 59, 73, 111 Lee Tonja 38, 149 Lee, Tracy 114 Leitner, Larry 184 Leitner, Melissa 52, 149 Lema, Rhonda me David ne, Jeannine 111 ne, Jim 51, 65, 149 ne John 136 ine, Judy ane, Noelle 35, 132, 136 me, Randy me, Terry me Wendy 31, 161 xney, Kim 161 rngford, David 161 ingley, Mike 161 mkford, Raymond 43 mphear, John 111 rpachet, Jason 149 app, Mike irrabee, Becky 161 rrsen, Rob 41, 54, 111 arsen, Victoria irson, Blake 136 arson, Darcy 149 arson, Gwen 185 rrson, Vikki 149 rsiter, Karen nude, William 31, 111 xudel, Eric 149 iudel, Rhonda 161 xuderdale, Todd zughlin, Kristi 20, 35, 161 Fiughlin, Marci 20, 35, 161 aurenti, Jim 149 aw, Randy nwrence, Carl rwrence, Laura 111 xwrenbe, Michelle 14, 144, 149, 173 Ewrence, Rodney wson, Marie 185 awson, Mike 43, 65, 149 awson, Tracy 149 ay, Mark yne, David , Dung e, Hoang 149 athers, Debbie 31, 161 atherwood, Dana 111, 213 couve, Stephen 37 dbetter, George 111 desma, Al 136 doux, Annette 35 doux, George e, Becky e, Henry e, Jerome e, Kevin Lema, Tommy Lemmo, Nicholas 161 Lennen, Jennifer 149 Leonetti, David 72, 161, 181 Leslie, Jill 149 Lessley, Michael Leverett, Noah Lewis, Kurt 114 Lewis, Matt Lindsey, Steve 49 Line, Lois 187 List, Robbie 136 Liston, Robin 149 Littlefield, Brandi 136 Locker, Vernita 184 Loeffler, Leigh 35, 38, 60, 149, 173 Logan, Mike Lomax, Brian 185 Long, Corey Long, Damon Long, Samenh Lookenott, Trish 149 Loomis, Darla 136 Lopez, Charlie 46, 71, 149 Lopez, John Lopez, Michelle 136 Lopez, Olga Loveday, Lori 26, 136 Loveless, Dave Low, Rosalie 136 Lowe, Andrew 149 Lowe, Jennifer 161 Lozano, Christina Luangsrinhotha, Deth Luangsrinhotha, Souk Lubner, Gary Lucero, Cheryl Ludwick, Laurie Ml Maberry, Jack 154 Mac Dannald, Jill 114 Mac Donald, George 115 Mac Donald, Scott 39, 136 Mac Lellan, Daniel Mac Lellan, Laura 33, 114 Macedo, Cheryl 161 Macias, Carmen 137 Mackey, Holly Madamba, Venice 137 Madrigal, Louis 114 Madruga, Robert 150 Major, Tony 75 Malek, Kathrine 137 Man, Than 150 Man, Thou Manke, Fred 185 Mann, Jeff 137, 174 Mann, Joe 114 Mann, Sam 161 Manrique, Lynne 14, 17, 19, 114, 173 Manzoni, Kenneth 72, 156, 161 Mapes, Shawn 114 Marasovich, Jeff 137 Marasovich, Jill 150 Marchese Chris 49 Marchese, Tamara 114 Marcum, Anthony 114 Marcum, Tana 161 Marcum, Trina 137 Markle, Sherryl 137 Marrical, Jody 150 Martin, Anna 31, 114 Martin Dionn 52, 68, 150, 174 Martin, Henry Martin Joseph Martin Julie 17, 19, 114 Martin Kelene 161 Martin Kristina 161 Martin Laura 161 Martin Marie 137 Martin Twyla 150 Martinez, Albert 114 Martinez, Anthony 150 Martinez, Brent Lugo, Brenda Lugo, Sherry Lugo, Xavier Luiz, Luiz, Brian 149 Michelle 161 Luna, Jeff 43, 114, 121 Luna, Matt 149 Luper, Bethanie Luper, Lanita Lykins, Darryl 150 Lynch, Robert 56, 161 Lyon, Daniel 150 Lyons, Craig 43, 136 Lyons, Dennette 161 Lyons, Shannan 60, 150 Martinez, Philip 31, 49, 77 Martinez, Steven 114 Maruyama, Dan 161 Maruyama, Robert Masciorini, Jennifer 51, 137 Masellis, Scott 114 Massey, Kristi 150 Mawyer, Tracee 137 Maxwell, Deborah 17, 35, 115, 209 Maxwell, Gloria Maxwell, Russell Maxwell, Tina 161 Mayberry, Donald Mayberry, Jack 155 Mayne, Ken 70, 71, 115 Mayo, Karri 115 McCabe, Kathy 115 lVlCCall, Kirk 19, 51, 150 McCance, Michelle 137 McCarty, Rose McClain, Alicia 137 McClain, Karen 137 McClain, Michelle 137 McCleskey, Kimberly 137 McCleskey, Walt 37, 115 McClure, Lynette 137 McCormick, Bo McCormick, Molly 6, 14, 20 35, 115, 137, 173 McCormick, Tammy 115 McCoy, Brett McCoy, Tracie McCreary, Martin 161 McCutcheon, Debra 137 McDonald, Corey McDonald, Larry 184 McDonald, Shannyn 161 McDonnell, Sean 137 McDowell, Tara 161 McGanney, Julie 150 McGhee, Sean 137 McGrath, Eric 161 McGregory, Don 137 McGregor, Richard 137 McGuffin, Jacqueline 137 McGuigan, Suzie 17, 18, 19, 36, 209, 213 McKee, Natalie 150 McKenzie, Elizabeth 137 McKinley, Melody McKnight, Marlo 150 McKnight, Ray McKnight, Tammy McLain, Diana 137 McLaughlin, Ray McMindes, Kathleen McNabb, Richard 35, 144 McNabb, Vilii 6, 58, 115 McNear, Melissa 150 McPherson, Chris 150 McPherson, Jennifer 161 McReynolds, Danett 68, 150 McRivette, William 184 Medeiros, George Meeder, April 137 Meegan, Gary 184, 186 Mejia, Romeo 31, 115 Mellinger, Aaron Mellow, Ruth 150 Mendieta, Brenda Mendonza, Brian 137 Mendonza, Stephen 161 Mendoza, Robert Merafuentes, Michael Merafuentes, Pam Merchant, Holly 19, 35, 161 Merchant, Melanie 14, 26, 35, 132, 137 Merchant, Steve 19 Merenda, Dorace 185 Merrill, Dennis Messchaert, Andy 162, 181 Messchaert, Renee 150 Messinger, David 150 Metcalf, Mary Mey, Sovann 161 Mott, Ardith 187 Moura, Michele 38, 150 Mueller, Sherri 31, 162 Muncrief, Lee 150 Muncrief, Missy 5, 116 Muncy, Diane 162 Muniain, Cassandra Murdock, Amy 76, 162 Meyer, Robin Meyer, Theodore 185 Mickey, Sherrill Miller, Brian 137 Miller, Karen 57, 150 Murphy, Chris 150 Murphy, Jane 150 Murphy, Kelley 20, 162 Murphy, Murphy, Kelly 68, 150 Timothy 150 Nix, Cindy 31 Nix, David Norcott, Diana 26, 116, 213 Norfleet, Dawna 24, 116 Norquist, Paul 150 North, jerry 187 Notaro, Eleanor Notaro, John 117 Nott, James 17, 43, 45, 215 Nunes, Rick 31, 150 Nutson, Jennifer 137 Panoussi, Christoph Paradis, Linda 35, 73, 117, 213 Pariset, Linda Parker, Anita 17, 52, 68, 152 154 Parker, Dana 151 Parker, Jessica 151 O Conn Miller, Lisa Miller, Ove 162 Miller, Regan 14, 26, 35, 132,137 Miller, Sandy 150 Miller, Traci Murray, Todd 162 Murrietta, Anna 150 Musino, Ignacio 162 Mustoe, Christene 137 Muy, Montha Myer, Robin 116 1 O Brien, Christian 10, 31 O Brien, John 117 O Brien, Patrick O Brien, Terri 162 ell, Renata 117 Olinares, Kristine Mills, Randy 116 Millsap, Jeanie Minder, Sydni 150 Minke, Gina 162 Mitchell, Erik 76, 77 Mitchell, Laura 116 Moeller, Kurt 37 Mohr, Analisa 81, 150 Mohr, jennifer 162 Mojica, Raul 150 Monday, Rich 140 Monks, Denise 162 N O Hallaran, jenny O Roark, Kim Nahhas, Alan Nakahara, Muneaki 180 Nale, Sandra 116 Nand, Parveen Naranjo, Michael 46 Naranjo, Michelle 51, 116 Nastrom, Jamey Ochoa, Claudia 162 Ochoa, Laurie 150 Ochoa, Rosa Ocken, Michelle 17, 19, 35, 117 Ogden, Chris 137, 173 Ogden, Tim 51, 72, 162 Ogle, Todd Navarrette, Christi Navarro, Fanny Summer 150 Montez, Denise 162 Montoya, Charles 116 Montoya, Greg 162 Montoya, Michael 150 Moon, Felipe 150 Moore Chrissie 150 Moore, Deborah 162 Moore, Jonathan Moore, Joseph Moore Karen 52, 162 Moore, Mike 150 Moore, Robert 162 Moore, Nazmi, Niloufar 35, 116, 120 Neal, Charlene Neigel, Mirja 116 Nelson, Heather 137 Nelson, Mark 14, 144 Nelson, Mark 49, 51, 65, 150,162 Nelson, Mike Nelson, Paul 56, 66, 162 Nelson, Ron 186 Newman, Brenna 19, 162 Newman, Kenny 43, 137 Newspaper 19 Olinares, Wendy Ollis, John 187 Olvera, Kathy Orchestra 33 Orique, Steven 39, 151 Orland, Devon 35 Orland, Merrin 35, 117 Orona, Craig 65, 151 Osborn, Diane 137 Osborn, Robert Parker, Travis Parra, George Paschall, Shana 151 Pasqua, Kimberly 117 Paularena, Biki 137 Paularena, Prank Paularena, Martin 51, 77,-14 Pearce, David 162 Pearce, Kathleen 117 Pearson, Craig 56, 144, 151 Pease, Roger 137, 174 Peck, Charlotte 186 Pedrioli, Robin 151 Pehle, Cindy Pehle, Derek Pelletier, Kevin 46, 151 Pelphrey, Debra 117 Pemberton, Tammy Penkivich, Paula 162 Periera, Andrea Periera, Michelle Perkins, Cheri 151 Perkins, Rick 137 Perry, Brian 31, 162 Perry, james Persano, Paula 151 Petersen David 137 Petersen Matthew 19, 117 Peterson, Darlene 187 Peterson, Darren 117 Peterson, George 187, 192 Peterson, Shelly 4 Peterson, Susan 57, 162 Mora, Ron 27, 137 Morad, Anet 150 Moradian, Michael Nicolls, Morales, Diana Moran, Jeffrey 116 Moreland, joe Morgado, Chris 150 Morgan, Brian 162 Morgan, Edward Morgan, James Morgan, Kenneth 137, 181 Morgan, Pamela Morgan, Shelly 137 Mori, Glenna 186, 187 Newton, Willetta 162 Nguyen, Dung 146 Nguyen Hop 162 Nguyen Huong Nguyen, Kiem Nguyen, Thanh Van Nguyen, Thi 162 Nguyen, Viet Niapas, Manuel Nichols, Hortense 186 Nichols, john 131, 162 Nichols, Marcus Nichols, Robert Ted 46,150 Osborn, Tamara Osman, Robirt Oswalt, Dede 137 Overlie, jeffrey 38, 46, 151 Owens, Ron 49, 77, 162 Oxley, Kenneth 186 Morris, Dana Morris, Oscar Morris, Paul 116 Morrow, Dana Moser, David 116 Moser, Lewis 150 Moss, Keith Niederberger, Karl Nielsen, Shelley 31, 150 Niemi, Ianel 56, 57, 116 Niemi, Michael 162 Nietmann, Rena-Grace 187 Nipper, Thomas 14, 24, 54, 68,116,190 ID Pacheco, Michele 162 Padeken, Gary Padeken, Michael Padgett, Denise 5, 38, 151 Padilla, George Padilla, Louis 43 Padilla, Olga 162 Palombi, Tobi 5, 73, 117 Palomino, Paul Palomino, Ralph Palomino, Randy Palumbo, Payelynn Pamperin, Deanna 131, 162 Panero, Rhys 5, 49 Panigiris, Michelle 151 Petrulakis, Dean 162 Petrulakis, Nick 6, 117, 173 Pham, Chau Pham, Tuyen Phan, Huong 151 Philipovitch, Dimitry 117 Philipovitch, Karl 72, 151 Phipps, Sherry 137 Pickett, Robert 43, 137 Pickett, Sean 49, 162 Piland, Kelli 10, 26, 35, 117 Piland, Scottie 117 Pinney, Russel Pinto, Jose 43, 132, Pipkin, Todd 117 Piper, james 188 Pitcock, Mike 43, 137 Pittman, Cindi 117 Plaster, Lisa 162 Platt, Alesia 151 Ploof, Dianne Plummer, Travis 6, 117 Poat, Teresa 162 . Podesta, Paul 137, 176, 177 'rasad, Pravina 162 ope, Licia 52, 68, 151 orter, Stoney 137 osey, Shawn 19, 162 oslaniec, Michael 137 ostley, Benny 44, 66, 162 otter, Shannon 151 otter, Sherrie 'owell, Ctayna 'owell, Necia 137 Jowell, Reggie 72, 151 Cowell, Vanessa 162 owers, Drew 162 Erasch, Marie 35, 118, 127 rasch, Richard 39, 162 Erater, Kristin 118 ratt, Dawn 35, 151 'ratt, Scott Eream, Diane restridge, Brandon 46, 151 Ramirez, Richard 163 Ramos, Ginger 163 Rancano, David 181, 188 Rands, Raney, Alex 118 Lisa 163 Roberts, Patty 163 Roberts, Sally 68 Robinson, Dorita 188 Robinson, Jamey M. Robinson, Kim 138 Ransome, Karen 51, 138 Ransome, Oke 72, 151 Rash, Steven 43, 138 Rattazzi, Jon 5, 6, 43, 118 Ravelli, Paul 46, 151 Reback, Lesa 138 Reed, Anne 163 Reed, Cynthia 138 Reed, Jeff 37, 138 Robinson, Timothy 49, 77 Robinson, Tracy 119 Robles, Eva Robles, Lily Robles, Chico 49 Rocha, Deanette 163, 181 Rodriguez, Araceli 163 Rodriguez, Armando 151 Rodriquez, Elena Reel, Susan Reeves, Curtis Reeves, Greg 138 Regno, Anthony Regno, Cynthia 138 Regno, Eugene 163 'rice, Denise 68 'rice, Robert 43 Erice, Sutton 37, 185 rice, Trish 118 trickett, Jeff 'ridemore, Brad 151 riest, Todd 6, 35, 71, 118 rinz, Lee Anne 162 ilrinz, Stephen 151 rock, Erik 118 rock, Kevin 152 roctor, John 137 roctor, Katrina 137 rom, Vanseng 49, 66, 71, 162 rom, Vansieng 118, 137, 213, 2.16 ruitt, Becky ruitt, Ronnie 162 rzekurat, Michele 151 grzekurat, Suzanne 137 Iiuccinelli, Kris 118 uccinelli, Nick 162 l uadros, Carmina uesenberry, Jenifer 26, 35, 151 uill and Scroll 19 uisling, Tori 118 ade, Angela 163 ai, Kim 163 aingruber, Robert 189 ake, John alph, Dick 188 Reid, Ron 118 Reim, Tom 163 Reiter, Spencer 162 Remides, Jerry 138 Remsing, Michele 151 Renfro, Kelly Renfroe, Julie 138 Renfroe, Lonnie Renner, John 163 Renner, Tina Rentziperis, Anne 68, 118 Renwick, Kate 163 Resso, Frank 31, 151 Resso, John 118 Reuber, Sandi 163 Reynolds, Robert 51, 75, 138 Rhodes, Steve 138 Rice, Sherry 38, 151 Richardson, Candy 118 Richardson, Robbie Richison, Tony 163 Richmond, Lisa 31, 151 Richmond, Robin 151 Rickard, Rod 118 Ridenour, Rich 138 Ridgway, Martha 189 Riggs, Steve 138 Rigney, Brenda 163 Rigney, Lisa 138 Riley, Jeffrey 46, 72, 152 Riley, Kelly 118 Rinehart, Dale 51, 77, 152 Rinehart, Lori 138 Rinehart, Michelle 163 Ringgenberg, Ryan 138 Roen, Brandy Roland, Jean 188 Romano, Jacqueline 188 Rombey, Reggie 163 Roper, Robert Rose, Beth 14, 51, 144, 151 Rose, Chris 152 Rose, Margaret 189 Rosenthal, Julie 38, 163 Ross, Matthew 138 Rowan, David 138 Rowan, Donald 163, 185 Rowe, Steve 152 Rowland, Linda 163 Rowley, Laurel Royalty Fall 59 Spring 79 Rubalcava, Melissa 119 Ruble, Donna Ruehle, Robert 189 Runyon, Mark 19, 119 Russell, Denice Russell, Tanya 119 S Sahai, Raagini 119 Salas, Deann 163 Saras, Andrea 163 Saras, John 46, 77, 154 Saras, Michelle 119 Sargent, Kristine 163 Sarkis, John Sarmiento, Christina 138 Satterlee, Jeanette Saunders, Jerry 43, 119 Sawyer, Craig 51, 59, 119 Sawyer, Dawn Saylor, John 152 Sbragia, Michelle 119 Schaffer, Todd 152 Schell, Charlotte Shell, Christina 138 Schell, Traci 152 Scheuber, Heidi 26, 138 Schilling, Mike 163 Schmidt, Michelle Schneider, Michael 43, 119 Schneider, Stephen 46, 152 Scholten, Sandra 35, 152 Schoonover, Agnes 190 Scoggin, Laura 152 Scott, Charles 163 Scott, Nancy 31, 152 Seifert, Stanley 152 Seitzinger, Joel Seitzinger, John Seitzinger, Mark 6 Sereno, Daniel 119 Settle, David 119 Sewell, Judith 152 Shannon, Terrie Sharar, Eric 49, 77 Sharp, Lisa 152 Sharp, Tonia Shaw, Charles Shelden, Phil 119 Sheldon, Tara 138 Shelton, James 152 Shelton, Jerry 163 Saldivar, Rodolfo 138 Saldivar, Sandra 163 Salter, Amy 35, 52, 138 Salter, Richard 189, 192 Salyards, Mike 152 Sample, David 138 Samuel, Christine 73, 119 Sanchez, Elvia 152 Sanders Ellen 37, 58, 138 Sanders Shelia Sanders Spencer 37, 154 Sanders Steven Ripley, Billie Jo 35, 78, 138 Risley, Scott 119 Rivera, Brian Roach, April 138 Roach, James 152 ameno, Martha 38, T38 Muriel 38, 151 ameno, ameno, Patricia 163 amirez, Alex amirez, Mike Robbins, Les 51 Robbins, Melissa 6, 119 Robbins, Michele 119 Roberts, Bobby 189 Roberts, Deanne 163 Sanderson, Cindy 163 Sanford, Crystal 152 Sannes, Cathy 19, 152 Sannes, Mike 163 Santana, Eduardo Santiago, Emmanuel 152 Santos, Karen 31 Santos, Rosemarie 119 Sar, Sivorn Saragoza, Stephanie 119 Shepherd, Aimee 24, 38, 138 Sherman, Scott 46, 152 Shervington, Monique 138 Sheth, Seema 14, 20, 35, 132 138 Sheth, Sonal 35 Shetley, Karl 119 Shimrado, Lawrence 138 Shockley, Brian 49, 163 Short, Danielle 31, 37, 138 Short, Gaymond 152 Short, Robert 38 Showalter, Erik 138 Shrum, Rebekah 78, 138 Shutt, Kelli 36, 39, 122. Sieferer, Sheila 68 Siefkin, Nelson 163 Sill, Kelli 152 1 Sillemon, Anthony 163 Sillemon Sillemon , Calvin Le , Carolyn Sillemon, Sharon 152 Silva, David 122 Silva, Dee Silva, Edie Silva, jerry 131 Silva, Ron 152 Silveira, Jim 163 Silveira, Kristi 152 Silveira, Suzanne 152 Silveira, Stan 43, 122 Simi, Dana 14, 20, 35, 122, 127 Simi, Ellie 5, 61, 152 Simkins, Everett TI Simmons, Christy 152 Simmons, Nancy 122 Simmons, Patrick Simmons, Sean 122 Simpson, Melanie 122 Nichelle 31, 163 Simpson, Singh, Adip 138 Singh, Baldip Singh, jasper Singh, Manjeet 38 Singh, Mohini 163 Singh , Sulochana 163 Sisney, Ray Skaggs, jeff Skeen, Christopher 36, 122 Skeen, Holly 35, 138 Ski Club 23 Skytta, Hanna 57, 123 Slaughter, Floyd 152 Slaven, Tammy 31, 138, 174 Slaven, Trisha 31, 163 Sleeman, Todd 123 Sleeper, Fred Sleeper, Norman 46, 152 Sloan, Clint Smees, Kirk 152 Smirfitt, Ross 152 Smirfitt, Todd 123 Smith, Amber 35, 123 Smith, Bobby Smith, Bryant Smith, Danelle Smith, Debora 81, 123 Smith, Erica 163 Smith, jacob 66 Smith, Kelly 35, 152 Smith, Kelly 26, 123 Smith, Marvin Smith, Pamela 152 Smith, Richard Smith, Robert 178, 190 Ron Smith, Smith, Shelby Smith, Tony 138 Smullen, Greg 5, 138 Snelling, Melissa 152 Snow, Sherri 138 Snyder, Cheryl 152 Soares, Tammy 123 Soccer Varsity 70 EroshfSoph 72 Girls 73 Solanki, Kavita 38, 163 Songer, Vickie 152 Sorensen, Gitte Sory, Steve 123 Souza, Dan 43, 138 Souza, Debbie 152 Sparkman, Henrietta 181, 191 Spector, Hillary Speech 20 Spencer, Sonya 36, 123 Spirit Leaders Fall Varsity 58 Soph 61 Erosh 81 Spring Varsity 78 Soph 81 Frosh 80 Sprinkle, Geoff 17, 123, 214 Sprinkle, Gregory 38, 152 Sprott, james 46, 152 St. John, James Stafford, Richard 190 Stagno, Marni 123 Stai, Chris 138, 176, 177 Stai, Laura 35, 163 Stamos, Spiro 152 Stankiewicz, Anita Stankiewicz, Christine 123 Stankiewicz, Monica 138 Stanley, Shannon Starck, Dan 43, 138, 176, 177 Starck, Margaret 27, 35, 152 Stark, Ron Starr, Caril 152 Starr, Michelle 123 Statisticians 94, 95 Stearns, Sherry 35, 123 Steele, Barbara 190, 192 Stenson, Derrick 152 Stepanovich, Richard 43, 59, 123 Stephenson, Larry 152 Stephenson, Lorrie Stevenson, Carmen 35, 138 Stevenson, Laura 123, 138 Stewart, Angela 123 Stewart, John Stewart, Marilyn 190 Stewart, Shar'ron Stice, Candi Stice, Frank 43 Stice, Howard 138 Stickley, Matthew 138 Stiles, Brian 123, 185 Stiles, Stacy 31, 163 Stockdale, Mike 36, 163 Stone, Christine 152 Stone, Jeffrey 31, 123 Stout, Elaine 152 Stowers, Casey 163 Strauman, Susan Strauss, Randy 14, 121, 123, 172, 173 Strobel, Karl 121, 124 Stroud, Sherri 124 Stuart, Robert 191 Student Council 14 Suarez, Gabriel 43, 139 Suelzle, Stuart 139 Suggs, Kathleen 139 Sullivan, Scott Surber, Robert 38 Sutter, Leigh 81 Sutton, David 163 Suva, Monica 152 Swafford, Lester Tillak, Navneet 139 Tillery, Kelly Tim, Voeth Tipton, Randy Toal, Leota 190 Todd, Chris 164 Todd, Mike 164 Tondre, Rick Torre, Darryl 82, 189, 190 Torre, Suzanne 57, 153 Townsend, Jeff Townsend, Lisa 164 Sweeten, Harold Sweetman, Susan 185, 191 Swicegood, Jamey 181 Symington, jimmy Trammell, Mike 153 Tran, Dee Tran, Hai Tran, Ken Tran, Linh Tran, Quyen Hue Tackett, Derrick Tackett, Doug 43, 39 Talbott, Elizabeth 124 Talley, Paul 124 Tanasescu, Sorinel Tanasescu, Viorica Tanquary, Tina 139 Tapia, Miguel 49, 163 Tar0, Rob 43, 139 Tarr, Randy 9, 24, 163 Trimble, Gary 191 Trimble, Jonathan 153 Trindade, Laurel Trio, Kelly so, 164 Trio, Louis 43, 139 True, Dawn 139 Truong, Chau 124 Truong, Chu Truong Dan 124 Truong Hoang Van 153 Truong Ken Chi 163 Truong Khim Tarr, Rick Tayahua, Christina 163 Truong, Lien Truong, Thanh Tubman, Alix 6, 51, 59, 121 124 Tucker, Preston 164 Tucker, Richard 164 Tuggle, Todd 43, 71, 139 Taylor, Rick 124, 213, 216 Taylor, Sheri 163 Taylor, Tracie Taylor, Wayne 163 Taylor, Yvonne 178, 191 Telford, Rich 49, 164 Tennis Girls 51 Boys 82 Terrel, Rhonda Terry, Beckie 164 Teves, Rosa Theadeuas, Edward Theuriet, Mike 124 Thomas, Lisa 19, 35, 124 Thomas, Sharyle 139 Thompson, Candy 156, 164 Thompson, Dave 54, 124, 173 Thompson, Kim Thompson, Randy 139 Thompson, Scott 152 Thompson, William 178, 190 Thomsen, Scott 43 Thorne, Jennifer 153 Thornton, Thomas 124 Thorp, Dawn 124 Thrasher, Jeff 152 Thurman, Shauna 17, 31, 124 Tibbitts, Jimmy Tidrick, Bret 65, 153 Tidwell, Larry 153 Tillak, Barney 153 Tull, Brandy 139 Turner, Andrea 124 Turner, Elaine 164 Turner, Kim 124, 127 Turner, Richard Turner, Teresa 164 Tweedie, Tim 191 Tygart, Kelie Tyler, james Tyler, Latonya 164 Tylman, Al Tylman, Nancy Tyner, Ryan 153 Tzagarakis, Christine 14, 35 144, 153 Tzagarakis, Elaine 5, 14, 17, 19, 35, 132, 139, 173, 214, IU Udell, Doug 31, 153 Ugar, Kevin Ugar, Tracey 61, 153 Ulrich, jackie Umsted, Josh 125 Usrey, Shelli 153 Utley, Kari 215 W 7ader, Barry 153 falencia, James falera, Aaron 164 Valera, Robin 125 'alk, Helen 191 lalle, Moises 'an Buskirk, David 164 'an Lier, john 164, 181 'an Walterop, Katrina 35, 139 'andervort, Frank 192 'andervort, Heidi 14, 139, 140 largas, joe 153 fargas, Regina 164 lasquez, Ron 164 'asquez, Yvette 153 'aughan, Eric 38 Vega, Gina 19 lerduzco, Richard 164 'erfurth, Pat 164 'ICA 36 'ieira, jim lee 'ieyra, Victor 51, 75, 153 'ieyra, Vincent 51, 75, 164 Vilas, Lisa 19, 52, 164 'in, Bunleang 'ines, Mary 161, 164 'iste, Vicki 51 'oelker, Matthew 'olleyball Varsity 52 j.V. 52 'ossoughi, Robby 72, 164 'regdenhil, Robert uong, Loan 164 1 W Vade, Julie Vakeman, Corinn 153 Vakeman, Jamie 125 Valker, Patrick 153 Valker, Paul 153 'Vall, Brett 43, 45, 59, 125 'Vall, David 139 'Vall, jimmy 51, 125 'Vall, Kevin 164 Vallace, Deanna 125 'Vallace, Janice 192 'Vallace, Yvonne 153 Valls, Chelsea Valsh, Tim 164 'Valters, David Walters, Greg xxfalters, Jeannette 164 Valters, Mullady Valters, Lynn Valters, Tammy 164 Valters, Tracey Valthrop, Mike Wlalton, Charlyn 164 'Valton, Rodney 153 'Vard, Betty 193 V Ward, James Ward, Phillip Warda, Ramsin Warden, Ami 20, 73, 164, 213 Warden, jennifer 153 Warden, Tracie 20, 24, 125, 213 Warnell, Edmonia 213 WASC 173 Waterman, Stephanie Water Polo Varsity 54 FroshfSoph 56 Girls 56 Watson, Brian 153 Watson, Debbie 125 Watson, Lori 31, 125 Watts, David Watts, Dona Watts, Robin 58, 125, 127 Watts, Steve 164 Weakley, Don 125 Weakley, Kathi 60, 153, 173 Weakley, Kelli 68, 153 Weatherly, Tina 164 Weatherly, Tom 139 Weaver, Allison 139 Weavill, Herbert 192 Weaver, Mona 165 Webb, Chris 139 Webb, Lew 165 Weber, Cherish 165 Weber, Tom 192 Weidman, Scott 165 Weiglein, Mark 153 Weiss, Scott 14, 35, 43, 75, 12.5, 12.7 Weiss, Tami 51, 153 Welch, Dino 37, 139 Welk, Tryna 139 Welk, Valerie 165 Wells, Phillip Welsh, Michael 153 Welsh, Shawnda Wemyss, Tami 125 Werner, Doug 165 Werner, Keith 139 Werner, Mike Wesner, Wanda 165 Wessling, Howard West, Carolyn West, Tabatha 153 Westfall, David 165 Westfall, Robert 125 Westley, Tina 139 Westman, julie Westmoreland, Myrna 183, 192 Westphal, Dwayne 193 Westwood, Mike Wettstein, David Whala, lohn 43, 125 Whaley, Kathleen 153 Wharff, Richard Wheeler, john 165 White, Andrew 153 White, Ken 139 White, jeff 125 White, Kyle 153 White, Mike White, Staci White, Wendy Whitehead, Brian Whitely, Robb Dean 153 Whitfield, Sandy Whitford, Allison Whitford, Michelle Whitford, Merlin 193 Whitney, Dave Wiese, Mike Wiggs, Terry 49 Wignall, Sylvia Wiinikka, lan 153 Wilbor, Eric 125 Wilkins, Kim 139 Wilkinson, Darin 139 Wright, Marcia 192 Wright, Mark 9, 31, 165 Wright, Martha Wright, Matt Wright, Monica Wright, Philip Wright, Rod Wright, Shane 24, 153 Wright, Shawn Wright, Tara 165 Wright , Tom 140 Wry, Mike 153 Wry, Pam 126 Wyatt, jennifer 165 Wyatt, Meri 20, 12.6, 172 173 Wyke, Kathleen 153 Wyke, Wynn, Kristen 140 Christina 165 Wilkinson, joe 165 Wilkinson, Lonnie Williams, Barbara 19, 153 Williams, Chance 49, 165 Williams, Darlene 153 Williams Gary 165 Williams john 165 Williams joanthan 139 Williams Joni 41, 51, 76, 139 Williams Juliann 139 Williams Larry 165 Williams, Mark 49, 165 Williams, Melinda 165 Williams, Robert Williamson, Darilyn Wilson, Deanna 1 X Xayarath, Khamsy Y Yant, Tom Yarbro, Bryan Yard, Dana 31, 165 Yearbook, 17 Yeo, Maria 140 Yepez, lohn 126 Yohannan, Lori 153 Yost, Bill 126 Yost, Mark 43, 140 Youhana, Aneta 140 Youkana, Ashour Youkana, Sargon Wilson, Debbie 165 Wilson Jeff 37, 125 Wilson, jeffrey Wilson, Kevin 153 Wilson, Melissa 58, 76, 139 Wilson, Michael Wilson, Mike 125, 139 Wilson Paul 51 126 Wilson , Shirley ,153 Winning, Tami 165 Winsor, Ken 165 Wissman, Dale 54, 126, 171 Witthoft, Frank 139 Witrhoft, Richard 68 Wolden, Stanley 192 Young, Brenda Young, Kris Young, Michelle 153 Young, Trisha 153 Youngheim, Marlene 10, 17 19, 126, 209, 214 Yunt, jeremy 72, 165 1 Zacharias, Geri 154 Zak, Mitch 49, 66, 165 Wolfe, Robin 165 Wolford, Kevin Womack, Kimberley 153 Wong, Ellen 153 Wong, Joe 36, 126 Wong, Wendy 165 Wood, Greg 153 Wood, Joanne 31, 126 Woodward, Mike 56, 57, 153 Woolf, Eric 153 Worrell, Helena 153 Wrestling 77 Wright, lonna 165 Zamora, Autumn 165 Zamora, Daniel Zapata, Armando Zavala, Rosalina 140 Zepeda, Michelle 140 Zirkle, Cathy 126 Zoodsma, Marion 192 Zoodsma, Paul 14, 35, 121, 126 Zorn, Todd 165 Zuiderduin, Cindi 153 Zwahlen, Ann 9, 26, 58, 126 Zwahlen, Brad 49, 66, 165 1 wma, Qgggiwmwulgqncqx Qwwwmpbeuwmgwwwmbdfwg UwwTW.i?wm ,1JJBAmQL JJSKU ,UXQOJQ C1QjL!L' mmm OL,QcQf,VwQjCjrfwiL6LcLc2.J 7iA,,v0,wLQ,wQ MQCLJ5ML,MQ,fQwWuw fUbJwQHfDQwuQQ 4Zg5U iC0QUQwM3f?D1fWfM, wkfmwwmdwudgudfm fefkwmwsimfwm Qgmmgwlwvwwm OLD ,LQJWQ Qfvvvuou a,QQfUm i gb Q ilgyk Q5 Swim? fpwmx ffglgwuwwnmb, dw' OWS Swfwxgiximm QAMJL MM 52525 24 , gm! mx2, Qumxfmldfsi ws' WIXQQXSQSSQS CAV 655555 4 WK57LfY16r6fZhcf W5 NLSG been KVM bm? frfl fddf Cfdfi, I ffm! 5'U'075J Vwf C'Offq,Mfyf ,Ufwf Q rf'rmf5f4'fkl 7!fP0ff' K5 'QV b6f'ij4 -Phare wmv! I weedef! jofgeonfie +0 .Mfg +G, ffwff Q 300. U Wifi H6796 Q4 fee ypy ,AJ QAM cfm, if Know Ji mmf' have bday i4 jjdrlld fm +A? ,bLff7L jgme!-mpg' l,lgpf7y ff w4el4S, Lvoue 14540475 h MJ? my Kee? 'N fwck fggfjcghyf 570 'OZ5 7 M0325 Po, cf4L'v1Qof'r1,5:h 95350 - 'fVL 1Jb. LQQ,5QYYj QQQQQYUD ,- AJUHKA wwmcb, All QW CL QSLQCu1 JQQCfLQVM,, fl JLOQM5 ,Mm U umm Mwmmcw Crm 2131316 Jug gm! md Cf, VQUUM QV A mg V50 Liam Jww ,550 SUJND, JMU WLC kqxilflfl kf.,0f.CMEUJ!f1fUf Maw CL MLW 5 WWMA CW Cl 'KM Uwe UQJ QWD L


Suggestions in the Davis High School - Olympian Yearbook (Modesto, CA) collection:

Davis High School - Olympian Yearbook (Modesto, CA) online collection, 1966 Edition, Page 1

1966

Davis High School - Olympian Yearbook (Modesto, CA) online collection, 1986 Edition, Page 1

1986

Davis High School - Olympian Yearbook (Modesto, CA) online collection, 1984 Edition, Page 208

1984, pg 208

Davis High School - Olympian Yearbook (Modesto, CA) online collection, 1984 Edition, Page 244

1984, pg 244

Davis High School - Olympian Yearbook (Modesto, CA) online collection, 1984 Edition, Page 233

1984, pg 233

Davis High School - Olympian Yearbook (Modesto, CA) online collection, 1984 Edition, Page 51

1984, pg 51


Searching for more yearbooks in California?
Try looking in the e-Yearbook.com online California yearbook catalog.



1985 Edition online 1970 Edition online 1972 Edition online 1965 Edition online 1983 Edition online 1983 Edition online
FIND FRIENDS AND CLASMATES GENEALOGY ARCHIVE REUNION PLANNING
Are you trying to find old school friends, old classmates, fellow servicemen or shipmates? Do you want to see past girlfriends or boyfriends? Relive homecoming, prom, graduation, and other moments on campus captured in yearbook pictures. Revisit your fraternity or sorority and see familiar places. See members of old school clubs and relive old times. Start your search today! Looking for old family members and relatives? Do you want to find pictures of parents or grandparents when they were in school? Want to find out what hairstyle was popular in the 1920s? E-Yearbook.com has a wealth of genealogy information spanning over a century for many schools with full text search. Use our online Genealogy Resource to uncover history quickly! Are you planning a reunion and need assistance? E-Yearbook.com can help you with scanning and providing access to yearbook images for promotional materials and activities. We can provide you with an electronic version of your yearbook that can assist you with reunion planning. E-Yearbook.com will also publish the yearbook images online for people to share and enjoy.