Alfred University - Kanakadea Yearbook (Alfred, NY)

Text from Pages 1 - 264 of the 1928 volume:

IM ESQ 5 My 4 1 COXL i Q 76130 f ' Q '39 5 '1. V . ,',f ...L fn...-, f..-qw4A.,g, YV YY i F- ,H ... ...Lu A .- V 4. ., dn-A I - C I R 1 Y x Q r U 5 1 : ! 3 2 ! K X? 1 v F I 1, 1 i' ' . . P I 7? I Q J! x k 6 E ' 3 T L - Q D J 5 i 3 I , x i 9 I 3 - J 5 Q , , 3 3 4 1 1 y . I E Q a Y 1 ' Xxn - .3 gf 15" X 1 KK ,XX 'ex IX'4!5lq ' fx Xxx 'f Rx' 'S K X741 2 X if X pG ' -x . -usp.. 31-Qi K -.-,-V ,,-.--v 'K .f Y gr' 'C 1928 KA AKADEA OE TRADITIO VOLUME XXII lSo vi' 4: z ' E CILI-9+ A PUBLISHED BY THE JUNIOR CLASS of ALFRED UNIVERSITY Editor-in-Chief Buxinem Manager RAYMOND' E. FRANCIS ROSS Wu. ROBBINS W Q X M 5 X -. w !. A N 'Q 4 w ,A +4 W xx Nw wk' lA , I R N 4 s A wk A ,M ...A -" Behiratinn een in the heartei nf true Alfrehiana linen a gearning ann a hnpe fur Elhe Eream Alfreh. Elt is a :spirit akin tn the pnnrer nihirh gniheh nnr Zlifing Alfreh ntnlh in pathluagz uf learning, anh gentle- nesz, anh gnnhg it in the fnrre nrhirh preeuiez eagerlg nnnrarh tnnlarh a gual hut hirnlg neeng it in the uiainn nf hnrnankinh nrhirh hehnlhn zaluatinn in a trnth nrhirh nnlg knunilehge ran tearh. lllilhe Erearn Alfreh-a hmne nt' learning nrhnae fame zhall get anew the pare nt' hnrnan prngreaag mhnze tearhingei ahall nnreaainglg geek the light nf truth anh fair- nemag nihnze hallz nhall ever hnlh fnrth melrnme tn the murlhyz 1UhU5P inflnenre fur gnnh ahall glnm an a hearnn arnih the rnuertz nf malire anh rniefnnher- ntanhing-an Alina Mater nrhnze rhilhren zhall fnl- till mimainna nt' ,aeruire anh pnrpwae, anh rarrg nn the nmrk nf the nmrlh in genernnz ineaanre. CH Elhnn, aa reuerentlg me hniell npnn the pant anh gaze with farzeeing egea intu the fntnre, hu me hehirate this unlnrne nf the "lCanakahea" tn Cilhe Brearn Alfreh, with the hnpe that in time tn mine, the guazarner nf nnr ilrearna zhalltalie fnrrn. ... .,- --- ,lf Y- - "In Youth we ought industriously to occupy our minds in the attainment of useful knowledgeg in Man- hood we should apply that knowledge to the discharge of our respective duties to God, our neighbor, and our- selves,' so that in Age We may enjoy the happy reflec- tions consequent on a Well-spent life, and die in the hope of a glorious immortality." -Unknown Table of Contents CAMPUS VIEWS FACULTY ALUMNI SENIORS JUNIORS SOPHOMORES FRESHMEN AGRICULTURE A ATHLETICS ORGANIZATIONS TRADITIONS AND FEATURES "The pure, the bright, the beautiful, ' F1 F1 'fiat stirred our hearts in youth, impulse to a wordless prayer, 'rlhe "ne dreams of love and truthg he F1 he fi longings after something lost, he spirit's yearning cry, strivings after better hopes- Qiese things can never die." -Sarah Doudney ' 'ff' fy--Q--LH I-.-up-.-.adfgg an -,s " " mv-M i I i 5. I 5 H ai 1 1 2 ii 1 I 1 l V 1 1 I , 1 1 l Q ! 1 L r E I l F v x 9 r A I I i fm-1:wW1 - . ,1- -9145-8 'Y' i Q, 5 X. 1 'v autism- : ,,,..m,.., . fi-an -ill!!-iv' 1 ,a as i 1 I I ,A Y Q xxx , X .' .4 x , , ' x ,bf T. 1 ,Ji -v , l 2 aw F 5 ,-fwa,.,,. .W , i 1 4 J i I I i 4 1 4 4 1 I r 5 I I I K I i i r N A i N 1 ,. V V, 4- E ,, Q as 4 s K f J K k 9' 1 ', G Y ss xl 1' Ninn 0-v.,Y1' 1' n Y 'N ,sn 'W X ,gig XNW , w.,..f sk '1 1 X "--1 ,:f'f I " N n- . u,- , s .- "' M " .nu i xvx W fn Nui 2' 1 5 4 4 3 9' 3 QA , l 5 tru E ' s Q ' ' , Q11 'iff " A ,' af xl o ' ' A . mg my P5' A", fwrxbx A he-f. A, A Nan A., 4 X We 'A K ' " ,K . 5 Lau A 3- 'U "f, '-mind, 'QQ-Ilia Q ta K ., 1 Fa xwv 1'-' . 'ug ' 1 . F 1,41 fm' .wl, 5,- r,' af . 1 L . . ,J , .-w- Q , 55 if .Q dune S A., . ,, 9-E' O ,- 1, A, .,-1' - 'H 1 Y . 1. AX X. '1-lv N I ...Q ,sw '1z.r',..z.... -1 1 .-9? x: X Q - K ilu illlemnrmm WILLIAM WALLACE BROWN HAROLD WILLIAM BEGEL His heart and his hand both open and freeg For what he has he gives, what thinks he showsg Yet gives he not till judgment guide his bounty." -Williaviz Shakespeare 1 I 4 1 'a Q1 I 1 0 5 I. , 1U-WXHEUiMlQi1?i?W lWi1l5kKHINHWWMWUWASWHHWUHSHWMWKIEEHEWWWEWEHEHXISHWX1WI?WllHl!i3EHit1Hi?fe N lf, f 4 I 1 1 . w 1 llikffiiifzii ?? ,, Q ,, 54,1 P 4 4 1 f H . , . . , . 1 , , A . f . , , . ' f A ,A A A, , ,A . , 5 N' 1 ' 'V I' 4 . ' 4 . X .f 'A " KN xx -,X M M xx Q 'J, v Y KX 1 x NJX,m 'IQ' ,,1, , U ' U 5 'XX g J L, ,Q " " 'F In h its I-Q 'I , 'QQ v x I x'mQ i. :V f .QQ--'NW YL!! . xy A V ' L VI If I E" ' 5 x f KX M M MY D7 K f f L 1 A 1 'v-Q-.if M-xmrm ,, ... 4, nm fVi-, gm., f .L V,.,-'ul'YA' gi ui . g 1gxEii,1 ' -A1muvufm1xmiugaluimu..mim1u..1i1411'au mimnmlmUAnAnfnm3 iu1'1rL1f1'Inrjwmmu 1 Q M Q,!Af I1-t m rv mu I ra 1 u' w1m Lif1mi1 ,n,1i'r 1 1 5 r U s Q an m ,ph ! ' Fx ' . 3 X-A f' if 1 :A 1 4 , X ,A V 3 ul-xxx V Qu xl' it 'X 'X' wi , '-L. X M fi " 1, ggi, Wi wi 5? X Fi-mmf? Q f 77 fig 35: I- EV 5 I 41 Q QQ' wi sf if ,- X Y sa - ., Q55 " if I: H 2? I 5 f 'fl 5 is - Q X9 l f: N 'Wm gf. FI QE I ' E fi'-f l V ? WE 4 M CQ X : vox E X ? Y, 1: Il . 1 X E V1 x F-I 4 ' ' i XX-gf ' S ' f 5 X V 5 y E : gj H 2 Y ,fi E K L I N uv, . Q F, 4 I I n in f if .E ' 1E f 5 u f rf E 1 W : :'J Q-E iv l if E , K L.-' Es , QE w if l , 5 - 1 1 2 X 4 ii 5 f Q, 2 1 y :Q : , , f: 5 E fu N' Q ' s....ff' f .' -1 T :Aw 5: 1 RX L' J t 'A f ,. ,- I A ' : 5' EQ' Q A Q' 2:- 2 ' gf- 1 f - - 3 X X E at ' E2 X g f I :fa 1 -' i I V "' In K : 2 w 5 Eg r f fm 55 ti -'W 'E 5' :' 5 gy "H I Q X J :E n If ,E ib 1 'x ea -1 E , EEA -v - , ':'. -DEW! 2' 1 ' i I E ' 5 K ' 1 3' 9 if 'nul l- 1,n1 1 . - ,, , I f - 1 112 P ' V .I f . I5!4..c:... E T.: Q 'V : :Z Q - I S 'lY -Y' 3 " ' -Al .f 'W I ' We ,Q ,X Qry. L ...x M dn' f SErFii'iii7ii'i fiii' s.iiii' a L V l u A liiil l l l l l l l l ' I l l I I ' ' ' ix -4 4 " Q CY or - ' ' ' . 5' ' ' ill 'I' if 3 X X Q5 si 4 e m 3: V M 5 4: "-If 3 E E: . ' If 'Sm fi XM E 5 L' 'I ' f Qt f' PE J ...I l ' ,QE -5 ' j -6 X 5 , .-:Q ' 'Ga57!!llIllll!!!!!!!l!!l!!l ,. ,MLLLLULLM,H,u1lLLLl1l-'JM-LUlllLQll , , : ' Q A L. F. U ML A ,, , 1 "' N EE r - 60 - MQ Mah E1 l mf - f X EXW-ff C5 1 ..-1 ' "-ef, is w 1' 9 'if' f .,,,. f 2 -9 'T v m ,, -3 fl' l .1 sf s 5 f 2 K fl, QL 5 5 'E fl A. ' u -Xkffmxxv , ' E2 ,' immlilllllll IIIIl'Il'illillllllillillllIlIIi lllIliiIIitil-IKYWWT f fif ' ' K " , Y ' fiil ' 'Wifi 3111-liiiiiiiliiif Tlliillgl ll iliHl'll'l1'llllE .,.' ,, A ,,.,.A ., ' Rx 4 514.24 , x t s , """ A , A . A 4 effrfi-ret - . A ,-A. A y If-cfs-S S size I A AA I r ssfwsessfpsfeigj A X 3 f A 5 t Y , t fi O S ROGERS B. FRANK LANGWORTHY . BRA ' F irst President of the Board of Trustees Presvtdent of the Board of Trustees l I I Board of Trustees l T y OFFICERS if y ORRA S. ROGERS . - - - President I FRANK L. GREEN . . If zce-Preszdent T l D. SHERMAN BURDICK . . Secretary , CURTIS F. RANDOLPH ..... - TWU-5'11"C"' ty T A UNIVERSITY ORGANIZATION t V The Board of Trustees of Alfred University is a governing body consisting of it thirty-three members. They are elected by the Alfred University Corporation, which . is composed of the members of the board and of those who have subscribed one hun- ' 4' dred dollars or more to the permanent funds of Alfred University. The members of l .,A: I the board are chosen for three-year terms and are elected annually. Eleven men are , chosen at each election, so that at no time are more than one-third of the group inex- b A perienced in confronting the problems Of the university. It is the duty of the Board 'I of Trustees to manage the affairs of the university, to have charge of the university M 3 property, and to elect the president and members of the faculty. The Board of i' p A Trustees of Alfred University is the legislative and executive body of the institution. 5 ttrf ltr! lltl l it l l vL"""""'nfffW"'--f...,,f""":wx ,Q--f-----. .-f-""-M. ity? drgrst 2-qw-F.,gS.,..,- '- 1-r..M,"f't,,A.-.. ' t l li byff44Er"7Lfi3,,,rf'i',I1r I I g .?'j.:Sf' Twenty lr. fr Xt Pt A A Qi t f 1 1 it rt i pt llr , gl 'fl we l I U 5 . t t , J A ,tt it lt lt tri i 1 at sr V 5 Y' 'xx i .. M-an , . 1 X - X, X A Y N. -'K' i i ,M . ' 'xv lx ',,.n,fl 'KSN I'v-NKWLQI -'-.4-I'-" HK-ex --M""'-2-.L .,.---as----C,,-.f-'eff-1..-,,: .. A-', --- --- -nu-' s -..tI,,v.-in ---. 'xi y I N X fi ru ru- X 'A A V V V J 1, .LV . T, ,, , - - lf QL, 'i A ,lf f-A ze' ,Jw " ., s , 1 ' 'WH' V -,,94-Q5,-1,.-ww X A,fXXuf,X"s5 mi ........- i,,.,,.urf .,nLW,.... ,4,,NY,,, 1 ,ww -1 X. WILLIAM COLGROVE KENYON JONATHAN ALLEN First President of AU'red University . President of AUred University 1857-1867 1867-1892 Makers andpounders of Alfred Tradition is the incarnation of sentiment, loyalty, and reverence. It instills the spirit of devotion in the Hold", impels the spirit of loyalty in the "new.,' As a whole, it serves to maintain ideals of yore and to inculcate those ideals in the present. Because this issue of the KANAKADEA is dedicated to Tradition, it behooves us to present a concrete digest of the significant stages in the evolution of Alfred Univer- sity in memory of those Alfredian educators who founded our University in toil, cemented her with blood, and nurtured her through yearnings and tears. Our University began its organization as a select school on the fifth of December in the year eighteen hundred thirty-six. At that time, thirty-seven serious-minded lads gathered in an upper room of one of the humble dwellings of Alfred Center, under the tutelage of a young student of Union 'College-Bethuel C. Church. The first organizer of Alfredian education, then, began his career with a vim and vigor that made its prosperity inevitable. Mr. Church was a man of great ability, and through his indomitable enthusiasm and perseverance, the first select school at Alfred reached the height of its first evolutionary growth. He was succeeded by James R. Irish at the completion of the Hrst school building at Alfred in the year eighteen hundred thirty-seven. Mr. Irish maintained the stand- ards of his predecessor, and through his tireless efforts the select school assumed the title of The Academy two years after his appointment. At this juncture, pastoral duties necessitated Mr. Irish's resignation of his principalship. - William C. Kenyon, another student at Union College, was offered the vacancy occasioned by the departure of Mr. Irish. The final act of the academy's incorpora- tion, however, did not take place until the thirty-first of January in eighteen hundred y f -- Ye e '. 'J g fr ft - A 'K , 1 . IL ' L' - -ft if' t ,'- 56 mfg-T In ' H f 1 if -- AL I JC -'AXJ ' ll 'L i n I Ir- f Twenty-one , ,iw ...Law n.,-...-1:-.n,...,ws..L,...- y1f4,.t,....-e1-,,g.d--A f3f.fl,""rff.-,"s- i Vey if if .ff af if is ' f c s L, is an - W I ALPHEUS B. KENYON ARTHUR ELWIN BIAIN Acting President of AU'1'ed University Presidellt Qf -'mired-I '11l'eV-W!! 1892-1893 1393-1390 forty-three, when it Was directed that The Academy thereafter be called Alfred Academy and T eachers' Seminary. 'NIL Kenyon, with the co-operation of a staff of enthusiastic colleagues, promoted a great intellectual influence through his stirring addresses in the vicinity of Alfred. In View of his loyalty and devotion, Alfred Acad- emy attracted many new members and its influence was established in Western New York. Consequently, in eighteen hundred fifty-two, steps began to be taken in con- sideration of the establishment of a college to supersede the academy. Feeling aroused enthusiasm, and enthusiasm the incentive to act. with the result that the Legislature of the State of New York finally granted a University charter to Alfred on the twenty-eighth of March, eighteen hundred fifty-seven. Mr. Kenyon then assumed the duties of president which he fulfilled capably until his death in eighteen hundred sixty-seven. Upon the death of President Kenyon, a unanimous vote bestowed the honor of succession upon Jonathan Allen, a devoted "loyaltee" of the l'niversity's faculty. President Allen guided the fortunes of the University until the day of his death on the opening of the school year in eighteen hundred ninety-two. During the period of his services, Alfred University prospered greatly and her influence spread to many parts of the land. President Allen directed the University's affairs for twenty-tive years in tireless effort, loyalty, and devotion to the Alina Mater he had loved so well. He died at his home in Alfred on the morning of September twenty-first. eighteen hundred ninety-two. K Professor Alpheus B- KQHYOU, Head of the l7epa.rlinent of iilatheinaties. was aPP0111ted Acting President of the University at the death of President Allen. Presi- fI1iLdE?yon performed his duties with great faithfulness and eapahility while guid- tifn au d gligiifsity s Welfarevduring the year eighteen hundred ninety-I wo. llis devo- n u 1 u carel . . iave gained for hun the .idlnlralion of all true .Xlfred1ans. , .-,x,,f-f-.AX pf,-in-A , S ,v -F. F .kt N V..-.--e New ., V- ., K 1 , , .. fx ,f-sg. .X A -: .x .-A ,..,,. e ,W . - , I f:,..3s,ff,ff . . A- f.. Twenty-two f it it l .his 'A pl f l A P ii ll 1 ,4 .ig gl il le - i' f 4 5 l lk N in its if E fx? . Zi N 1 if V 'N H u if lx ' 'X li. , W, 15 ...V lx ' ' jf M bil? .. X , . ,N ,.. I u s.. 1 x ,. ! A., . ...,. A in.-h 2 5 . i , x K . i yi! M l r i , , 1 Boofrnn COLWELL Davis President Qf Alfred Universzly 1895- The Board of Trustees then selected the Reverend Arthur E. Nlain of Ashaway, e ethical ideals and eruditional thoroughness of President Main accelerated the University's progress and elevated its moral stand- ards. The call of the pastorate necessitated President M8-1D,S Withdrawal from the U ' e sit three years after his appointment, to the regret of many of Alfred's mv r y adherents. In nineteen hundred one, Reverend A. E. Main returned to our midst to uties of Dean of the Theological Semin ary which he has executed ever R. I. to succeed President Kenyon. Th assume the d since with excellent thoroughness. On the resignation of President Main, the Reverend Boothe C. Davis, pastor of 'd t. the First Alfred Church, was appointed to carry the cares and Worries of presi en President Davis has been, and still is, ever Working to promote loyalty, devotion, . . . . ld d intellectual cultivation in Alfred as Well as to lead the University to unpara an leled heights. His excellent guidance and sacrificing efforts have endeared him to the hearts of our Alumni and students. He has but recently presided over the Ninetieth Anniversary of our University, feeling the pride of one Who has devoted his life to the dvancernent of culture and sane morality. A a Thus it came to pass that the insignificant little select school of thirty-seven pupils now claims the title of Alfred University after ninety years of successive evolutionary stages towards progress and fame. iixtxil E, E Al 1 A li l , A I 3 43 , f I .. f' ,Y Xing.,--W Y in - A7 H--er' 5 --Qlffg -Mgr, If' . "r-Q X' , f SX gi nf' Af jx X . A lfglll UV 4:4444 , ig Yi' Ai A -L, i -.1 - . ii Lv - ie-- . gg - ef --as --. -W Twenty-three l X-X w' "'-wi" 14 fyaxfee fe S Pt' .,. -1, , Leaf asf Effie PM P f' ' - 'f " A ' " 12'-Lpt. Tr.:-95-e Y ' lx-ff Saint J. NELSON NORWOOD, 1910 . L DORA K. DEGEN, 1898 ' - . Ii ious Edu- P P H ,5'2f0 y Dean of Women and .Professor of Rc g angflgollillzgl ggzziiiloi. Plifiill, 7Xl?1i?eg:irU7iivei'sit7y. cation and Ertglzsh Bzble. Ph.B., A.M., Alfred A.M., University of Michigan. Ph.D., Cornell University. P1 Alpha Pl. University. Delta Sigma Phi. ARTHUR E. MAIN, 1901 Dean of Theological Seminary and Professor of Theology. A.B., A.M., University of Rocliestc-r. B.D., Rochester Theological Seminary. D.lD., Milton College. L.H.D., Salem College. lloltn. Kappa Epsilon, Phi Beta Kappa, Pi Gaunmn. Mn. -..- ,,N'4,,.,. .,..,,M,:-.,,..----...ZX , . .U L , ., .4 f-f,'- .. fr 'f E. .1 - Q.-. --"'Tf1'fff vi ' Twenty-four .Fill-i, 12 -.. W.AXl.lDU .-X. 'l'l'l'SWllll'llll. 1211-3 Ht'f1I'Sll'lII' und Slt'jPlll'll Hulwuvlf 1'rq"..v.w'A of lllzgllvr ilIafl1e'1m11'1'4'.v. .-X.ll.,ll1ligvrs. XXI.. Xlflx llmvcrsily. SM.. lllliwlwilx' of NNN-omiu l'lni lloln Kappa, llvllu liuppn lfpsilun. lxlun Xlpnm ,. , uf 1 E' , 'L -fl gi .K My A . J! f M 172 a I. rl ' M V 'r ffl! ,ffl - . K. N' 1 .vii I-,IH liill KVA ' X, sl lfflrl lm W?-.5 gig? if lil H353 JHYJQ iw! WW. 11972 fjw' If if-Y,-' im Wg. L!-x' VY -- fa lgffg lv LTV? iw! E xy Q' 'R ask VL? JPN ax jg fl! l 1 xxx: Y - 1 4 ik f li? w - in ll 'K 'Qf l, 1 l. ax eb l l x lm N 3 X l ff.. Q. lv l 5. ! A 1 l-Ativan A lv 11-wma-aww LB! -if . , 1 1 1 El , 5'5" ef 1 HI Q A 1. A' 1 1 ,f I 1 'im J ,-.. 5 -'in J .1 g 1 , 1 E f, , lfill' 1 . 1 i it Siffx I il-li., jevfw . . 11 '. lxiaijhly 1 '- .1 fl 1. Y A l 1 Y ' y' iv NK' V 1 1'l1 4 W 4 l. H . l- ie l ,-1 X. A vl . , 11 ARCHIE E. CHAMPLIN, 1918 M 'v egg 1 CHARLES F. BINNS, 1900 vi., . R y tw 5 A . ,Vx I Dzrector of the New York State School of Clay Director of the New York State School of Agricul- ' 1 XA I Q11 Working and Cerrarrzics., S.M., D.Sc., Alfred Uni- ture and Instructor tu Rural Economics and Rural lm ' 2319 versity. Delta Sigma Phi. Sociology. Ph. B., Alfred University. Delta Sig- hy 13 ma Phi. lk lt. l 11 ll it X X . , 2 ,gl ll. 1, 11, A 1 1? a Milli' lx 1 ,x 1' , 1. a X xl '1. .1 . 1'i ll . -, 5 :Wi l l .24 alfa. 3 1 V 1 , 15. 1 it 1 . .f l ' 5, I5 l 1 1 Isl 1, 1, W .U N 11, it in flxiiii 1 4 1 t Q i K 1 1 1 1 11? all 16 Lf t . . gg la ,W 1 .1 fvlklf -'S A 1 1 1 'fill DONALD L. BURDICK, me Y Ll GILBERT W-CAMPBELL1924 A 1 1 1 1 , El.. 'l ll' V A 'alll Professor of Biology. AB., Alfred UL1iV0I'SitY- Professor of Philosophy and Education. A.B., l , fl1g K A.M., Columbia University. Klan Alplne. A.M., Transylvania College. B.D., Yale Divinity it 51 School. A.M., Yale Graduate School. 'Ph.D.', I if,1'l University of Halle. Alpha Sigma Phi, Kappa 'gm Psi Upsilon. Acacia. . A .P il 3 'gal ...D ,.....-r,-N. ,lad -. ffm. -ezfffrffmr -111' 'r -:s1:. es.. 'N5.2E:. 1 fafffm-Lbs his r fig. , 1 11 5' P T wenty-five I Win, ,.,,....,.-,,....,,-.---H ' 4' , , V---Af------'-+""""' A Uh ,fx X. 11 1 Jfwf 1 11 1 A 11 ,, ff' 5 111 11 14. 1' ,. 'uf 1 1 W J i P 1 1 1 'X '1 11, VV , 1 2 A 11 'fe A 11 fi A X , V 1 N X 111 1.11 1 1 JV 1 mga 1 1 1 S F4 ' :M 1 5 1 . X x .. K 1 x 4 , ,. 1 1 PR i 15 ix 1 ' 13 Y 1 I? 14 ,F , ' A f. ELLIS. 19'2f' ff CORTEZ R. CLAWSON, 1908 BET, LAH N N J , . . . - . ., fE1zglz'sl1. Ph.B.. Ed.B.. lvnivegrsity 5111 t L b ' an and Professor of Qzlpary PT0fF990f Q I .i - . , Q- , - U 1 5 EcfJJrZ?1?5T?1Z?14h.if5.rag.Litt., A.M., Alfred lnlver- Of Chicago- A-NI-1 C0lUmbld K HU Glllty. 51.9181 i VA' A . y , C111 Nu. R11 11 sity. 1 1 1 1 11,1 21517 + 1 W1 f 1 1 1 N AV 5? 11 I A EGR W 711 , 11 X 1 A1 Ng F 111 11 X 11' . 1 1' 1111 M N 16 W 3115? Q1 LW EVA L. FORD, 19Q6 Mxlllux l l0wl5lt'K 1-112 iljgf Rrofegsor of Rovnagce LCl'ILg'IlI1gU-9. AB., Ohio l'1'1gf'1'.x-.v111' 117' Jlu1l1'l1'r1g 111111' I 1rf 11 1 N ima Umverslty. A.M.. NI1ddlQblll'y Collcgv. Y111-lv Nlutv N1-1111111 QI' 1 711,11 ll nl 111 1 111 1 1 1 ' mul nl' lln' NIIINCHIII ui l-1111- Xrlx lglxxtlilx l'1 v,7j ! ' 1l111 Pi. if 1,A' ,HL A f, ,72ll'..V ,L 1 , 1' , ' Twenty-s1':v .nv ll .. ,- t Eli va .fl nlilf- ' lik .4 'TV' - F fa. "?if " - . l :egg ,,." - , l S 'itil .E f ALEX.-xNDER D. FRASER, 1925 WALTER L. GREENE, 1926 II'i1l1'qm C, and Ada F, Kenyon Prqfesfsor of 'Professor Qff'l111rC1z History. AB., B.D., Alfred Latin and Uv!-111.0171 B. No.1-son Professor of Greek. University. A.B., Dalhousie University. A.M., Johns Hop- kins. Pl1.D., Harvard fniversity. fi!! ll get f lf -1 1 4 xii! ll lf lg il. ll 1 I 5 I 5 !. I x., 2 I 1 1 k . ti., lt ns! Vx ,ll it 1 l lf Q . K l il 2 l ll fs l . 1 l lx. Il l l , . il ll. l ll R L ,. ,. I w 1. l 'V l FX f L . l ll rv il tiff 1,55 H lv .b ,...,.. ..V. , ' '-l .., tk 3 ,. , 1, , E ., It 1 ,, ERWTIN A- HEERS, 19Q6 CLARENCE VV. IVIERRIT, 1926 Professor of Physical Education and Director of Assistant Professor of Ceramic Engineering. Athletics. S.B., Syracuse University. Sigma Beta, B.S., Ohio State University. Theta Ixappa Nu. Pi Delta. Epsilon. 'Q..,ff' ,',1','.1fg,-ffj 'QZQ-f,.f'fYjA"1',.441nuff,.f'Q,Qjfj,,-ffljffff ..., -,,,-fijfQ',1-fifsxif.-r -.,1Q E.- ff'Ll1'L-r-f4' I--ffLIQf.i..,-s ,..I..'1."T.-f'fl.fQ,.1f?.,,..- T fwenty-seven -1' -Yi nffl W ll! fl fi NAT' f'1ff':Q.fm-. fu ' P J. ,I ,if I Al I .N rr M , D , M1 M, Q, K ,aw .,..-f--,-QC .fffw .4 Q5 fefxe-Mqgeeff'Nf-rr"r Ij...'Xf1i2i:1-Qi? Ni"-'g... :'1ff T-1 ' .ff -if -,f-:4..:ff'1-afffiJ..' f fc. Q ,agSN.QLf 'fT?'f,Ji2 fp,-.3,f,,f-9.2 + Y 2,9 IQ-.,.1.?JL., ,A.-IN-kxvmf..-Q 4--rgwef-as-if Qi. ' -- W A1 . 1 ,' ' I . i VVVVY 'WA .4 U , , I i 1 fy' , , f I X R 9 J . , , 4 I .I f' 5:1 , .4 1. - 1- I I 41 Hz' , .. ,4 . 1 7 1 X' . 2 ,F A X I CLARA K. NELSON, 1920 1 l. CLIFFORD M. POTTER, 1919 Professor. of Drawing and Design in the New Professor of Industrial Mechanics and Babcock York State School of Clay Working and Ceramics. Professor of Physics. S.B., S.M., Alfred Univer- Rhode Island School of Design. Theta Theta sity. Delta Sigma Phi. Ch' ARTHUR H. RADASCH, 1991 1 l l'.'Xl'l. lll'SlRY. In-3.3 Pro " Cl ' , f 1 . Scho0gllJ3'SgQaZfWtl1?Z,lllSg:Zlngnr6152732670 iffy' lainie l,l'Qfl'.N'.V0l' of l'lf'1HlUIII 1.t'.V. .-X.ll,. XXI.. thli J l 1' CS. n . . 2,,'- ' . , . .' . ' '. ' ' x - . sachusetts Institute ofTechnol r . .l'lz. , U"'V'HlA. l'ln lx.upp.n Inu. lxlnn .Xlpnn-. T' -1 -ff1f.i1:"-N-if---' 022 --. ' . ,QSM-... .P ""j':gfY ., '- .... .. - A-f..,5M-Mg ...A "ff x.....-...f A, ..., Wm.,-r - - - -f f Twenty-eight Ogy X 1nAlp1m imlrm ' 1. Af . 1 X' ' r E. W. .. f xi i. IN' .' L 1. . fx 1' 5 lf? E I AX' ,Hg E ill: 1 1 .AVR ffl : x L 1 lu lf em. 5 2- 1 f lf' X fl- 2 Q01 W. :XX K .X 3,3 ,E-'X xx , 2 . 1 ': gl lx , tsxi A Q 'x Q. i Q ' fx 1 u 1 .1 ,J 1 1 1 1. 1: 1 4 1 1 , - al 5 - f --'ir 1 4 '- i Q s ' it 5 0 ll J 1 1 i iii 0 l .1 1. ,iff jfff 11. 1 51111 1 1 .1 l 1 x l ' , lk I N. . X I L1 151, , il if ill PAUL C. SAL NDERS, 1924- 5. -nili:tz.Q- ll WERA C. SCHULLER, 1925 HRX" l ll ll Li x Professor of Cfze-nzfzstry. S.B., Alfred University. Professor of -German.. A.B., Oberlin College. g fy-155 b.M., Ph.D., University of Pittsburgh. Alpha A.M., University of WISCOHSIH. Sigma Chi Nu. X1 1 -l 75 Chi Sigma Klan Alpine Q Y . , , L I Xlrlill li .QU 1 l 1 ' i Fixx? l l 1 'il in 11. l I: i 1 A A A A 1 f 5 1' 1 , 'W 1 1 11111 A1 fsjlil . l 1 11 1 ffl .i A l l 'i W A R . - xl 'lil 1 .U X. in ,N rx 1 ' 1 l lk' 'l fm' 2 V 1 j 2- 1 4 , 9 xiii' 9' i f ' 1' 11 1 , . Q 1 11 ,- 1 +4 ,-'1 li 1 1,1 ff ADA B. SEIDLIN, 1920 JOSEPH SEIDLIN, 1920 115 F-vii ,li f 1 l , . . . . 11. il-rf j Professor of Pzanoforte. Malkin COHSCYVSULOPY Professor of M athematzcs. S.B., Universlty of 11 I 1.53 of Music. Missouri. A.M., Cornell Unlversity. S.M., Co- ff 1 "f l lumbia University. Omicron Alpha. Tau, Klan Q Alpine. 1 M1 1 Sz: ' 'f",,1'17gT'f'l'.ii' fit: fifiiif11:15:11WSI?'iii-'h"t'ff7-'fliifi'-:'Tf?3i'+i?:il1'f?2TTli?f7'71'0"'i""1Tfr' All Twenty-nine , . . A . , ,.-.........,.,-.....,..,...n . .... - - 1.1-.f ., -, ,..,.,.......a- ,1 . . i .-n I , . ffgu 62efii2H:24'?i23fa2Xgffxfigsf5'f.A:ff2Zf4. if e -fe eff. ee: i Q ' 1 ef , g g so ggi .1 W 7- --'- E ., s frm t iN g i i fx H5115 v 3 N j Q if W 1 1 .I j 5' 'A Q 155 K 7 ' ni 1 In fp. . 4 Q15 - ' KV xi ' -X I ,I I FSR? i r A ga ,X x it - - fig- gi 4 it -,Y . tl K A HX- :ii 5 s W ri . l It fi 4 no if FRANK C. WESTENDICK, 1926 . . RAY VV. WINGATE, 191Q V A Ii Professor of Ceramic Engineering. B.S., A.M., Professor of Vocal Jlusic, Instructor in College Q i Ohio State University. and New York State School of Agriculture. New Y 5 England Conservatory of Music. Phi Sigma Epsi- A W i lon. Kappa Psi Upsilon. S . I ' z - i n s . r r i I ' 1 il x, Q . ri rf' ij, P5 K 25 ji fi -ki a lm- L7 R vii ' hi M 1' it M 5 Q I W fix, , HERRICK . , , T BAWDEN,1926 A umm .-x. voxnoic, in-11: i-Us f il Assistant P ' e glggyg , , T0f0SS0T0fEducat1on. AB. Denison -l Y- . - 1 - . . Mi.: U t . . , ,I . I ps I . .s.xI.slfIHl1 lQf1SNUl' if I-, tl .gl jj' 1,14.S ,NJ mms' y A M',Q0l'1mb1e Umvsfslly- my. A.l:.,.1x.1x1.. .Vx11'.-1.11"ifif.-ifslaii ifimli x11.,,,1. MF-ii s tiff! a Q Thirty l . p 1 mg, We K.. L ix 4 XX fix' 1,i'f. X415 .Yr .YRS if ' ,Wg 1' l ix ,K .Ay :I 5rQf'j -' E lyk ,Ni HM ,g AX, J. 'ikxxif mx I WX A 1" 3. , glsxi, ,, ,V 2 30 HX . . P ,K ip-xx . Ki 1 . X. '.K x rj , A 'Q , . -T , . 'gi g I Q N , l . .il Q '44 J f ,if i I if r XX: 2 , ., FRANCIS C. HALL, 1926 E. FRITJOF HILDEBRAND, 1918 ,' Assistant Professor of illathernatics. S.B., A.M., Assistant Professor of Industrial Mechanics. Columbia University. SB., Alfred University. Theta Kappa Nu. I i lf? Riff lf X ,M lg 'XV I: 1544, I . X-Fil ff 4 ifilll . -ij .fl fl . . .,, X r Ui .h fl I ,ll ,f I il 1 ,M fi Nt My .A v 1 , ,-., . Zvi i i ' 5 ,' X 5 z Q -,li iii l p 1. V 7 2 LELIA E. TUPPER, 1926 ELLIS M. DRAKE, 1926 I 1 Assistant Professor of English. A.B., A.M., ' Instructor in History. A.B., Alfred University Cornell University. Sigma Chi Nu, Alpha Tau Delta Sigma Phi. , Alpha. l 1 . . 1 1 V . 1 1 1 i I ' J iv! ,LH fi if Elfg lily. .,,l l, fly llrfr' llffr sfit 4, if .VU QW ., 3 ' M In fam! 2 f 5 l l ix. I !'lxl .I 1 R I . rf? fl l .":."wf l lf 1 N i ff 5259 'll fa E l ,wifi fxls f i lafsli l lf i jf , lfxlj E Fr f Rf j xi .Y - ai .r . .5 Ili' ii". .i'.i Y iiflm Q6 lik!! glff ?'ln isp! ll it I it u l A If lily!! Nfl Rafi! ff'4.Ul Il nm lf!! H Wi, llil l 1 xgil i- l. 7 I R lg? wifi l lv ,,,,..,a.. lf -, ,ff .f , ,, -.,,.-, . --., V-f-N. , .R X X, U . ,. ., 1, , Q if - ' ,.....,., ,. --Y-V . F..---,- ,nf--J--f -,C ,.-ff" """'-N-c""""N'N1f:'jT"""-.4"A""m"---"""""""'ff-ff""+-:"""'Qf:f,'5'w."""f:"Q":':f' -1-.IIE V' U , f 'M , '1 --- -. 'F - -X. -r' , ,f "fi-T". - X-fi? .luifiiim -Ta Juv., x QW' ,Mt f'f". UiZf'gfQl3'i'fKb I M A M ' 'Z-55-' Y i .f 1' ff' ' ,ffl '-f"' i".,g-" -f ' ff' ,f'N': iff' Z f ' .f"' lf' f' iff:-7" ,-'U 3-f' .ff..l'-1-'Y'Qff'.lf57",-"U,-'-'QXdif"f-.F-xkv' J I 'V ' ' f,f'f W" - 'IIA ' ,Ai .---f " ff 'W' f """'if ff """"',,,f" G, ffl l"" -..--'Z'-b1"""",vf'.,. ...t--' "i.,-,z-'lf-.,-.1-'K' S..-ffk, ru. ,W , ,M-" , ,,,,.- ,fm YVVYY- ,,.1- - ,,, ,ff-'A '--- L..-M" 'K---'M' N'-" rwff ' ' ' . T hirty-one Ap-Y' 'fF, :exi"!f'k:, 'J -l'.v if 1 sfff F ,fx 55155 21:5 ! tE,f, 'fr ' z M WH 11-XJ! z ,XJ ! H ,- A f uf 5 s 4 4 Efxffju x , . bf, Rxpitkx Q4 px 1 .HQ rt HJX W J 2 Fl IL A E FSM HE xg :Xb 1 1 as 'S Fu I XE 'yi LX X 1-.X K .E ,Vx f X Q ETHEL D. BENNETT, 19020 AGNES K. CLARK, 1921 e w I nstvructor in Rural Education in the New York Instructor in Domestic Science in the New York L State School of Agriculture. Tau Sigma. Alpha. State School of Agriculture. S.B., Alfred Univer- 1. - slty. I 'N TZQA t ei t rsg ' V in If A xl ,"' t if" -.5 figffifif l . i7.,,1- ' . WILLARD R. CONE, 1917 SUSAN M. LANGVVORTHY, 1912 'K 1 E I lj l Professor of Agronomy and Fruit Growing in the Librarian and Instructor in English in the New l l New York State School of Agriculture. S.M., Cor- York State School of Agriculture. Ph.B., Alfred nell University. University. - Jil ' Ellis-ggfrqf A-ff: .ifzijim-x:QQaf-ef1,i'1Xf'f""Q,vsg WSC! ifvxiiixgirxfiiiifx-q.f Swf-13+-.ff-3 ' T hirty-three 5., 1 wf'x ilwm' 5131 'f Mfr!! fx!! x,,1,1:- ,sf ff f' xf ,Q -X ,JA M LH..- -nlf ,L .. if ,A ,XA,,.X,f fkxxx xff,---1. .1.,,N,4,,f--' x.,fi-'miw i-vi'-rf 5114, ' , , M- ,,. ,.,,..w ,H--is f 1,3 V X -,-,O 1, --f'fM:,.- ,fm ,ff 4 ,V ,I Q., ...M-ff--. ri-V-wfvffa' -:f',,..,,,-,f ,NJ fx O- V' 1.-X ,,-x. ,,f,,,f J-:-,,f1,W' ,f:,,,.f A ,fp-X ,,.-f-T,,--f-"'j45,-Lgf....,,f 'i,,...:,fQ,s:"-Xsf,f'XiL,f-A 'fix x jx xlffihgdf' ,,11f,,f,fjy-'if' ,N,'--- 2-lk.....,wM,.1,1f ,..,.ff f .,-f ,, "7 ffgj I,-,XKQ fxigggg, -.1fQfx.J,ff XX.,-' X-A,f.N5g,,w'MX,,Q2"'Hk-"' M-"- - X"f-f,T,:.Sl-"-'N-""'5A."""QIJ--c-QwgmL7N"-'mf-f""K-21?" 1 ,, ,- K- gy--,. 4-W,---.9--J W- 1 5 Mg I 1:1 Q 3 NX iff 11,1 XX 4 -,.a W ' PM Cyl, mi .L 1- 3.135 W 111,152 X , . f A11 V415 fx 9 W 1. y, L 1 , x X fr. l ' 1 . If, W M 1 ix W . L My 1 M . P? E : . 6 1 5 5351 J 2' 1, ' J- -7 1 31 W f X LJ Q..-if . 'ff F ai li: fl W 5 5' , fx l ri H ,J . fmfq ig fa 575 7 ff' x X, gf .4 ff 1- 11 r W 1 i QU! 'w-fi!! .jI1'j . ' fx 1" 'fl 5 ff. 1.1 Y, H1 if r, fy W' fl A jf ff ,. im .M K. JU.. .fi ,r f. J 1. E. M. MYERS, 1926 . ' GEORGE S. ROBIXSON, 1919 1n3t,.uCt0,. in Dai,-y Industry in the New Ygrk InsIrz1c'i0r in Pouliry in 1110 ,Year Yorl Niaie State School of Agriculture' Srlzool Qf Agric-ulizzrr. Theta Gamma. LLOYD W. ROBINSON, 1919 5 M 4 f ' , r 1 lI.Ulxll XX NNIIIII lr' I ltlllll X I f j ' ' 7 . ' 1 JMIHISIEWUOT W ,hmm Mf""'!ll'Nl1'11l. Iwrrnl Nlmp, -' - ,',, ., .Y , x U atc nnqry mul lifufrrzl lCwg1nr'wr1'ng. SIS., i'm'm-ll l',',,,11,',, nlverslty. A.M., All:-ml l'lnivv1'sil.x'. 'Ixlu-In Gamma. Thirtyff 011 r Y 1 N IX Y I : I .1 J I A. Y I ,,. .y.. I4 ' .x .f ' I- F. ,N I ,Ii -I -. fd .1 I . - xx .Wk , I Q V , J ,. I ' 1 i M .ffl 5 . 1 . r . i V. I V' II i I 5 I I' ff' j I-IARLANIJ L. SMITH, 1921 f', -jj I W j - - M X s 32 LN! -' . W A W . I nst,-actor 'm Ammal Husbandry. SB., Cornell University. V A, A I 'xx 5 f WE K' .. I? "', il My fi . 1. I .Xl Q i :Aj ws H J I: . f We - T5 ll I 1 Student Asslstants pfyfgi Ubi' ff ME gff-gf APPLIED ART f 'H' E 2 7. . Fpfjif ALTANA CLAIRE ATHALENE BRISTOL EMS ft TNS k'?',f'w? ,EXE CHEMISTRY I5 , -I ' :fix HAROLD E. ALSWORTH . WARREN C. COLEMAN I lxffjjj CHARLES R. AMRERG RUTH K. TITSWORTH LW. 5 ,jgfg HERMAN G. WILCOX LEONARD M. HUNTING I gg INGRAHAM HUMPHREY REVERE H. SAUNDERS A V ij aj 5 A iigm , WH- 5 i. I. ENGLISH if A 3 is 5 . TRU gif RUTH GREENE RUTH LUNN R,.AYMOND FRANCIS iii I NRE! xl .I X lx nj -Iql, , ,eff MATHEMATICS gkfjy 11' 1 FRANCIS VVILLIAMS JANE VVALDO Il iw ' BEATRICE SCHROEDER A- Pit E. .W f L'-x'r1?'Q N PHILOSOPHY AND EDUCATION Avi QM? 'I ROBERT ADAMS LEONARD HUNTING ' 4 :V 'Farr Y MHZ 'W M152 PHYSICS 5,ff'L3 KENNETH NICHOLS RICHARD CLAIRE my WW 'ff iT aw. f j Wg i I wx. A A. if XII, V intra 1. E LVN-Rfv'-'R22f1""'K41" 'TZ T721 A-, ,jk Rf, Jxfilzxfll - Xi' A xiii. 'Q' ,Agn ,ff'TR A-' ..-H QSM Thirty-five And soon, too soon, 'We part with pain, To sail o'er silent seas again." Thomas Moore .x .A -'lx X' .x...x r KX f' 1... Q.. c 1 A v 1 I... 4 I I ' X Q . l . M -. g . 2 . if ff 11,5 if ' lv ,214 ,,-A .. Q fl? HHH 6 Xfiifi? I 1 Q ,-V1 3 .N wh- yf Hunk 2' ' ':l3,-H. if 3 X 'gf' f 3: if-:nl K Rl ,kk h Iii: uw g fm .I A. 3, J? f-A F Q Nr. We if 1 7 'W .Q :I . ff Q. my 1-.4 X fl V . :Q Er! xx XSS 5 K 1'-5 N N E E :g X... 1 Q- , M QW 11: aff 'L 44. -3, fi' " 5 I: Ll 53 NIP' .,- XL f A Q " ,S xi A ' S 3 .of J were. " N. ' ' -, y . ef. .B g :Q . xni- X rg: -9 N. 6 pi' r 'll Z-4 g C' E5 AMC. A E 17' K 5- 3g I1 1 .H 13 X: 51 'Q X 32 ' m V21 K 4-X Yi D51 ' f E Sw xy N: ff 2, , f f :Q T 9' 4 f ' "ii ' w .. :Q 5 2:6 E .g ' ' 5 ' A 15 A :4 X .47 1? F21 x ,IA 'PX I X Y: if ff Y' f FE 71- " '13 'f fx :W1.ff' 55:7 'Q F Eg im' ,X E W' iz' :gd 'WEN 1 1 15 Zi QQ" 'Af ff- 3' ,P 1:3 jja N-:N Jig 3:-e Us EJ Q 'I-fr ,' '-" 15, Ju ii ,j .K Q :Z 'X Vx. Lf, lg 7 Qi 134 " ' 'Q X 531' f' f' ' ' E! ...J , . . , x ,.. - ! I 7-1 if Wy, NJN" , . -,..J if ---4 Vx? 'El 1 w X A A -.R , :- if E1 ' L-gp Ji flu .,..., .. Y .Y N., 1-L J E Eg , 13'auf-545715-fIx7Lr.1,'7:71 3gi!2,LQj,L:.L.L15-vj5,e.2,23,2,x3QQLVJ.xgmjjrwljbj,L,LLU,l..rJQ13'u rf5,1RJIEQLJQljfyjjlhj5,Ll.l,I,F,LLLLLl,ILLUDJEDJf,iElU1I1jUj-ijidjjglf m A Z2 7, ' 'X imvfz'-'rx.f ' ,V -.,Ti4-lzfi'-3X1'i'f -xx ,A f V-.C ,, A ' H, , :. 2:1 f A QQ f '55 .3 E Q 5 .QM Q Q ,Qi G 1 . , K 1 1 H' " V V 775- if -' 2 k v- ' 4' W' V 1 :U ,H l 'ff Ml ff '.,f-.-,- H-'1'fr" l.' ." "','v'7'f' lv'-ff' ' 'ff'7:qT".'A-"f '-'-'35'------- ----f- - ------ . ff -- -fl,--W ,- -- ,A-4 .--.- .... .H --- --- --. . ,,,., ,., ' X :fig EQ35!N:!.Uif2ItklbiihlFLW!1H':J-!Al'U3lJ'mlHDl.H!flWlWIH,WlUll!H!HHX'iIH N i'yl'fIU!HQjkfIItfllljjhujjITILLU-NIWEUIQ '5 VH" f 1 I sei ff fa' -4 4 f S :lf .E if 5 NN, w 3:1 Ei :ff ,infix E If' Q :Q fm! 7 .QT-1 Q .' ' -.V sW'qf.,4 Jef -1-iii LNG F 5 1-'Q - f +2 , x fx 'ffa i 4 , Y Y X-.A -1 f 1 , I -"4 Z'-11 . bd -rj 1:11 WN X XA -E -f ,f -J N1 'fi .BJ 'jx 9-. jj E! ,fffg EQTJQQ Ka lj .21 Q . J fff f' Q. ,ff G-HX N. "ll 4-J J jf gf gg , 11.29 N ::,giel:Q . .faf Q .5 -:Q ggi: ,Q-M fi 15 " , G- -! "H---'w'--'f-rw . ' "-"' ' W" "'. -'Ti'T,, U , ' "' "TF" 5 " if 'f-" "f't',-vw'--v-'K---f f. Y "--v- - - --- f .-- , .., !T"i ' - gf, ... . iii X A Q L' .' . f- Y Eff .. W? ' Q g wr C 1 3 i .lj L1 S 12 M 1QVU,l.i.l.lj :MXEKVE Llvjf yjjjzjijUM,kf.j,U,! ',R'iEL1119'Qy:2W3'Q'5?g,5V' - fx ,ff ...:1::::g.7:r:::rrztiizb. .V -'M' flip .gf-W-. ...- -,,. .-, ',9f',9:f' M f5:g'.,Qfl.' ' " ' ' 'M "'ifJ!4"E7c ' 'WA' 2, E, fri., .Y 5 i,: ,Y W 5, 592l XQ-ViT-b ii..., F ' Epi K ,L 'g '37gff X -:PZ - Y f- 5 - 7.3 in , Ag, f2T.QVf FNVKAX fcfjl, L- L. Q- If Ezgskjil gi ' i . X 4--' n , 4' 7 f ,ft-lQ .1 V f '7'x,ff'fX , 1 ' 'A 7321.-1-X ' 1 K" ff T f 3 'ard - I ff . -. pf! . f fx V ' 4 1 1 . x - Xx X , f,- I I Q., .2 f 1 J H X 1 W M ww DP , f X. A+ fn ff 1 X. Y 123 7 gil - , J 42 .43 -K ' Q.: X!! ,V V XV I NW-Qi Mxggl ..:L ,gy E5 , ff !,,,:w12X ,j7gi,hX 'fwife I 211 W'-1 -1' ' "5 b fl fr--gy - ---'- ' "'f"Qz4Z14nfZ3:--Qw - K'-,-Wpw,,f' -' XX S,.:iZgy""' ,,,j,1,3QL,QX' fb. ,E 3:6 pw'-'r-fftf'-'Ar-' "" ff" """ TM" 'f"""R"". T 'f-5-"'f"""H""" "'T- ' "" . if 'W' M" A-M f -f 4-T V , Ti? "' '5"""J'U"'+iL 32" DUJ C' if 'f5u5 gu.a,uf.,: 1,a.?,ifffl.? 1. 1-:.31 1.f.v 1 4 ml .1 .sim.Mr1.3f.L.:3.u-.x:.e.uigw1ggLm:fgs.faU3Lumlimlimgulm1um1Li.iir .a.HiM a fggfffif V -W -L 1 1. 1 l 1 yi 3 Y: i I 1 I 2 i P V L t r . v -2 i c ht ,x Y. w. 'ww r e my . . 4 titgkt , If 1 it A l i V U l 'r l l 1 is ll DOCTOR ANNE WAITE l ll A Executive Secretary of the General Alumni Association A p A fy Q l fl lg, A The General Alumni Association if f Q .1 The Alfred Alumni Association was founded in 1886 by a few graduates who limi +I foresaw what an actively working group of Alumni might 'mean to Alfred. Such Rig, names as E. P. Larkin, L. E. Livermore, D. A. Blakeslee, W. YV. Brown, P. B. BIC- W Lennan, J. A. Estee, and Daniel Lewis appear in the early records of the association . AU In 1897 the late Professor William C. Whitford was made secretary, and to the duties th? of this oflice he attended efficiently until the time of his death in 1925. An arduous wi task was completed by him in 1921 when a comprehensive directory of the Alumni gr" . was published. tp jill In 1994 I.M.Wright, '041,then president of the association, inaugurated a scheme it 'l for closer Contact between Alfred and her Alumni. ltliss Norah Binns was chosen KX executive secretary, a position now held by Dr. Anne Wlaite. The chief duty of this oflicer has been the editing of the Alumni Q'llCl7'fC'I'I1Ij, the oflicial organ of the assoeia- .it tion, which contains news of the college of especial interest to Alumni. news of the Alumni themselves, and suggested ways of Alumni eo-operat ion to help Alf red. 'l'he A Loyalty Bond .Ca Pledge to pay fifty dollars in five yearst was also initiated in 1924 . FQ!! and has met with great success, especially among the younger graduating elasses. M Under the leadership of the present President, lt. Guy Cowan. '0T. and the Mi, EXGCUUVC SCCTGULTY, Dr. Anne Waite, the Alumni of Alfred are working for their it Alma Mater, not that she may have more athletes and better teams, not to :nh-eriise lv? Alfred, but to help to make Alfred worthy of being advertised. it ,,'1f's-fffsm-af--f-X-ff--s,..w-H-----.-. M... 1,25-I ffgffs-a"i"Tii1s" ' ' t - "" Q , v..- ,, .,f'.-..f s-i--,-tff ...lf A-- 1 ThmyQ2igijg2'iii 'iii iiii A A l A xx "X xx txwf. HERBERT A. WHEELER President of New York City Alumni Association The City Alumni Associations Alfred Alumni have made themselves felt not only through the General Alumni Association but more locally in the City Associations at New York, Chicago, Buffalo, Rochester, Syracuse, and Jamestown. Many Alumni living in and near these cities have been co-operating in their work of having Alfred recognized by their friends as a real up-an d-doing institution. The association members frequently hold get-together banquets for their own enjoyment and for the deepening of their Alfred spirit. The Jamestown Association is a new member of the family, having held its first banquet on April 17, 1926, with twenty-five present. Mr. Allen J. Williams, President of the Buffalo Association, reports five of these get-togethers during the year. President Davis and other Alfred leaders often attend these gatherings. The Twentieth Century Club, another child of the GeneralAlumni Association, consists of the graduates of the last twenty years. They have their own organization and literature and have been active in their financial support and work toward the interests of a better Alfred. Our Alumni appreciate and endorse the work of our president and trustees. Mr. Herbert L. Wheeler, President of the New York City Association, Ends the members X J, ,ll lyf., ,f in fi i, M, J. si Al T A ,ff J. fa Y I .t 4 'x l L l l l l i A A of ll ,T . . . l of his association to be sincere and intelligent men and women who place character and improvement above personal needs. It is people of this type with a vital interest 'y in the Alfred oifstoday who represent Alfred to the outside world. A .yi f ' YW is A -lr- A x, -.il A. - A ,A r, e -n A T g 1, Z' if-fi..-wftnwe- Ng. .. wwe .fa Xa X E-- -Q -f. - -L i J -'1--Qf1Lil-Aff . .fi??lr,.v T hirty-nine . 11 fkxfr x ,, , fr f'? r A iq- "-:CY ' Ni! -N ,-e .rf-,ffffkf ' .A '. f-:SQ A ' A- rl4q,,.fvgf,w'-- 'wiggy five -ff .ff 1 aff.- L g A A .A A so 1 A fa 'aff ,Q-,J-A 1 A I . W 1,4 Al Y X lf' AA AN A A J, lA Af A l 5 1 fl AA A A If ,,,,,.,, H 1f1'q-Isa'-Inav:-zo' , , . Al A 1' ,4f'3Tf" A r A AA lA''AAl'AAAAslllwrliaf A 1 '-fl all ' "'- " A 1 ,,A4 f' y . A . . A I, A ,AAA lgusf'1'6'il'.0'i"rU-9''f'm"Nw':'P"r'f"UQ. . f.-. '- il':Nq'uO"n' 'n f",9"'N.n0 1 A7'a.ff,ZAot'W'Wf'EQW'M'QM1i'1v'o , p 11, 53 .H .Q H., .. 14. IIIIA, ,.a 4 0 6 . 0 1 -. Qasqgsaraifsifvvb:5s?1w,g49gg,Z+v3:4eyg!.933W?.wfv'- A ' .. ' '.1' 'Ne' "b:"'k l--'fl' " 1. li ' :O 'of 1 140 4' Q Q 'eagfpfgipgii f 0g9j ,faezay,g.n' . 41 A l A y y 4 COLONEL WILLIAM WALLACE BROWN The Most Distinguished Alumnus of His Generation ' ll F A 1 A ' O , H 61110113111 - A A A Ay A William Wallace Brown, LL.D., Senior Trustee of Alfred and most outstanding A . 4 . . A y Alumnus of his generation, died in Bradford, Pa., November 4, 1926, at the age of A A A , P y nlnety years. A jj A at ' A L . 1 Q is' - A member of the Class of '61, a Union Soldier in the Civil VVar, a Congressman 1,1 . . . . - ,A V3 from Pennsylvania, an Auditor of the War Department, an Auditor of the lNa.vy, Akvf, il ' I a u q o A A . A A W 1 an Assistant United States Attorney General, a distinguished lawyer and public ANA , ,. ' . - . , . , A l 5 citizen in State and Nation, he was also an Alfred man to the core. He was active 111 3 g A , 1 ' ' - 'A' Q ,Ii the Alumn1vAssoc1at1on, served on the Board of Trustees for fifty-three years, and MA 'A Y . . A 'XA 2- ,Ag founded eight scholarships. 5 1 A A . .1 A 1- ' VX A A H I ' ' ' ' Alix, , AA lAl The KANAKADEA of the Class of 1926 was dedicated to hun as a trlbutc to his ish outstanding character, ability, and loyalty. AQ L A . A A" Ai AL A .A fi AA Ani' x r ' in A 1 O. 1, , A r. - ul o AM ' Aga All li Al Q 1 AAAXAA A A- .A N . 'N' .-1--'f-S-..,-fed-'-1---.,, ,M- A A A Fofrty K l. 5 'S ifi' A ,AAA Li' 2 I K 2 riff -:Nw 33 ,S 1--f . , H ggi ., ga - Q 'Q ,Ti 3 i . S 5-M' as I if . fl gi' 'Q L. 1 l v il , , . 1 , x i 'ff 3-4 .,I i I ,, f I 1 H ' 57 I 1 V ikfljfx xx - X' ,A O lx V H' -, A .N we wk X le!!! li J fifty lk I VX HX X, ,XX i Q ll X ' ' il l if i ' f Y 'ul S 'll 3 , S ,fy W l I Y ll: A 2 -lx , tai X E X? jx 1, 31' ' -5 -ir. mi fr ,X .Nil if , QM, 'ffl l ax - I ,xlyfgf ll EW ,lb M f 1 F lt fi it umm on ur aeu y it Y V, YN ,vigil Wle have kept some of our Alumni among us. We are proud to learn both studies and Alfred tradition from them. ll FA' ll tiff . . . E i l5?S,l President Davis, Dean emeritus Kenyon, Dean Norwood, Dean Degeng Pro- ll , ' . . 7 fessor Titsworth, Professor Saunders, Professor Potter, Professor Hildebrand, Pro- lei ll fessor Conroe, Professor Burdick, Miss Harris, Miss Ellis, Mr. Drake. f ffl a, 2' fu. L7 til all fl 'El ffl ll if ' 1' Il- 1 'L fl t Riley? T ,lil ll f 412 lr X, .l ily: Y' 2 f w A I l X gl f I 15 X , " of ., , ' 1 ,P H AMI P Faculty of 1886 Faculty of 1893 ,f f f ' 2 P . l1fQ"'l' 154 F only-one 1 1 tl 1 I 1 1 af 141 l ., 1 1 I 1 42 fc I .LA EW. L L, ,H - af- R I f 15 VNC' xx -xg---L'-fit,---x-Q-1:5 ff-if -at R s 2--fr-1 -T155-f ffffyfiffr. - W l ' l til!! 1' Ft V ll X"A l,l . In ik!! .E lfll '1 li N! 5 1 1161 .lt all , 1lilf 1 E! ll' ,1 A l tx F 1 I 5 in 5 g Ft ' 1 lr tl 1 ' 5, N l 1,1 l, 1 1 l, lx ll ll l 1 if 1 l l l l 1. 1 l. 1 1 tl ll fl tiki Lfll 1 I it ll I hx 1 1 1161 , . I i 111 all s fi h' d Q1 111 l . tt Alfred Students of the econ , T 1r an Ml 8 1 h G ' 5 llkfl it li ourt enerations N. 1 ' 1 S55 ll 1 lull ARMSTRONG, LELAND -Reuben H8925 and Grace Hood H8915 Armstrong il", lt l Norah Crandall CArnistrong5 H8595 1' Oscar Hood H8595 and Ruby lllitter CHood5 H8625 A 4, 5 111, BAKKER, FREDERICK -Jacob Bakker H8945 . 1 ll 'll BASSET, ROBERT -William H8835 and Myrtie Bliss H8835 Bass-et li Atl! E. S. Bliss H8555 and Sarah Humphreys CBl1ss5 H8595 I lt BURDICK, -Lester H8975 and Grace Grow H8965 Burdick 1 lt: 5' DIGHTON, MILTON George M. Grow H8695 l 1 Buss, GEORGE -Walter Bliss H8865 '1 ll' Benjamin Bliss H84f85 lg' 'CLARKE, NEIL -CGrandmother5 Ophelia Stillman H8635 CLAIRE, I -Leonard H8975 and Mabel Niles H8935 Claire ltllyt I ALTANA, CHARLES, RUTH, XJVALTON 5151 BRUNDAGE, BETTY -CGrandparents5 Jonathan Barney H8655 and Nora Dexter tBarney5 H8665 X tl COTTRELL, LEE -Royal Cottrell H8985 Ira Lee Cottrell H877 5 and Angelia Dye CCottrcll5 H8705 311,511 'COTTRELL, LOUISE -Max H8975 and Gertrude Packard H8965 Cottrell A. B. Cottrell H8595 and Isabell Coon tt'ottrcll5 H8595 Ella Lewis H'ackard5 H8635 l ELLIS, -Charles H8925 and Lulu Carpenter H8935 Ellis Q5 DELMAR, HELEN Maria Wlells CEllis5 H8575 Pliilaiulvi' Carpenter H8-l-95 FENNER, RICHARD -Ely H8845 and Susan Babcock H8905 l"t-nnvr Elisha Fenner H8-L75 and llarrict. Smith tl'lt'llllt'l'l HS-L75 42 ll FENNER, DONALD -Olin Fvniivi' H89-l-5 lmll Elisha llcinicr H84-'75 and llarriot. Smith tl"vi1iwI'5 tl8'lT5 1.lX11'l fl 111 1' - .ll fix l' 'lf lf F orty-two l"vi,xn-zu. ILKYMUNU, l'i1'1gl-:xlq Gnnns, XX .uxri-nn Gnu-zrxx. 1-liuxvrzs Gnmzx. Rivrn ll.mn.'rox. llAnoi.D 1lL'x'rixu. l.Eox.xnn. lturn J 1-31-'i-'m:Y. Gn.nRn'r KPIXYON, K1-:xxx-:Tn LANGWORTHY. JACK Livi-znxromz. '1u, ,- 4 1 A ,K ,,,,,,,..X.-, ,,,.-.Am ,r......, ,..,..., .,.. ,, -Y X 1 F ,Q ,J 2, .W .,,1,,.a S.,s,,1-- .4 --aqu- - N V. A ,I lr A .. LM 1, ,I .7-- , .f-4, -1 "" ,ui-lqj j Y N., lk fl!! 'V V ,1if:..+'-i'igf',..h-f""l 4"'f,Ltf-5'ffk1':-J2"'j:Lj,'i,.fA"'f:i,3!'fI.--4-J"'fg4M.f'j,L'Ll9 ,, A - , I ff ,... . -f-.,,d,..-ff ,.,...-H:1,,,,..-4-...,-fs'..,....,fs -.-.,..-f-'Q--..,L., , 3 "E i , li' "ullil'1lll4llll0lllel'l l.ovina Metcalf 1Fllllll0l'5 118505 - ---- l.eonnrd 118985 and Jessie Mayne 118995 Gibbs l -1Gr:nnlparents5 John T. Green118575 and Sophronia Lackey1Green5 118545 V -1Gramlparenls5 Milo Green 118655 and Alice Sisson 1Green5 118655 1 l -Ezra 118865 and Leora Sisson 118865 Hamilton ghllllllliltl Potter 1Hamilton5 118525 llaeliel lloard 1SissOn5 118555 -Irving llunling 118945 J. l'.1-lnnting11-Ionorary Degree 18595 'ind Lucettm Coon 1Hunting5 11857 , 1. 1 5 -lisle 119015 and Gertrude Hoffman 119015 Jeffrev l Benoni Jeffrey 118795 and Lida Burdick 1Jeffreyi5 118765 John ll. I-Ioffinan 118575 -Evangeline Canfield 118905 Kenyon -Howard 119015 and Annie Rainey 119015 Langworthy Louis Lix erxnore 1890 - - ' c J RIARGARET, AYAYLAND Selucia Clark 1Livermore5 118445 LYON, RUTH RI.-KXSON, KExxr-:Tn OSTRANDER, GEORGE PERRY, ALFRED POTTER, FLORENCE, ORTENSE PRENTICE, DONALD R.kNDOLPH, RUTH ROGERS, FRANCES, RI.-XRY REYXOLDS, EUGENE SAUXDERS, NIILDEREXA, REYERE SILL, STEWART SPICER, J ORN STILLMAN, PRENTICE TH.-KTCHER, ELE.4NOR TITSWORTH, ALFRED, RUTH VV.-KITE, JAMES WHIPPLE, GEORGEOLA WHITCOMB, DONALD WHITEORD, BETTY WRIGHT, MILES WITTER, RAYMOND -Paul 118975 and Adaline Bonham 118975 Lyon Winfield Bonham 118725 and Eveline.Saunders 1Bonham5 118665 - -Holly 118975 and Rose La Forge 118965 Maxson -Bert Ostrander 118915 -Orlo Perry 119145 -Grace Holtom 118905 Potter A -Harry Prentice 118985 I -Curtis 118935 and Adelle Carpenter 118965 Randolph I Lewis Randolph 118655 -Clarence Rogers 118895 -Edwin Reynolds 118915 Lester Reynolds 118645 and Minnie Bloss 1ReynOlds5 118685 -Myron 118755 and Amanda Hall 118825 Saunders -1Grandfather5 A. Stewart Stillman 118625 -Clarence 118895 and Anna Burdick 118935 Spicer , -Lucy Prentice 118845 Stillman -1Grandfather5 Scott Thatcher 118525 -VValdo 119025 and Miriam Saunders 119015 Titsworth i X Alfred T itsworth 118695 and Georgiana Alberti 1Titsworth5 118735 Irving Saunders 118635 W -Anne Langworthy 118925 Waite ' George I. Langworthy' 118555 and Anne Karr 1Langworthy5 118565 -Herbert 118875 and Eola Hamilton 118875 Whipple Amanda Potter 1Hamilton5 118525 -Sylvania Rogers 118835 Whitcomb I 1 -Edwin 119005 and Vernie Santee 119005 VVhitford Abert Whitford 118695 I J. B. Santee 118665 and Mary Bently 1Santee5 118665 -1Great-grandfather5 Isaac Miles Saunders 118445 -Emmet 118745 and Eola Allen 118685 Vifitter V Charles VVitter 118515 and Abby Edwards 1VVitter5 118525 - 'x ,Y 7--" 7 'fi Y ' - if if H iv -:Y -C Y.,JW 4,4 F orty-three l l , v .. ffffifx V i 1 A Z Thatis Where My Money Goes in if fh ' By GEORGE I. LANGWORTHY yi F ' AUred Freshman in 1855 U 4 Facsimile of Original in Possession of Dr. Anne Waite 4 t Vffaepahn MJMQQM 3.rCT0J" am Ami' fiery xffffgwf ,ff X594 wwf 77 MQ! fo 9,my 5625 4 70142 3532152 Wmifgfejy iiiliwf wa fgf 'ii M-2 L ldv 54111-7' Z Wwfeffdf-W i ij-ff --q'f'?'j"71,i A:-A -- '-Qw, 'wjjjlx ,nm- jf :mfg '-q,.jj,, xX:,,-fMjrf,3,,Pfs,M .M in P., D. N... - -- 'eff - -N-,.s.,.gw ei0Xi4l.,f-H- !..f.,-nz-, 13 Forty-four .21 026' if 5, AZ f 1-Z6 .Dv 6 jx AZ dzvklbm fffq 6 M57 Q 4'-960 50 oajfafmflfi WMM anafwywd ,Mkt-9,5 4466 Aw wuZ g4y41,Z6V' 55215 avi? L,Z22ia Z Zwuea WMM A200450 01941. i ,azzzwa maxim? ywaau f,gaL,,,f g444Zd2, 560661455647 i Qawwfgf WX '-kxv,....,-a..o,AX A K V J 0 fad ,Zia .Z ,JF 74? ba Jjwv gm Jo 42, ,i A21 , Z0 Afa ,7f' JK-7 .33 wa j37.5 I f , 7 f 73h 0-Cf 50 4 I. 4 A'-Nd ' i 4 ! 1 WV mfr PS4 N, Ks 1 . K Ny 'x N Xi Qi is ,, H QR a xi K XX ZX 3, '. xx X LX fs . .. ...aw . 'C ' .ff ,If 1, 1 ,,A,, jr. "1'., ,441 Q, IV 'V 3-f fi' ., . ,flaw 1 'Ja Q. ,V-, ', I ' , 5 'Q H ' 5 ,g 7 14 w wfffy 1471351 3,7 My fiilyf' 7 V13 Tu' fw V! M 1' 7 I 3 I 5 47 f 4 , Q. i KUQTQ ,"'f, "g ' L at hfgal 1 E! i 12 Iv 'H X! 'Z ,fx M yn X 1 I 'TW Q Q, 'W fi v 7 , P ,gpm Q WJ 'dw VH Ls -ram ,g ff WW INN: lf' ff 9 'Q fy E 7: iw lj FL g fi 9 W ix ma H-,X 3 f W 'A FWZ w1",fwQv 4 5 . ,, ff: w! rv- r- 'J .0 'W r N' ,N , 5' 5 EK Q! Ng 'a fffv , 'J . Tv 4? ff M up fx X1 I ax Z QW x x :LIN Nu 'Xl YQ fiixfiku if 1 1 M W V2 5 F4XRJ102 A 'Vi Egiffffi e'QK?1,? if "WI NZ? A :JMS , L. , ,HH ,H ,N K-,,,.,v, V .,.,.....,-,,, ,,,.,f--1.-..,V',,F.......,,,.',,-0 ' ----A-.,,,,,,fA--XX o,,,.... w-'x4.,--p---Cx., ,.,:....,.-...Y lf..-L-.--v, 1,9-gqf-,, ,,.,,1...,,-....' ,.,,',V - A , K-1-b HM, XA., -V,..., -x----. N, A .x,,,,.,, -K., ., X--,M ,M N- -f ,,,,.,..r 1- wp ...nk -Y -- f MNH nf ,-N X. -, - , X -x , ' f-1 -. - ' H , --fm'-' X N H--1-. X: :J X ff :X ,fx :Af ffxfmf trx x,2,,Ni.-A --2' ,fdaddf K,-:wd,'f' ph'-Ugg, -1 1,-gm, 'ff Jr- ---H - K, jv,,,,-f ,,-- A.. .,..-1' ' -,L ,4,,,..-4 rdf.. ,J f' if , H, 1- 4.4 ',,.y-- af, - ,w f,-',,-.eff f V, :Af -, a n 4 . fx xJ 1 4' ' f,.f, f4,..-- ., ,ww ,....,,,,.-f-f Nk,,,,.,,f-fgm-.,,,..14- x.....,..-A -.... ,M N.e.n...-LA-1, -f-As..,,...-Q ,.,f----ZA.,-.H 4'-..-,.:f' F orty-five fi, v 1' 1 Hn. Thus quoth Alfred: Small trust may be in the flowing sea. Though thou hast treasure enough and to spare, both gold and silver, to nought it shall Wearg to dust it shall drive, as God is alive. lNIany a man for his gold God,s Wrath shall behold and shall be for his silver forgot and forlorn. It were better for him he had never been bornf, -Proverbs of King AUred Delivered before Weiiarzagomote C3 "O 0 v0 Q Q2 P 3 Q 0 0 Q '4 ga R ,- pq Q i M 5 : 4,-fa 5 1 5 1 l . P 4 4 Eg 5 E 5 A 2 56 vQ' CO in 95 -Q4 S E: 5s , s 9 PY, 3? ni ni ai P3 9 1 l1"""Fl th . ,JIU BQ 1 I W 9 'Q' AvN 4 Xe I V? S Q l' I .QN Q26 o'4 'X .... ,u - ,,.. , -.1 , . :,-,4 4...5- W .' " ..,,4 A 1 . N if . U "-'LH Z' X 5 W, "g,:.J tlfk' ,W x-x WI,--: Q. "" X. f-9 5 ' -A-1 as 3 'L "--1 ' I , . -... x qi r-gf ,'--1 I nf , ,'..J""4 -"4 H' .J Q -1 ' ..- go .- , X... f lf, X-N -1 I H. Q-'fi 'Ili ' ' Q. -TI' i q N9 xx C-rx -.4 v ' I ' NN X351 QI, 5 r--T f , xx N731 P- R v. .. 1 , X ,Y M.,.1 x 'n ' 71 ' J: I 1 4 , W ,V ' I r, I vl ' 1 IZ! K . 0' Q LZ 'Y . P H Life ,If W QI , w :F ' fl I . g , ,f , a .1 , , M , , ., 11-k 4 ffj Y, EQ 147' 0 Qglii E? 1 fiell 0 :1 1 .fr and s -1 ' 2 5-ii ,yfx j IQ l ww F' 1 .1 QX EI xx ,,,.l . X - I N IE 2 'S L fix 1-"K ' 1 "'-'-uz- Y"5-rf ,egg V M! rg :fi A 'K 2? -Q Q : , if 71:54 ' : ... Y,,. if MEET ,A 3 A , . ,.K,,,, !,,,,,Um., ,f5y5 W,,UQQU1,-Wjy,jg:33331nQaQpaYug:Qmgoiulniriwirgm,iieirglgnliill,UiM1433H1MlU.lUUU.I1MliU.UdFSg X- . 4 .A,- -.v -' ----- -4,:gL4g,1':::g.:4:-li?---""""lll'-+ L4-'---" 'hu'-""'T"'-"""" ,' fr -L. ' , gf2fi,. CQ,126fQfwMfMf?i2ff2 3425555 f QQ A I 5,,Axx?I -,Fx ,D -lf .X 4 N Mfxx x I Xl , E, f W ,, , 1'UTE'2'LU'i'U'iTlTi'WkUi'l'k H11'lTYlAl"fli' i'k'l4lf1QlfYlTl!WSKIHUMIU ll,UU,UfULUT?FY!MT!UPTi g: QL E --, Ei w 2, Q E3 it I4 MN , L 5 .MX-7i"i E5 22, ,VXA f X Eg K if Lf :Z-'E fi QW X Q14 Z: P12 R uf? ff f in-11 J, gd H 'ffiw XX Wi '-C if fy 1 Mx. flal 2 ff. 9 f K A -W--,WWW -W , ,, , , , -w , , N 1L1'f!Eifgf' X f v--f-- H-f.. -fr-- 1 . , r f-f W ji 5 gg, fTTjT'i'fT'Tf', g max ir Hwhll 5,572 mga 231-1 1. Q51 t l R U,,UX.H,1 lj,E,U iXUIQNQUSIH-2gi.U345? P1430 EX 5,14 ' - - '- A 1 " 'x""J"5MZYwk,,Q. L yi f'ff,,. V- ,krr -..U-:,:'::r:i,:.T,:7f-, ff"""'7-ff ,f"""1 , 'f""'.'ff" ,iff "' ,f V' f""'b1- 4'?fl.QEf?5g'f"wq-A 11 xqiif' ' "-I fifz-'1 "f,"f75QQ1iX' ,X ,fx fffnfg ff, 'fx i A4551 Q .J ff? A 1121 41 f - , 4, ff-,YN ,, 1 V' 5 ' XX Y 'xy XFX 5 !!,,1. f ff fm f X: I 1-K 1 M Nm 'X ff f1f yffff '-'A- -11 f ff 1 1:1 1 J 'L- 1 5? f2?f57fPfff'2m fv AWK fix .ff If ,X Z X, ,L ,, kk ,S Jay!!! Fiji 1, ,AAK I , C, jgkxn fy QS--r ffl, li? , ff' ?i f ' Q' QM.-- A x , .-. -A-f "' ' ' ffigilffiliif' "" X Rf-f "g3,g1,m?l '5fTmfT'77 TTTETQTEYTIffIiif?ffL7f W .PmisL1A,1g,a-agpuQugmQgmgmgmmyP M f 'li Q: F L 'K g V T 77 X ,Mi Y if 5 -xqn V,q.E1Vx,:g" -jr, "lazy, N W""f I ' f 3 1 Y 1 F' 5' fy r FX 1 ' 1 N, AH A 4 A L V R ff .N r m Q . R W W R R Class of1927 OFFICERS 1 ROBERT BOYCE . , . . . . . President U . RUTH BULL . . , . . Vice-President R KATHRYN KELLER' . . Secretary R ' RAYMOND FULMER .... . Treasurer R Class Yell lr We,re aliveg r r Out to get 'emg A. U., '27 P V R . R ge T 4 Q x A R xr , ,xx Q I QQ? R rl X .rw X tl? yi "rr, WI J In in x Q A js , XX X55 im r XX ?x'i2J Wifw'--err"---.f-'-W R few- M- ' 1 ARYRAW ' R V R R is Forty-eight - A gx rs Purple Wvhite l , 'R X -, 'v i .II I. I ix. IPQIII 'II I' I Z 's F I . W .A .I X lqx, It I I. C I I A I- xiii: I N iffQ..t.fif.gfg: ii g1Qffi.iff5pI'1-ea tif' 'ij I I .I - -'-, - 1- -M --C... III I!! M. I li ' I J Ai ZSIQNII W5 f - . . . . 3 l I J li0BElt'l' Annis, Jn.. lxappa Psi lpsilon, Wliarlon. In II It N. J. St'I't'llfI:ftt',' Cross Country C153 luterfraternity I Council C'2.S.-l-5: Yice-President C351 President C-L53 Kap- j pa Psi lipsilon SOL'l'Cilll'j' C'Z5: Yiee-President C353 Presi- txqx dent C-L53 Vice-l'resident Class '27 C351 Student Senate II IQICIII C45: IQANAKAIDIGA Stalt C35. A Il it I HARoLD ERNEST ALSXVORTH, Klan Alpine, Arca.de,N. A A X . 0Il'I8Sl'CGII.' Editor Pina' Knot C2253 Treasurer C353 Presi- , ll .II-4 dent C453 Interfraternity Council C3,"l'5Q Chemistry As- C I A I' sistant CQ,3,4i5 3 Class Play C25 3 Press Club CQ,3,45 3 Editor- I il in-Chief 1927 CKANAKADEA C351 Associate Editor Fiat I- A Lua' CL2,353 Editor C45. ft I I l Il I A l A I i li CHARLES RHODIMER AMBERG, Klan Alpine, H.M. A., , A i I Elmira, N. Y. Ceramic EngIz"neer,' Student Senate C153 I I II l 5 "As You Like It" C153 Class Debate C1,Q53 Klan Alpine I Q' Treasurer C45 3 Chemistry Assistant C3,453H. M. A. Presi- l tI I I I dent C-L5. C I I FREDERICK PHILIP BECKVVITH, Dansville, N. Y. Clas- II , I sicalg Fiat Lua: C353 Press Club C353 Cross Country CQ,353 l II Track Cross-Country Manager C453 Managing Editor I I I ' A Fiat Lux C453 Varsity HA" Club ll . I , I I III! I 5 n ' ll I CLIFFORD HARRY BENTLEY, Theta Kappa N u, Rush- l I Il ford, N. Y. C'lass2'cal,' Rushford High Schoolg Houghton l I l College C153 Class Basketball C25. I Il 1 . . I t A If JANE MARG.ARET BOLAN, Shortsville, N. Y. Sczen- If Il ll twcg Shortsville High SCh00lQ Committee of WVomen's I I. lg II Student Government Council Glee Club I A A Iv ' iz' I' il A lj II if I I I I II III I ll l l ' l I, IS C I I ROBERT ESTERLY BOYCE, Sigma Nu, Chester, W. Ya. II ,N ll I I Scientificg Kiski Prep. SCh00lQ Blount Vernon Union Col- QI Il I lege C15 3 Editor-in-Chief Fiat Lux C353 Chairman Spring Il 5 'II E I Day C453 President Class'Q7 C453ManagerFrosh Football tl I I If II ca ti l ll Cl , , , l l II PII JULIA ATHALENE BRISTOL, Cuba, N. Y. Ceramic Arty 5 fi if Il Geneseo Normalg Columbia Universityg Ceramic Guild , CfZ,3,453 Student Assistant in Art C3,45. II 3 5'C '1-I l g :fm Ql 'tnr El E . A..- -I ,A A A ,, ,ww LE.. ,L ..f..-. -A fa. -,A ,- g I fl , .,,IIl A 7 xffr f " 1-...ff ftgcf' Y? 1-. M-lxg -Q S.-Y -ff" h -ggr if -ff ,I ,IIC--516 ee .se-'S-:fx T, X-I. wtf.. N are I we 'fates we waefxcmw as F orty-nine 4 f 1 l 4 A Al t V I . t , 1 9 1. ? s w I m ls I. x tl i' I if-X lp. ,-sax., kd.. . lf., s , A... , s .. Q 1 4-,X , . , :Q . H-+.xf. , I -1 'V Y ,fe it , , F ., gms., , ,,,..1.z.e.-..,, ,d,,5.-..a..,eu,-?""'t'-- M., . , f xi ,NX .- 1--1 - , - fl- f--f - A 7 -S., n X, -E-ss..- xL---1:ff'-L1.-r'rw-fin:-feiifniff ff- 'sw sf-jifiikffsvwiff ,- ,Q ,-V --' ,,-l- . , .Q - ' -L, , - . , ,I . ef- X sr' . ' ,w , 1- - .. . - K- - I '- ,.- , -sk , X' -'R , Xia- 1, x, X X1 xxf , J- K ,www f 1?,7,l: .saWp,X ,.---f ,."' T' fc" . s . fx . 'sf X ' fx f ,, ', ,- ,. X .f , --x .432-' ...' - ..f Y F' -s 1 ZX x frbiiigm . - .L Y,-. x f ,,,Yx,, -- N, 1,,,,v., CN- 1. , gf' A I ,W 4, , , Y ,Lif35,,.a,jf-- i3,x4-X ... m,,,...-.. f xx at s..,...A-as .,.,.,f ---f'1-f wh-,Z-x.,,w ... -A ...-P'----0 if l B ! v 1 i A l 3 l 4 3 I 5 t ,L-5 If M -,-7 ,-.,-. -Ay ,..- . ,ff .-vf .ff f1-- ., ---" J' Fifhf V C 1NE BUHRMASTER, Theta Theta Chi, Scoiicailiigl. Yinglizlramic Art, Y. W. A. Qljg French Club QQ, Ceramic Guild Cl, 2, 333 PI'6S1deI1ll C45- RUTH DOROTHY BULL, Theta Theta Chi, Phi Sigma Gamma, Lake Placid, N. Y. Ceramic Art, Girls' Track Manager CID, Class Basketball C153 Ceramic Guild Coun- cil C3Qg Women's Student Government Council C1,3jg President MD, Theta Theta Chi President Mfjg V1ce-Pres- ident Class '27 C-Q. LYLE D1XsoN BURDICK, Delta Sigma Phi, Little Gene- see, N. Y. Ceramic Engineer, Ceramic Society f1,2,3Dg Class Plays CUQ Class Basketball Cljg Class Tennis Clk Intramural Basketball Cf-D g Varsity "AH Club Program, Business Manager MD. ELIHU EVANS CARR, Theta Kappa Nu, Punxsutaw- ney, Pa. Scientific, Class Track CD3 Class Football C2jg Glee Club C1,Q,3,4jg Intramural Basketball f2,3jg Inter- fraternity Council C2,3,4jg Secretary-Treasurer C3,4j. DANIEL CARUSO, Kappa Psi Tfpsilon. Rockaway, N. J. Scientific, Class Debates C1,Qjg Fraternity Basketball C1,QDg VVrestling Q1,2Dg Captain Q3,4jg Y. RI. C. A. Secre- tary C3593 Kappa Psi Upsilon Treasurer CQDQ Varsity "AH Club C3,4Dg Athletic Council C-lj: Campus Court Judge FRANK ELLIER CHURCH,Ulysses, Pa. CIGSSfC'l1Ij Mans- field Normalg State College 02,323 Football C-U. ALTANA MAE CLAIRE, Theta Theta Chi, Alfred, N. Y. Ceramic Art, Y. W. C. A. Oljg Class Basketball QD, Ceramic Guild C1,Q,3,4-DgCom1cil CQ.-H:Trensurer QD' Theta Thctt Chi C orrtspondin Sttrttlrx SD: - '- 11: gm-wg.-Q Art Assistant MD. R1IC1lA1tD SHAW' Clnxilm. Delta Sigma. Phi, Eta Mu Alplia., Nile, N. Y. C1tlSSI'l'llZ,' Y. N. C. A. Cabinet tllg Class Bz1.skct.b:1.ll URM Glee Club 3,333 Assigqnm 1135- kctbztll 1lVl:1.11:1.gc1'.C3jg ltlxutatgfing ,lflditor 1"z'uf I.u.1' tiki: l7cll'.a blgllltl. l'h1 Corrospomling Set-rct:l1'v tiki: Yiw- l,l'0SlllClll. Sl.tlll0ltl. Assistant in Pluysit-s t-U: Basket- ball lVllLIltt.g0l' Civ, , mx .1 A51 5 A A at :X 'l V4 I , sig wx y' .Y - A .1 NA. 1555 X, EVELYN SHERwooD CLARKE, Andover, N. Y. Classi- calg French Club C2,35g German Club JEANNE AUGUSTA CLARKE, Theta Theta Chi, Phi Sig- ma Gamma, Yonkers, N. Y. Ceramic Art, Ceramic 'CS im Guild C1,Q,35g Y. W. C. A. C1,25g Cabinet C1,25g Women's 4' Student Government Council C15g Class Basketball C15g Art Editor KANAILADEA, '27 C35. P an gg 'ine .W I . 5 l l 9 i 2 5 C WARREN CHAPMAN COLEMAN, Klan Alpine, Ilion, 5 N. Y. Scientzlficg Student Senate C2,35g President C25. 1 GERTRUDE LOUISE COTTRELL, Theta Theta Chi, Tempe, Arizona. Ceramic Art, Ceramic Guild C1,Q,3,4f5g 4 A Choir CQ,35g Chorus C15. l l CHARLOTTE FRANCES DEGEN, Theta Theta Chi, Du- Shore, Pa. Scientzficg Y. W. C. A. C1,25g German Club 1 C35g Class Executive Council C255 Class Basketball C153 i Class Tennis C15. 'A KATHERINE DAHN DIENEMANN, Pi Alpha Pi, Phi Sig- l ma.Garnma, Eta Mu Alpha, New York City. Classical,- ' Y. W. C. A. C1,2,35g Vice-President C355 Class Debates l C1,25g Class Plays C1,25g Class Basketball C1,25g Class A Tennis C153 Footlight Club C3,45g Assistant Editor KAN- l 3 AKADEA, '27 Pi Alpha Pi President 3C4f5g Phi Sigma ' Q A Gamma President C45. wil 4 A JAMES DOUVARJO, New York City. Classicalg Presi- A . dent English Club C455 Senior Critic KANAKADEA C45g El f C Press Club Member ir 5 7 l 'ff C CHARLES RICHARD FENNER,,AlffCd, N. Y. Scientific,- C Class Basketball C1,2,35g Class Football C153 Class Base- ' ba1lC15. it 'A N 1. A 1 A :il V ff fi WY T of it X' 'f.- TC Nr ' Q11 l 'Q X-af.-fs-fire sag' S - A f is ' :' ' J' 'A S - ,' 6 'i ti' X i fr ,gil li il gi 1.,f' Fzfty-one i C, . 1 Y, -R-5 I - r , w I i i . FRANK JEDEDIAH in Theta Kappa Nu, NGWYOFK City. Ceramic Engineer-g Varsity Tr21Ck C116-ll? BUSUICSS Manager Fiat Lux C3D. . T M RAYMOND COOPER FULMER, Theta Kappa N u, Phi Psi Omega, Olean, N. Y. Ceramic Engzneerg Glee Club R CQ,3,4Dg Varsity Football C1,2,3,aDg Captain C4lSTI'?lClC . CID: Class Contests C1,2Dg Athletic Council C2,4J: Class il l Treasurer C3310 g Phi Psi Omega Treasurer C4j. ' .W W ALTER LEONARD NIAYNE GIBBS, Klan Alpine, Buf- E l A falo, N. Y. Classicalg Class Treasurer C lj: Football - CQ,3,4jg Class Tennis CD: Nunierals CU: Varsity "A" Club C1,2,3,4fjg 1927KANAILaDE.1. Photographer: Athletic A R Council C3Dg President C41 g Varsity Track C1,Q,3,4j: Cap- l tain CLD: Spiked Shoe CLD: Klan Alpine Vice-President C-U. DOROTHY PORTER GIBSOX, Pi Alpha Pi. Angelica, I N. Y. Classicalg Class Basketball C1,Q,3J: Class Track C1,2jg Class Baseball C1,Qjg TVOIIIGIIQS Student Govern- 1 ment Council C3l: Treasurer CSD: Interfraternity Council A C3,4Jg Y. VV. C. A. Vice-President Cij. if . I . fi I C . JESS GOLDBERG, Spring Valley, N. Y. SC'1.c'l1l'I1fiC',' xii' Spring Valley High School: Chess Club Cl,2j. C ' I l' I RICHARD HAMILTON, Delta Sigma Phi. North Har- i lf, persfield, N.Y. Cerainzic Engz'm'er,' Student Senate C251 'ii Class Vice-President CU: Interfratcrnity Council Cl,-2.3, fN'5 45 5 Frosh-Soph Plays CD. W fp Cl ,E 4 I-I1-:DEN h.l.xRc:.xuIf:1' llnluoxo, Sigma Chi Nu. Fill- more, N. X. C'lfISNIiI'll1,' lloughlon College Clyiig Alfn--l XC Summer School: 1'lI.f1f I.u.rSt:1ll' C333 lqnglim ylul, NAV' A1.M.x S'1',xo.uu.x ll.n'Nl-zs. llorm-ll, X, Y, 5,-,',,,1,'n',. ,TX - i 1 f,.,-.Q -, ,,1,,4.5nJ:-.iw fa . C fi. .ff-"-"W Ffzffly-1100 llornell lligh School: llrivk Sm-rvlzirv C315 Gln. C-img ld to l rofvssor Sm-iillin CIN. lk S 1 Y C4-l1,Cll2llI'lllilll Brick ll:1.lloxw'onSluul C45 g Sl1'll0g1'g1ph,3r 3 ,i .VR 5 1 i .C , ,......C are ,LL gl V ll ni' T. . 'll l ,mfs lf' ar E-f-A ' i ' tl . l Q. l l El l ll 'N Burn ADELINE HEw1'r'r, Sigma. Chi Nu, l"ricmlsliip. all F-H X5 N. Y. Cllrzsszrfzlg Y. W. C. A. Q1,2,3jg Class Basketball lk L1,Q,3l: Nunierals tllg TYOIIICHKS Student Government My Council LQ.3j: Secretary qapg Sigma Chi Nu Secretary . lj Xl? LSD: Interfraiternity Council QS,-.UQ Secretary QQ. I ' V, A l ll'l ,lx BIARY BLANQHE H'L'X'1lER, Pi Alpha Pi, Warsaw, N. Y. . f Scicntificg WarsawHigli SchoolgMoving-lip-Night Com- , l 'ji .V mittee Qljg Brick Prom Decoration Chairman 1 T f l . mx 3? P .x Tu nu L HUSUN H5 derabad India Ceramw Engz if I neer krrangobad High bchool GX111H3St1C Team C2 .SD M . li GRACE EDIBELI Hnrcnrxsox Theta Theta Ch1 Long 'P l i Beach Cal Ceramw lr! CCI'3,I'I11CGU1ld Q1 2 3 4 Coun . ul Q Y W C A. C1 2 it ornen s Student Govern P ment Council 1 Class Party Committee 2 ll V l B V i t l , FRANK MARVIN INGOLDSBY Klan Alpine Lakemont ' N Y Ceramzc Engineer Football 1 U Class Basket 1 ball C1 QD Class Baseball C1 QD Klan Alpine House , f Manager C3 IU . GILBERT HOFFNIAL JEFFREY Delta bigma Ph1 M11 ll ton Vhs Sczentz c Ceramic Society 1 QD Yarsltx A T Program Manager CQ Glee Club C1 QQ Fraternity Bas Q ketball C3 42 l ' l FRANCIS PAUL KEEFE Kappa PS1 Upsilon Rexville l N Y Sczentzfic Cross Country 1 2 3 All Interfratel- V nity Councll Q35 if l KATHRYNI BIRDEWA KELLER Theta Theta Chi Ftfi l Mu Alpha Shlnglehouse Pa Classzcal Class Plays C155 V .l Wee Playhouse Play C23 VV omens Student Govern- l ment Council QSD Foothght Club C3 M qecretary Treas- T urer C40 Class Secretary Q40 Theta Theta Chl Tice- T President f3l English Club C3 40 Km AK ADEA Staff C45 I Fifty-time 1 E I x E., . wi '. 'o .-T ff. ix, , VNS 1-ww 1 5,1 J il ,H Av! 1 I 1 ,ff 4 .fe-yf',.f X..-'K+ if j I! 'Rf A ' "iw "'9g'z"t "' "-.f"m1. .I 1 'limi I , i ff. 4. il ., A, E , K - w E "Q . 4 , It 17',,fXR,ff-Axle 4 sf ' -scf53-"gNf111"ig,,j'1,- Y -f., ,A s,.a..., Mr-fx" K' N g, , , ,Hi 'z l l 1. 'QM 1 I A ' . C 'PC 1 PAUL GORDON KELLEY, Delta Sigma Phi, Phi Psi kiwi: lx . W Omega, Wellsville, N. Y. Ceramzc Artg Track C1,2,3,413 1b A Xxlrestling C1,Q,3,413 Tun1bl1ng6C1,2,3,413 Football C413 X. W Footlight Club C3,413 Varsity A Club! KANAKP-DEA E1- A Staff C313 Class Vice-President C31. I 151' w I G 3 wi' . 1 RUTH MAY KRUG, Yonkers, NY. QzaSSiCaz,- French fg ,ll 1 A Club C2,313 German Club C2,313 President C413 Choir RC fl 1 1 c1,Q,2b. Hr WY Y ' V V l la! 'C H 'vi . . 1 A ll '4 EDXVARD KEENAN LEBOHNRR, Klan Alpine, J amaica, 1 'g Ci N. Y. Scientificg Class Track C113 Class.FOotball C1,213 . 1 Class Basketball C1,213 F 'lat Lua: Assistant Manager - if V .X Football C213Varsity Manager C3,4c1 QDCg1SSTFeaZU5Cr.C21g 1 x A i w C Assistant Campus Administrator 3 3 ampus minis- Q. jg 1 - if tratOr'C413 Varsity "A" Club C3,413 Footlight Club C3,413 tl W A154 Business Manager C31Q Klan Alpine Secretary C41. lg M lt 1 I i lla iii! ,C LAXVRENCE CLYMER LOBAUGH, Delta Sigma Phi, Ridg- 3 U 4 C li! way, Pa. Scientific, Delta Sigma Phi Treasurer C313 KC ig President C413 Class President C113 Y. BI. C. A. C1,21: rx :if ll 'E Secretary C213 Athletic Editor IQxNAK.xDEA C313 Yarsity I R I1 NA" Club C1,2,3,413 President C413 Athletic Council C1,9., . "Aft f A 8 3 lVIana er Interscholastic Track C413 Yarsity Basket- ' 'F l g - . . - ' f I' C 1, ball C1,213 Yarsity Football C1,2,313 Ceramic Society E Yr 1 C1,2,313 Secretary C31. r 4',. i1 fl 3 Mx ARLOUINR ODEssA LUNN, Wellsville, N. Y. Ceramic 52 if Art, Cornell Summer Schoolg Ceramic Guild Cl.L2,3.-L15 1 I Y. YY. C. A. C1,2,313 Class Basketball C1,2,3.41: Captain 1 C55 C' 'Cy C113 Class Track C1,2,313 Captain C213 Nuxnerals C112 ,E Xwli Press Club C113 Hikers Club C213 Student Assistant C41. A Ji. fix-Cl US. - . . . . YV 'Vi " H.XROLD FRANK BTCGRAXV, Ixlan Alpine. xxl1ll0SVlll8, 1. . N. Y. C'lass1'c'aZ,' Y. hi. C. A. President C311 Cross Conn- --CC wg, try C2,3,413 Captain C413 Class Secretary CS1: Class Cross fi' I 3, A Country C213 Class Track C1,21: Interfraternity Track lj C' 10541 ml' 1- C -All ' I 1 Gil lit 'sjld 1 I X llfsil 1 , FRANCIS DES.-XI.liS .lXICNl-IRXPIY, Theta Kappa Nu, l' i f pllb01S, Pa. Cvrcznzic l':Ngll'llt'4'I',' St. Katherine lliglx ' 231001: Class l'OOtball C1211 Campus Court Exanxiner 6,1 .OLGA IRENIC BlIl.I.ER. Alfred. NX. l'Ia.v.w'ml.' Alfred lllgll SCll00lI Y. lv. ll. A. Cl,"?.13 Class lizlsclmll CQ1. r ,. E. ,V .X . Fviftyifour . a M NHC 47.1 3 CC ,QJ XX,,,H ix-.-' N I Ki in Sigma Phi Psi ALLEN ALEXANDER 'ELL s. . iii. L .3 . Omega, Granville. Ohio. SC'lt'lll'lfiC,' Outdoor Tennis Champion CQ53 Indoor Tennis Champion C353 Football CS,-L53 Basketball CQ,3.-L52T1'21Cli CQ,3,-15 3 Tennis C353 Cap- tain C-L53 Footlight Club C3,sl53 President C453 Varsity "A" Club C2,3,453 Junior Prom Chairman C353 Drafting Assistant C3,-15 . 'KENNETH Ross NICHOLS, Delta Sigma Phi, Shingle- house, Pa. Scienttzfcg Delta Sigma Phi Secretary C45, Cross Country C1,2,353 Varsity "Aw Club C1,2,3,45Q Sec- retary C453 Basketball C1,2,3,453 Captain C453 Assistant Athletic Editor IQANAIQADEA C353 Class Contests C1,Q53 "Spiked Shoe" C3,-153 Physics Assistant C45. HATTIEDELL NUGENT, Friendship, N. Y. Classical,- S hool Class Play C15 3 Y. VV. C. A. C1,253 Alfred Summer c C253 Frosh Girls, Initiation Chairman C353 French Club C353 English Club C3,45. PATRICK DONIINICKPPERRONE, Delta Sigma Phi, J sonburg, Pa. Ceramic Enginee-rg Class Basketball C1,253 Class Football C1,253 Intramural Basketball C353 Varsity h M r C3,453 Football C1,2,3,45. Manager C35 3 Fros anage ohn- ADELE ANNE PETERSON, Elmira Heights, N. Y. Clas- C A C1 2 35 Re resentative 3VVomen's sicalgY.W. . . ,, 3 p Y 1 asp. Student Gow ernment Counci C ALICE PHILLIBER, Pi Alpha Pi, Phi Sigma Gamma, Punxsutawney, Pa. Scientificg Y. VV. C. A. C1,Q,353 Sec- , f C 'l C353 retary C353 Women s Student Gow ernment ounci Assistant Editor F iat Lux C353 English Club C153 Press Club C353 French Club CQ,35. HELEN ELIZABETH POUND, Theta Theta Chi, Phi Sig- ma. Gamma, Nanuet, N. Y. Classicalg Class Vice-Presi- dent C253 Class President C353 Student Senate C3,4f53 Sec- retary-Treasurer C353 Vice-President C453 Y. VV. C. A. Cabinet C35 ' Assistant Editor KANAKADEA C353 Womenls Interfraterriity Council C3,453 President C45. DONALD TooP PRENTICE, Klan Alpine, Yonkers, N. Y. Classicalg Basketball C153 Tennis C1,2,3,453 Manager C4153 ' "A" Club C45' Wee Playhouse Play C153 Class Varsity , Plays CQ5Q Seidlin Trio C1,453 Glee Club C1,3,453 Press ' l' h Cl b C45. Club C353 Enchanted Cottage C35 , Foot ig t u 1f1i"iQq gffg? 1 -if. wjffiii rfi...g51 ! ' Fix P P X fx X Df!VXP'y"7's ' X' Eff? xr' Xf' -si" -3 3' -i'1.f-lgs.fQfp,fffs, F 'cfty fiv ., Y 6'0 Xs.5YsQ2fNf ll k l , Af ll l li F' 1 T ll .2 l Iylj MA f 4 1. lihl I I if f Al RUTH Frrz RAXDOLPH, Theta. Theta Chl, Eta Mu .i N l N Al h ., Alfred, Y. c'1aSsl'cal, Y. W. C. A. 41,2394 l 'A Trgasurer C355 FI'6'I1Cl1 Club CQJQ Honors C1,2,3l3 Cl-HSS l . . Basketball C1,Q,3,4jgClass Baseball C1jgChorus f1,2,3,-ill li Eli l It Glee Club l i . . X 1 l li. MARION HELEN ROONEY, Cuba, N. Y. Classzcalg Cuba i ll is A High Schoolg VVOn1en's Student Government Council ll A I t QQAQQ President Brick Mig Chairman of Halloween lV l ' A .43 Party lily lx I i . l l O v - ll' .ll tl. 3 HARRIET SAUXDERS, Eta Mu Alpha, Alfred, N. 'L wt ' A Ceramic Artg Ceramic Guild C1,'2,3,4lQ Secretary C3l! wi l Y. lV. C. A. C1,2jg Honors C1,Q,3j. A i LEO THOMAS SCHLOSSER, Delta. Sigma. Phi. Shingle- Avi! house, Pa. Scientificg Press Club CSDQ Class Football C1,?Dg 1,71 l Class Baseball CLQDQ Class Basketball C1,2j: X'3.I'S1ty iff. Football cog Glee Club Orchestra cw. lb All . Ml i il A A E I ll ' A 'L Al ' BEATRICE DIARY SCHROEDER, Sigma. Chi Nu. Eta. Mu RQ A? Alpha, Hamburg, N. Y. SC'iC'I1f1:flC,' Y. W. C. A. Q1,'2l: l 'll ' l Student Assistant Mathematics C1451 German Club l3pQ l ffgl I French Club CQDQ Honors fQ.3lg Class Plays M53 Sigma Xb' A Chi Nu Business Manager CSU: President C-Ll. 'f .' ,l 1 ALICE SMITH. Theta. Theta Chi. Netc-Ong. N. J. Clas- it sicalg French Club CQ.3D: Sopll-Senior Party til: Theta l ll Theta. Chi Treasurer KSU: House Manager L-ll. A .i , ' ll ll ll l i l kts . i Q :AXDRIQXV lYAl.'rER SrAl,nlxt:. Kappa Psi Vpsiloll. ,., A l l lil1lO11 Clty. B. J. 3r'in1iffi0.' lllllllll City lligll School: LL gl il C ross Country QLD. lixli . - fi V , ' ' N 1 w - . . . l. . ' l l lJONAl.D Emlltn h'rl:Altxs. lhctal kappa. Nu Plu Psi 3 0llli'Q'll., W:ll's:l.w, N. Y. Sf'l'v1lIz:lic'.' Footbzlll tlli Yzlrsitx' it Q l ' . CU: Tllclal Nu Sl'l'l'0lil.I'j' til: Glu' fllllll Qltllg lYlx-stlill.: . K f2.3.4Q: Allllctlc llkvllllkll till: Slllllt'lll Sl'llIll1' t3,4lg IH-K-,- Xxx lllL'lll.f4'D1AfSlSl2l-Ill l ZLIIIPIIS .-Mllllillistlultul' Lillg llusim-AA Milllllllwl' lfml I,Il.l' ltllz llllSlIN'sS hl1lll1lgIl'I' KANARKIYI-lk A xl. i CU. M lu g ll 'X M l r N .N l il V A QA Q Nw' 4.2-PIPE.-is-J'fN .PA . -,.., k ,ww-lzvlaag'-f,4L::,.Lwf1,:ihm.,m,z,-nff-.A-Y.A.,.J A ,Q Fvjty-.sax ' ix X. xi 'l .41 XX yxif-XV -L ..N .a x J ' X , .-XS-x liREN'l'll'E S'ru.LI1AN. Delta. Sigma. Phi, Alfred. N. X . Scientific: Alfred l-ligh School: Y. M. C. A. QQ-,351 Nlass Football LU. hi, Eta Blu FRANK ISDNVARD TATE. Delta. Sigma P Alpha.. Ridgway. Pa. Ceramic En ginccrg Interelass Foot- ball tl.2l: Varsity Track C1,Q-.3,-D3 Intramural Basket- ball tQ,3l: "Spiked Shoe" Q-LD, Varsity "A" Club CQ,3,4D. MAMI1-3 ROGERS VINCENT THOMAS, Alfred, N. Y Scientific, W' ' ' " ties. hitewater, VVis., High School, Town Actu 1- :RUTH ISTATHARINE TITSNK'ORTH, Alfred, NY. Scientific, D n Nlain Q2,3Dg -Y. Vi. C. A. U.,QDQ Secretary to ea Student Assistant in Chemistry Q40 JEAN CAMPBELL TROWBRIDGE, Theta Theta Chi, Phi C Cla ssical ' Fiat Luv Sigma Gamma, Sound Beach, onn. f . ., I . Q2,3,4jg Press Club Q2,3,4lg English Club qQ,3,4s5Q KANA- EA Staff CSD' Frosh-Soph Play CID, Class Basketball KAD . . , CU, Soph-Senior Party CQD. E ZABETH TUERS, Theta Theta Chi,4Paterson, N. J. LI Scientific, Press Club C3,4jg Theta Theta Chi .Secretary QQ, Nlanager Girls' Basketball ' EDXVIN Woons TURNER, Klan Alpine, Eta Mu Alpha, Horseheads, N. Y. Classical, Elmira Vocational School: ' ' 4 ' F iat Y. M. C. A. Q2,3,4Og Treasurer QED, President C D, Lux C2,3,-ij, Honors CLQDQ KANAKADEA Staff C353 Eta ha Publishing Editor C3Dg Silver Bay Delegate Mu Alp . 125, Town Traffic Cop MD. WILLIAM GILES VEY, Morristown, N. J. Ceramic En- M C A C2 3j' French Club Q3j' Cross Coun- gineerg Y. . V. . , , , try C1,2,4jg Track C1,Q,3jg Class Contests Q1,2j. Sang" W A YH. il!! I l 4 lr it 'l.l l ill lf ll l. i. 'i 'I I l il l l l l r ll 4 1 ' e" ' -f Y'-:tif-nf' l' . P - . -Q WLZCL -Ev f Aff- -, if ' mnfif I 126' Y Y . Fifty-seven luv I i' l.. la :li X lil it I l Nl Q ll . V, ix ,-1 ll ,I .fl ,ffl ,-. . W V, wgilfnrli ,!. ld lf Q il -. ., A- ---71 H . L ie- g 375: 1 L L , L 'iz-. P1124 1 Y " " 1 li, A , - e fy it . l 5 li l ix ,Ea l lk l' 44 l l gf! 1 M Iv l A li tl X A DOROTHY HELEN VOIGT, Theta Theta Chi, Hemp- H 4 stead, N. Y. Scientificg Y. VV. C. A. CU g French Club C2Jg A ll L Brick up. is w ' lx ' JAMES GLEASON WAITE, Alfred, N. Y. Scientzficg - if Westerly High Schoolg Milton College C1,2j. li ir E X ill, l 'N it li NELLIE IRENE WARREN, Pi Alpha Pi, Alfred, Y. 5 y l . Classicalg Assistant Librarian C1,2jg Student Assistant ll. 1 Librarian C3,4jg Chorus CQjg Choir C3j. lg NL X, ll A 1 N 7 H 'H i NEAL CARNEY WELCH, Theta Kappa Nu, Alfred, N. Y. ll Ceo-am.ic Engineerg F iat Lua: StaH C1,2,3jg Footlight Club l p Il QQ,3jg Business Manager Q3jg Class Contests C1,2jg lVIan- 1 1 ager Cross Country C353 Manager Track Q32 Ceramic I il A Assistant C3Qg Varsity "A" Club 8,403 'cSpiked Shoe" , - CLD- , .1 I l le l i V . ls .4 41 1 . ll if T ' GEORGEOL.A YYHIPPLE, Pi Alpha Pi, Yonkers, N. Y. l fi Class-ical,' Class Play Cllg Class Secretary CQBQ Executive y y 1 gl W, Committee QSDQ Jumph Fund hlanager QQ,3,4jg Pi Alpha T if ll 1 T Pi Treasurer C3jg House Manager Q-U: Columbia Sum- I mer School. l 'lf H l l '.-5 I . , il gl PISTHER NIILDRED WIARD, Springboro, Pa. Classicalg ll vi! Edmboro State Normal Q1,Q,3jg Glee Club Qlcljz Y. YY. A l j W CA. C1,QDg English Club go. pf 'g,' . W . fill. K ' I iv: lily fu - HERMAN GER.XLDvll'Il,COX. Theta Kappa Nu. Eta Mu Alpha. Falconer, X. Ceramic Engz'm'rr,' Falconer L gif High School: Chemistry Assistant till: Honors tl.Q,3.4l. llllwl lf ' l l'IlLDA ANNA ZYLs'rn.x. Paterson, N. J. CIa.e.ez'm1I,' Pat- A. X in i erson High School: X. W. C. A. Q1,2,3l, J" V x N wi J li..Ax!.'fE J 1 .5 l'i?'12ff'..--e. , 4,,.,.- ,. v 'j ll. f' I M--V.. ,, , , , Y. , , 5 pf, -Y ,Y , .l .Wi it ' F 1Qfty-eight Jes, J" Y-"VjTf'wXxlR'i,-""-.. gc? is N flewf'f'ffQf:""1f"ffTQQN'1-,N-'Hee---.,,,,W-m...nh ,,,,..,M.,,f',.QQTj fxf.,-NK' r-:QQ-N,..,.c.c W M ,M , esmg fe'-an f .life-gg-D' Mg-,,.-'jiylajz-w.,-1-" ,ii-V-3,f.f ,. ,Y "Q Qu -N M.. A ef?" ' fi jwfff '-5:""'e-fa' 'f---1+-F ,,,,"."5fz""'-W s-s,,:-Jess.-e-lewgt-f--ex,-N-Ibex MA --rs sarftfw-if Kiwis Qs. fr-fcf1'7f eff -ess:-f", . 'fs fri ,- f....,M.V --.W ...---...A pk., ,N,,g- . fs., ,,NhJf - A, JN. .A , - .. .qv v 1 I v....,.- - L---W A .2 V .g S. .K ,fm ,ag -Ja. M., Y y N ,lisa il Seniors Four fleeting years, held for a brief moment on the threshold of time, have Y slipped away. They have taken With them some of our rags of prejudice, dogmatism, and stubborn beliefs, leaving for us shining garments, open minds, and a desire for i service. The universe lies before us, it awaits our hand to guide itg our mind to mold it. VVhy do We hesitate? There is such infinite peace breathing from these hills of pine that We are loath to leave our loved' Alma Mater and her protecting Walls. The World beckons. Q We stand at the slow-opening portals of duty, ready and eager to serve. 'A l l 7 ,- fp. .ff f ,,- 1 -., , ,,,, - ' Q. if X 'T wk 1.5 x if Q, Y, .1 i Y iq If W , i Y i Y ix , , , , 7 : Q , x TX h ' Y -Y ' E AQZTNQAI- ',,1,,,C' ,f4",,Q.ffQg:?,-ciA,,ei" ,,-cj! - 1,5 -f 4-,g fr '4-Q,-ff -.Arr Y -V Fifty-nine Q x xii '4 '.!. m ' .J I Y. f 4 2 fix A Af"if' PQ? , , J-1' ll ' in '?"-fa-4 fx Q - , ,.,..A..,.. N...-...,.,..,,..4, i ,af p X1 aff: ! A 'izf j EM sy 3 ff 1 X 2 ' K? . w 2 x fy . ' V: 1 ' 3 ' ,E 3. 'I .J I JA yen Nil 5 hm u gi f ff - in k! R,?Q"'i A EM W . iff si . 1, 'Y Y :I N U' E Q . U N fi. in 6 lx N nf!! W I ' 1 My' X f A W 5 ,q N , N K M yu! Y EI f1 N N ',1 'LA E - ? I I! ! 'jx lqgxi :1 I' X i . x, 1 Fi x xx w e im a 15 J Q Wai wer My K I T W K Tie Ab N., .-'fr ...J y, XQSV tl iv A xi ,I t ,Q QQ? F R spy! K ,f My 5 E .z W gtk? :N 1 . f X 4 E , lk . PX- . yi xl A XV 2 2 .fax I 4 x E E F Mf,..1,,-,.....NS4l.--4.4,ikyf,,,,.. .,., ...W.,,-5--1'-1, .,..-.,..-,X.. ff--1-.,, NT.--M-..V ..,.., fi4L:-+J1f2f1i.:,w1-32:75, -if - .1 , , ,h,,.,-f-If , W ,,,.....f-f ,H , ' -M S1151 gf Q k L I n w K H Rx . -- ,. ,.M,,..M..uali'n4 fi ji 'nf' V, Q! U X35 lx xifl Q' w 5m U V A E: M 4 If ,IX K5 V- f 'A w W M W A Q 'M ,gh ,P !. M W E 9 M ,W 5 W .xg Q -'------- 4 f x 1 " f if .1 .712 fl fi if .Vi "IV K ri! Tu 1, 1 , . f ff: 3,152 . I , 1 iw mfff, .1 ze, I WH 32. fi A K I X. ,,, l W e 2 " 'Q Jv' X1 X ,f Wy J lix 41 NW 4, Ni X1 ,. ' f ii .' ff. 41 ' M .QU V W L 1 il 1 A T4 M 'Q .gli I, N +5 me W Nw WA 5135 J 5 ik ,Ji PQKPA 'xxwnff KW 3 QW HW IM WW ,fp J fha! EEE' , xp' Sify' n . N. . ,914 ww ,,,Qv-,,.,,Nb,v,..:..,,q,.., ,,,fx-Aff'-x,, A'f:'m'2-w,...,FS""'6' M4 3 , , ,W--- aff' "X-6'4" "' ' 'x""'1' Y --x--bf:-,, '- ,.ff:11L.,k '-,-.- xy' ' vw 1- 'R ,..,. , ff-- ."""N"N-"' , ' xf'w--- Nf?""'-:X X11 'if X ' 4 "M:---X ' .Ip X N f' xx : 'A' .0 . 'Nfl' NJ 1' ,fu ' ffm-Nfff- , Nflwn N-fn-Six czx-cf:?XXx,,-fyxxf fx TfQfff,f NX5ff,f"Bl'fffJfJi1:biij?,-x5j'pXCQi:QiJj! r - v - -, ...f xx, ,rx -.- 'EN X, ,rx K ,f ,xx f x,f .Yr ,,,-I 7,01-'L' .J .g,-,:,: ,A ,.,,,.---A ,,-Tn...-PY - f P 4 F A-f-of df- L. -X, ,ual -. 'TiZ?"v-. "1" flfafxfy if' f'...:-9,f"-4-ff' :MW --:Sf Mfg, ' ,ffl YY,,f2f L.--1,,,,-f--V-hcg,.-if-V'+22,,,f.x,.,.,:,,-1, Q..,c,- .-f ,. 3,-Qff ,1:,.V X,ff1,,,W ..,.-- ,f -- V, 7,1 X., m,,,,.- --,y....,. fry- - Y .Y Y ., J, ,mg 2. --.-lb ,Q .:,hYn!,..f W,-f..-,,,.fffi.W..,f -W-.J -ff Sixty-one Thus quoth Alfred: If thou hast a sorrow, tell it not to thy foe, tell it to thy saddle-bow and ride singing forth. So will he think, ' I who knows not thy state, that not unpleasing to thee is thy fate. If thou hast a sorrow, and he knoweth it, before thee he'll pity, behind thee will twit. Thou mightest betray it to such a one U as would without pity thou madest more moan. Hide it deep in thy -heart that it leave no smart, nor let it be guessed what is hid in thy breast. -Proverbs of King Abfred Delivered before Weztanagomote ...A N-3 J 2 Yi 1 A ix ' P mx! mmm, 1 x 1 , l, fx ff "M , 1 . L ,- n 1 A H . fx , 1 4. . g 1 Q 5 0 0 XX as GP A 1 'V 4,1 1 A f' fjm 1 Q, Q 1 MQ Ma 2, .X ' I ' 'J 4' H! 1 Q 4 '-r ' .4 in gg? uf ,ff I-Q2 Q X X -g . I' I---+ if YQX N "U 4 222 f W, Y Ha", '- ' if B' Q I O. 4 vw 5 l 511 , 4 3 ilg Q I gig? ' 4 , in K1 lu gi Wi? ,,,w . :V I, f Q7 N, X filibhl f . Q X3 y. fi ' wa 'L' I fx -Ng in 3 A P1 3h " 3,595+ J ' fu AQ EW' Q, lbf iff' -Ti m if A 'hvxfzwr' 1 'ffl' -.:' ' ' ,Q . - Q5 if -- gy rr -.11 . ffj , X 1.-11Q1D,h .Lu '1- ' , 1-"Mm Urmxw ff S Qi EQ f E! , A wan -' '21 -2 fy: 4 - 7 g fx sg n , - f M as 4. 1 A ?: f ef' Z 22 .gi I ,i,A ,""""',... 4,51 Ak ' fl" I -3:11 f rp gf-11? ff ,' 1 ,-1 x gy ::- Y M XW ,.fy,, y l . X 5 A si .- 5 .!I,!IlfZ1g5' f 1 lim ML 3 2 Z fl S - X is A W U bf' ' XX 1- 5 fl ff 'fl 24 W ' 1 1- .Q 7 ,' - S W ' 5 A A ,' ,: S 1-.7 f , fn Ali usa - - " I Y X 1 1 ff va- T3 ,. , S f 4 .. L' nfl N ' W y 4 - ,il ,f j ,Q N1 J A! 41 ., I! If - ' n Z ,Q - h f Z fili 1 X3 ' if ' ' X RX- ' ' 1 'A 79 fi "" Y mx 1 BL fx, ij if?-DDQQQMDxmmnm.QLLLQMMJUDEDLUED-1m.m31uluuu.uiu1rn1,u1mi'G3Imu,u,x.y.m1LKmJ1AZYJfCBJ1El3i1JLLliU?QqE.iLLLsJ1I1.l 3 ' X ' S X? E ' X , fa ,X V- ff , , Gs' 7 V, M V V it V .I 5 1 .1 f 'T' I 1 mm ,u mm I .sw 1 m Q 'ie A 1 i 0 W f gimcgjj , f V . I f 1g?'XY'XXX n :ff , yx . 1 ! 1 L ,Rx , Ng jf "X i" w ,fy Zi 1. , '1' W 'i w 11 f AFT ' T :zu fm' if W 2 Eg W is I 5 xg? QgmilimmuJ4.uJ,u.Un,m,m,LxJHu,Ll,qLl.nIVEu1u.m.uJ-mnmm1mmmU5.m.u,u,uJ5m31,u.u,musn.um,muMmm.w 1,5 Jil A2 E1 R gk X . ,, ' A ' Y x I X TY X F Q ml:1L,. 'A - x VN, ' My m Qgmm1: mgme'Mmxififnmiw'mx1U31s'9immxfmu'ummmm'effmsinmw.wu3gw'me1m"eAe1fm'Q31mml II, A A Aa mi ,-Y-I, E- y 4 fz rf ' . , Q fir. if I K "x ' 'L'f5e"f""LO" OJ R OOJKEE 'A - , if re OOOO J LC' I I I I I J .J 'Af Y-ny s e' if 's l fl! :A A J I I I GYJI , I , I jf I f U, I N V! gi A 1 W kxvlli I 1' Q6 ' I1 A J PI, Dv + I .M A 48 I U A ,I ff JS N' if V Class Of 1928 hive' iwfy A W 'S p + I OFFICERS W I DOROTHY HOLLAND .... . 1,l'i'A'I.l1Q'I1'f GEORGE W. BLISS , I'I-C'C'-l,l'z'.S'I't1Ic'Ilf - x WV A' 54 QA 5 v S WILLIAM G. COLLINS . . Sf-prffaf me N I .U , A A I ' LEONARD ADAMS . . , 7'rI-In-14r,1r if Q A A I RJ 'R s 'l Class Yell In I L Wx' I. On timeg never late: I- 5 I A. U., ,QS 'X MIRIOOR I Q mx. ,K I " rge ' 1 I1 wi 7 . A ' I If !- L A I I I mx Y , fl I I I x X X I if . xv WI I I I ,Tx f Q. A Y 'I i 'j 3 7 :Nw 1 I il I f f F Rf H1 If 33 xii gg L , fm M i X Eiyfifi fe-fm f. wg ff' 1 ,A up I fi J' 4, "ff , I Vff i S'1f:cly-four l '. ll wif lluNxlll'l'XlXlll! Xl1XXls V XX M x N X , l ',2f, I 'jf . nf? htm Xlpxm- ll -' ' if , - X, N H ,,, if ,I isiffflll ein, , r X . I 5 I J W I J, , K ll,ffv. ft fl . i lhmll, lil-mil, vhiixx, mil, ll,-tl-yuumwl, ,VW -wlxinzi ull.-.lily 'U-lllllHtlHlll1ll'tllY K 'illllxf' gmnl Ht lin' -'qu' :-1K V ul' lgm llml lim' ' has vlmwn fm' limi--'lf X xx illing xxnrlx- 0l',Llt'lll'I'l.lIl ll1ll1i'u'I', .llltltlPlN'l1ql1ll3lq'i1l llic vxlrvmv. lu' in-uw' llllI'llIlllx ll Mule limi lu' tlwvx xml guwwnixpllsli :mul lu- liilfjij? :M'll'rf NMI il fix lm-i-11t,tl-mpml mam. If ills l'Ull2!'lXlLll pvl'-mlgglity, hi, 4-ll-up lvziritoxw ruin-. null his LIl'lU'l'1lllsUlltll1055 ilk 3, for nmsiv. inzilw him gi xwlvmm- gust-1 10 any party. .Muwmnam-lmtrr,limimm-,"lh-11115-" has nuulv Ll ilismzil fziilmm-. f , 1 l P l ,V 'Y D fix I twin wk J il W.-,y i: I 4- lil ABDE ALLY if w HYDERABAD, INDIA ill, y enmi, Ceramzc Engmeeirmg llgjgll I 1 'x l l . . . . . W' Halczmza Coronaflon Hzgfz School, India yrsj De ll'iff Clinton High Srhool C1 y'r.jg C'e'ra'mic Sociefy. - b ,ll ll As a perfect gentleman, Alode's man- ner, his voice, his actions, and his very ,Ay smile bespeak an inborn courtesy of which We Americans may well be jeal- lgiyf' ous, a good scholar in whatever direo- tion he may Wish to apply his. thoughts, it a sportsman, and a ready friendfour WM representative of the East incorporates Nil W in himself an absolute contradiction of that old saying Hand never the twain, 'tfljlll shall meet? Everything for which we pride ourselves he has also. If 'there be Wllg . . . . . a margin, it is in the favor of India. gpwif Abde Ally bids us look to our laurels, l g,ff,N but with no offense, and We are happy ,Wi to have h11n with us as a friend and fel- My t -'-Y - low student. ,QQ , ggtgy ,uN,,.., ,s , ,A n N ,M Am rm, ,..,....-...R 4,,- ,,.,.., , E ff-7AJf"f g'Q"ilI fini-:-"1i-,T' f-e, riff'fig?s1"iW.3'1f-f-Q2-1-vaoMcfgii'-TI': ,"'fI?,m"21i-'-Triffgmugijglfllgffa X' " "" Q -fff ffigffgff-1,1 f,:'fL:::r'f:ffg:lffffbdffi-,gifff,,zT gfN.,4fwbff:f:rs4:,23w:f4if ff -' ,q "., ,,,j,,-f ,wwf -.,,.,,..w'L ,,,,,.,- W'---1,....-ef-..v,..Ji,,,f-f,,.m,:,,.-f1.E,,,,,,,,.,.aQi.j':,,'j,,,1'j,'QTQjwP+1Q Sixty-five f-.,,f , Mei,-1-f,f.,.f , t. M, , """'f' - ,W ,,,f' ,-i, ,, ,ff -- P V I 1 l -ix 'r ,...f ., H. V -1 Ef-' M11 Iii, 1 .AX 1 l 4 I 4 'Z W3 fl" ' l is 'rlilf 1 ee "X L i" 'L XV LM wi riff: 'gf -e fy 'f ,, DAVID ALTNLAN QQ if ASTORIA, L. I. 1' LV lt Mm' H I S I Siniiwey If University CD L ' .'cwo,,ew Orff - lx S05li2fg'iLZ9h gcisebfgllj Intramural Basketball l l Q2j,' German Club 2 . 3 7 J ,J i l 1 v EQ s ii David is quiet and unassuming, re- fwfr y ii minding one of that old adage: "still il ' Waters run deepf' He is one of those fix-L! that come to college with the serious in- r, tent to study, and he surely deserves K lil credit for his efforts toward the realiaa- fbi! i ry V tion of his ambition. The eagerness With gtiif i which he fairly devours old literature fi and verse makes us wonder if there i 'vii isnit something of the poet lodged be- 5533, i f fi hind those dark eyes where dreams ifrfii seem to lurk in the mystery of his reserve. Tyr aryl, Y L ii i fail wg, I Wi W I . :ii L Liu f, A MERRITT HALL BIDWELL FRIENDSHIP, N. Y. X f Science Friendship High School. Track C1,Q,3l. is ji cc' ' as ' rxigjkfi Bid IS of t.he reserved and unas- y suming type-simple in his tastes and impetuous in his manners. A sympa- A , thetic nature and a shrewdly practical Wu? mind make up his outstanding charac- teristics. Few really see beneath the surface of 6'Bid's,, smiling calm, but to ff ji his intimate friends he reveals the true liifliiii sincerity and depth of his nature, and f,f ln numerous ways endears himself to iff -Ki I those who are favored hy a glimpsc of ii the real Merritt. i J Srfrrly-s1':1: GICURGIC WAl,'l',lCR. BLISS l3o1.ix'A1:., N. Y. f'1czss1'c'aZ A E Sb H0fI.I'l1I' I1 fglz School. 1'l00I'bflN Q1 l'vlll'SI.li'Ij P11111 QI..i'.Jj,- Sz'1uI4'nf Semin: :11'1IIl'fI'C l'ounc'z'I L.1'.4il.' Cllcmv PI'6'.9I'!1l'IIf Q1 Slzulvnt Fam- pus COIIFI' L.2.JD. Coming from a long line of Alfred graduates, George has maintained the high standard set for him.. A gentleman -sincere, cheerful, true to his purpose, and a man full of determination, he usually gets what he goes after. George has exemplified this by accomplishing his ends both on the gridiron and on the campus. He is Without doubt one of our most consistent football players, having been a star since his Freshman year, much to the pride of his class. In college activities, his prominence has increased steadily, until he is now one of Alfredis outstan ding men. "Pete" has a winning personality. May he be a Win- ner in life! ' I H-K ff..- V ,,,.....- -X ,,,---vA.,K,..-f-' 1' . ,,f+'w,,.N-1'-'N'-x.,- ,J fd' "- ..-' ,,... , ,...,.... ,-a.,. V---. V.,-,XF ,ins . 1..,,, '1'i , . MX.. - .X if'-. X .X N ,- 1"' ,,.-, ' ,Af g- 1.--' ,f fi? ,f 1.:'4f5,.11. .,... , ,-. ,L , , ,.. , , ,f- ---- f -' 1 '-" 1-' N' fe-' " .s ...,,,.ff -U.. , .rf-fe - ,,,, AMM1 -H.,-M,-' game' --NW, f---e 'N--,.. I a ,-Y Q f fx, ARNOLD BOOKHEIM fhLBANY, N. Y. C'era1n'ic Engineering Albany High School. Class Football C1 jg Cam- pus Court Q2j,' Cheerleader C2,3j. In the midst of the political wran- gling and dissension that inevitably arise in the most co-operative of classes, there has emerged a figure from the Class of '98, Who, by his persistence, has often Won the floor of debate. He is there to argue his point-be it right or be it Wrong. "Bookey" is always to be found in the midst of those more or less friendly battles that are the yearly out- bursts of lingering class feuds. When he is not rooting for his Alma Mater with both lungs, he is leading cheers for the rest of us, that We also may express our emotions toward old HA. U." ,vm 'M' -. ,....---Us-. .,-x.- s -,.,..,.- s.,.-,,.-- nm...---'. .. - .. . .,..., fr. ff Sixty-seven ...K X. W.. , -gnu. -X... ...Z X-...-..,..,N-gc.-. wr' , ' . 'X X ix- .- X s 'X'-. 'X 51-N ' -, .,'-. ' '. -. N" MTX- ' . f px 5, xg, fx J , J. fxx X, X 4. A .ff 2 4, 1 J X if 1,1 :,, 1. 1 ,m,,... -.-Y-- 1, ,.,.-- f ff --'- V, .,.,, 1 .Wt 1 l 7 ,.1 I l I I ,' 1, ff., 22 ll fl! l 4 .5 l 'i lil 57,1 fx ll. Y inf lm. ip if l 1,119 W1 X wif! alfii .Vai "4 Lvl gal 1l2fif'Z :gig livffyl I-N fl' Eli? lllff. f. lt'-,ffl flxitl! ll Willy. H, zfil flxilf l W Hill , x Q.. f lj, 3 K Er' if' 145,113 X, FXR! e i M54 iw' W, Lf: 1.1 . ml 5 f ll nj! li 'wi W i i Z' lla? I xl rl 1 tlfjl ffl 1. l , , :ffl I il :gl i ffl! L i'.l,"'l i x , 1 1 T1 I 2 'TU n . ln-'X M3 4 Ml. i i fl-i5 I y I Iggy. NWN Nall xy., , i 2 7 i i 1 . ' Q 1 ,-Q.,-N. ij pf" - fer-sq4j23,W,fi,fZ3 fs, n,f1QL,,,-fiilf.,'Z5-ff--1" N--N" s W' s r ls? v,-14+ . iff!! 'illrll LYLE CH.-iRLEs CADY , 5 , T f .fy ljll 5 AnAMs CENTER, IN. X. QQ l I f ll l Iflassical ff 5, lla' , l li' X Klan Alpine tial Ill - v ' .. .-, 1 1 7 ' -legal, lg! Adams Hzgh School. 4 flu.--sv lffllvlffllilll gf! ld Class Baseball l1.?,l.' 'flass' .loofhall If-J. Q H1400 115.5 ik P1an-c1.en,- H0f10f.f 1.11: I fffwy lf ffww- ij? i!,i i f - H lllfl Wlhat shall we .say of Lyle? It 12 9- QX ,fl problem that requires discrimination in- gy, 'llffl asmuch as our space is too limited to permit a full account. Perhaps the Q llrlll first attribute that springs tothe mind ffl on consideration of Cady is lns prowess in the field of wrestling. He has won il1g,4'l fame there: indeed. so great is lns zeal y l'll:gl-, that he has often been honorably and r .ill tittingly decorated xrith that worthY token-Hcauliflowers. One wouldhard- lv believe that there could be so much F iron-like muscle and brawn in a person y of his stature. Although we Sl10L1lf1 . llltll warilv avoid a pitched battle with Lyle. X ii! M W, .,..i,. .. ,, llffl N 9 lilly? . llkll P :fi wll r x lll fill l EMERSON GIBBS CHAMBERLAIN BELMONT, N. Y. , ll ,VN Classical ,,:xr' . Klan Alpine ll . li ,er,,r ll Wilsonia'r1. High School. Froslz-Soplz f'ros.v u," Country CQL' ':F'iat" Reporter CQD, Asxoriafz' Iirlifor C3j,' Assistant Football Manager Coll: l11fc1jfn1fv1'- nity Basketball CQj,' Y. M. C. A. QLQD, f'ab1'r1f'I lil. l ,jill 5 ,. .,,. J. l "Chame" is a tranquil and likable r fellow who possesses an individual cha r- l 1. 5' 1' l acteristic that helps him to make friends and keep them. He has a kind ol' soci- ality that only those who know him in- timately and enjoy his ardent friend- - ship understand. He is agreeable in companionship, amiable and sincere in manner, diligent, earnest. and indus- l trious as a worker, and always shows an eagerness and alacrity lxo lend il helping l l I hand. Sfimty-eighl as friends we admire his sincerity and purposeness. and have often taxed his Qgood will. never to lind it wantingf I, -5 Y tation. il F1 fr 1. - ' il A . Mi , xxNv1- , ,-I . x - - 1 ,ffl in N . Ag... '1 1 E 1 .E ij-11' A ft isnxlxt 9, clit-xR1.Es Nuns C1r,A1R1-3 if ALFRED, N. Y. Wi . ., N Scicrzcc lp +I Alfred High School. Honors QLQD. ini' X' N ' ss ' - - ii 'fLl1arl1e 1 IS a diligent student. ll-lle 1, I M claims no athletic distinction, but holds ilk A, It honors for his scholastic ability. He en- . 3 .xp 1 and has more than 111ade good the repu- tered college with a State Scholarship A i ,'F Behind his modest reserve We find a W to joke. Charles can tell you how itis .f done, Why it's done, and when it's done. VVhat's morwhe is always Willing to 1 ll. All gif clever personality full of fun and ready tl help, so if in doubt "ask Charlief' 4 1 1 l i, W V it l I A if 11 it n N' v 1 lf. A li 1 ti f. ii il 1 5 Elf A it A ii is 1 M fs l JosEPH EDWARD CLAVELLE QUEENS, L. I. 1 Classical it Klan Alpine A Jamaica High School. Assistant Manager Cross 3 ji Country and Track 12,35 .' Assistant Business Blan- ager "Fiat Luxn C3D,' Assistant Business Manager KANAIL-iDEAg Frosk-Soph Plays C2j,' Footliglzt Club C315 Assistant Campus Administrator C3D,' il Le Cercle Francais CLQJ. lg Go on with the music, the dance may if gl l start-'iloei' has arrived. lt I A. IJ: V 1 Alfred has its criterions of the terpsi- it 1 1 l S ii 3 chorean art, and "Joe" is one of them Us 1 Sill . by popular vote of the fair sex. Al- ,li is 1 though We surely appreciate the Way he if 'ii li. W X has of using his feet, we are forced by if A fn circumstances to admit that he uses his p ' head equally as well. Leadership is also it 1 l Xe 3 his, bolstered up by a faculty for busi- tl- , ness that spells efficiency and financial ff, .ji M gg instinct. He is here, there, and every- AW g a -1 ' ' ' l' A . A Where at once, It seems, leaving unmls- fig it If f., takable traces of ability in his Wake. gl XJ 0 9 0 u 'l 'fig "Joes, most endearing virtue IS his 'lxfjlk J 'enerosit in the lo al effort and full- tl If il g . . wx! gf ness of support which he has given WI. fi thin s at Alfred. ,ii ll , 'x 1 ffm gp! A il 4 iff! -M - -by of :af Sixty-nine f f CXVPXC :ww f J r' f it ..a,.4, ,....- x,f, ,wA...,,,,.,-1---W...f.:y-'MH--B' If g J, . .f'mf'N:' X js., 'fjffffyl ftffff' ii HERBERT SAMUEL COE V WILLIAM GEORGE COLLINS NEW YORK CITY Ceramic Engineering I A E CID Lake Placid High School. Class Football C1,Qjg Class Plays Cljg Interfraternity Council C2,3j,' Vice-President Interfraternity Council Y. M. C. A. C1,Q,3j, Cabinet CQD, Vice-President C3jg Intramural Basketball Historian Delta Sigma Phi CQ,3D,' Assistant Editor KANAKADEA CSU,- Class Secretary C3j,' "Fiat Luxl' Reporter C1,QD,' Ceramic Society CQ,3D,' Chairman of Procs CID. . "Bill" isa bit hampered by not hav- mg. the skiing and sledding facilities to which he has been accustomed, but he manages to get enough of joy and pleas- ure out of existence at Alfred, despite Weather conditions. Engineering shouldn't give "Bill" much time for extra-curricular activity, but he still mixes in quite a bit of work aside from his studies. Serious when need be, he can be as jolly as the best. A pipe or a good cigar and a person with Whom he may argue are all that "Bill" needs to make him feel content and al' peace with the world. Seo enty . SALAMANCA, N. Y. Science Klan Alpine Salamanca High School. Honors C1 jg Assistant Wrestling Manager CQDQ Wrestling Managers Cross Country C1,Q,3Dg Track CLQDJ VC1T6'lf?! .A Club,' Class Cross Country C122 5 Class T rack C1,QD,' Interfraternity Council C3D,' Y. M. C. A. Cabinet C3Dg Delegate Eaglesmere Y. M. C. A. Conferenceg Class N umerals. It is such as he who will make the "Dream Alfredn come true. A strong, persevering, congenial spir- it has made c'Sam,, a friend of all. He is another of our quiet, more or less mod- est, Juniors, but his feet talk more elo- quently than lips ever do when he sets out on a cross-country jaunt. He surely shakes a "mean anklef, and because we are proud of him, We gladly pardon his dust. N. l .s. fl ,V .v I V .3 wp fi, CIARENCE VAN DUSEN 1. I I r f v lg ff lc x 'L r w ,H I X CRIPPS .X BELFAST, N. Y. AR Science it 4 A E fir S, U is I Belfasz5vHz'g.lz. School. Cross Country,' Basketball . fl Q1.9,3D,' T arszizfy 'X-1" Club. fl' Little can be said of "Dutch" until you have really become acquainted li, l with llllll. He goes about his work in a f X25 quiet manner, but has that sincerity .wif - - 1 ll i'V. ii. which brings results. Although not a M star .in basketball, he has always been Mli consistent and dependable. His deter- l M nunation and fight brought him a letter l il if in Cross Country during his Freshman y year. In Work or in play 'cDutch" is Q li 3 always a gentleman and a sportsman- 'Q li, perhaps no greater tribute can be paid ll it V' a man than that. . ii ,I as il 5 Q! i' . X I! 2 4 M 111. . W M J GERMAIN CHARLES cRossMoN i , 4 1 wi PRATTSBURG, N. Y. 1 i J. Science wi, . ll? l K XI' T if ll fy, Prattsburg High School. Intramural Basketball I if gl ,C1,Q,3D,' Intramural Cross Country CQ,3j,' Campus gil C - 'll Court CQL' Interfraternity Council C2,3D. all Everyone admires a man who will fi li. 5. put his very heart into an undertaking . H' and do his utmost to give the best that 'gi is in him. Such a one is Germain. What tf We know of him We have delved out for - Al, i, ourselves, for his modesty prevents him i- ' from making his many admirable char- lv acteristics too evident, but they are y there, nevertheless. He .cannot keep ,Q them from us. Germain is a good stu- J li dent, a sincere friend, and an Hall- ' if around" sport. We predict for him un- l. limited success. in Whatever line of en- deavor he follows in future life. it lid? - . - . - if f 1 lf-sf---P-ev vfwfftr--1:3 QNfL-.g'w1T"fT-1 'Nfl gg 'fat 12-fig if 'eip iff .X f-fg . ' .gi i il, S eventy-one Fi ,f if Q - K I 1 'X ill, -L Ve? ll gl l WENDELL MARSH CROZIER . fl l CANISTEO, N. Y. , Science VA X, e K N .F 'Ll Canisteo High Schoolg Meeker's Business In- Wg stitute. y l "Wink" came to us from Meeker's Business Institute to major in mathe- l matics, and We feel sure that he will be Fi a big asset to any classroom. He is a U consistent Worker, a deep thinker, a -33 loval friend, and-note the incongruity y L lhe plays the saxophone. Tallness, gy broadness, and a seriousness .of mien ii might give the effect of austerity were it not for the contradiction of an under- L L I it standing glint in his eyes-convincing evidence of that saving sense of humor. . ,f V J .li L tl h ii DEsMoNn EARL DEVITT . it tl MALTA, ILL. i til Ceramic Engineering Ei A E CIP y University of Chicago. Class Football CQL' Var- C l fft sity Football g KANAKADEA Staj M embcr Student Athletic Council CQL' Assistant Campus Administrator C3D,' Alternate on Campus Court CQL' 5 ll if 5 Y. M. c. A. cabinet 131,-Footlight cab, Business s X53 Manager C3D,' Phi Psi Omega. gf Yi ill A It is difficult indeed to attempt to Al E evaluate a man like "Johnf' VVe should fi it fear that our words might sound like fa platitudes if our subject were not quite Sgt so familiar on the campus. "John" has f l distinguished himself by his cheerful, careful,.and consistently fine work in everything that he has undertaken. He lf is the very essence of dependability and ix efhciency, and bucks the line with that L 'A ZR same determination which character- 2 izes his scholastic work as an engineer. l He wields a pen with that same cris Q L S . . . . l style which typifies his acting. "John" l has richly deserved election to the cov- eted Phi Psi Omega. He is lnaster of himself, and he will be a leader whom men will be proud to follow. i, Seventy-two ,. 1 . i'- . 1 f 'r -.l 4 . it K X 1 I l ' it Mi? .1 .' 3: .V ffl YA it, , , , ,Ml 1-:mu xo riioixus l W ool'ul11f:1:'i'x' l lp 'ti l.oNl: lsihxxn l'1'rx'. N. Y. fl" ll v ji .X I Lb ly 1 Hi rznmlis Iliglz Si-hoof. Hi "Doe" Dougherty has not been in li Y VXA school tor 11 tew years. He IS a modest. R conscientious. industrious, independent ali sort. of a chap. He never enters into a fs gm project before carefully thinking over ll p 555.5 the outcome. He IS seldom found doing 1 l nothing. as he plans his work well and llfvli ff.lll',l does it according to plan. "Doc" forms +A ti .X very definite opinions about the world 1 in which he lives. and though never f U prone to interpose his ideas,will express V i them only on persuasion, but always in l clear-cut, unmistakable language. One L .xl will End "Doc" always a gentleman. U Qi 'l' 'ii 5 all il ill A .yi li pl gl ' it E lg ARTHUR HARRISON DUNN it ,i vftwl f A SHINGLEHOUSE, PA. pi Ji Science Al ,il Q A E CID if Shinglehouse H igh School. Basketball C1,92,3j,' N Class Football. ul p ffl! His is a long story-something over fi ll! ii six feet, to be specific. If "Art,' makes ll grad? as good use of his years of mental -Y jp growth as he did of those of physical ll pf growth, he will leave Alfred a well-in- fy formed man. llle trust that the case will Mg A be thus, drawing our conclusions from l ii i the serious mien that he assumes on the llgigjr campus. ln basketball play, 'Artw li' L' mfg' Hnds his height an advantage. He picks the ball from the air and drops it into 'lk the basket with an ease that liasalways M y been a boon to our class team. "Art ' is Y an interesting and congenial companion, gp, and so there is little 'wonder that he 'Q stands nlllglln in the opinion of his class- f l mates. A good friend and an able stu- typ 'glflg y dent, nothing can keep him from a LA f l deserved success. J ,ffl 3 -,"e - Ho, -co no ,.,- ,--XM...-X ,. a gn, as ffl. ,cal L i Seventy-three i l fi li Xi X IW. 8 FH. A J Nfxfffixlx-"':'t'---4-3:'t't"t..r.i3fgiiltiigLZ3'fggl4.l ji?-11?Tt ,' li' ll YV LM! ARTHUR LAURENCE FOTI RAYMOND EGLE FRANCIS p LIMA, N. Y. Classical ' 9 K N Lirna High School. Class Cross Country C1j,' Class Debates Cljg Student Assistant CQ,3D,' Class Secretary CQL' Y. M. C. A. Cabinet CQ,3j,' KANAK- ADEA Staj CQL' KANAKADEA Editor-in-Chief C355 Honors CLQD. " 'Ray Francis? you say. 'Wliy, everybody knows Ray'.', "Someone called him ca brilliant scholar, a fiery debater, and a true gen- tleman., He's all of that. Ray's a chap with rockbound principles, ideals ga- lore, and a definite aim in life. What? No, a teacher. I'll bet he'll make a mel- low old fellow, too. He admits now that he's interested in affairs of t.he intellect. Ray hasnit lost the common touch, though? he has a 'sympathetic under- standingf I guess. A good mixer? Sure. Everybody likes him. He's the 'prince of good fellows'-but a hard worker. Ray .can V16 with the saints in a philo- sophlcal discussion and yet laugh with the bunch at a brisk story." S S evenly-four ROCHESTER, N. Y. Classical A Z CP Honeoye Falls High School. Basketball C1,Q,3D,' Varsity "AH Club. "Art,' is a quiet, rather modest, fel- low who is best known on the campus for his athletic abilities. Basketball is his game-and he plays it well. He also excels on the baseball diamond, but, unfortunately, diamonds are almost a minus quantity in Alfred CFraternity pins being t.he usual mode of expres- sionjg hence, Fotiis talents along that line are wasted and he is deprived of a "Babe Ruthn career. Good, honest ap- plication and hard work have always been manifested in his studies, only to prove as a result that Hit pays? Among those who claim to really know "Art,,' he is esteemed as a gentleman, an ath- lete, and a good sport. lQl'S'l'.XN'l'S l"lt.XXli Xi-:xx Youk Viri r . C i 1 li 1 ll -N1'1c'I1t'f' X J if 1 Ilvfizy.sfi'ii-I Ilzylz Nrlzmvl. liuvfluzll tI..'l,'Sfml4'r1l 2 'Q Viinzplis l'.mrf. I "'l'here aiiu't no justice!" "Gus" ill! llaiuuts ai wave that is the ohjeet of ev- lil ery iiiuideifs envy, :ind lo he NFl'1lllk.,u il it is worked out iu ai red that would be ply Titian if sported hy an woman. Despite l. this evidence of temperauneut. "Gus" is very husiuesslike in his attack upon life. In his studies he is euruest and in- .li dustrious: in the performance of duty ly he is dependable. Like the majority of men. he has a hobby-photography. He Q has put into picture form everything on C the campus that students will want to W remember. Of course, it requires fore- i. sight and good judgment, but he has both. His versatile camera is known to N have been used for shooting Hdearsl' in p Frosh caps. Wie don't blame you, "Gus" ' my 1 l 4 1 . i EUGENE WILLIAM FULMER OLEAN, N. Y. P Ceramic Engineering li e K N y y Clean High School. Class Cross Country C1D,' is Class Track C1Q,' Class Baseball CQL' Class Treas- ,l urer CQL' Fraternity Basketball C1,Qj,' Fraternity ly Secretary C3Dg Campus Court CQD. yet "Gene', is a fellow who does not let y business interfere with his pleasures, fi and yet somehow always keeps up with 5 his work. Tell "Gene" of a dance, and A he instantly forgets all cares and is 2 ready to "strut his stufff, Sham has no place in his make-up. "Gene', has an . unlimited supply of good jokes and sly if humor upon which he frequently draws ' heavily. An all-around good fellow s who will make good Hin the wide, wide li worldf' m. R5 "r-'ff"""--4' -N5 'if-1T'77jT"frl, if - ' ,E 'ff f N-ff55f5fif xi 'L' af,-A --1 " +11 ,j-1-at-f"il C S eventy-Jive J FRANK LESTER GoBLE WAVERLY, N. Y. Science A E if Courtland Normal. Freshman Coaclianrl In- structor in Physical Training C1,Q,3j,' Burdick Hall Head f2,3D. Here is a man who deserves credit. Coaching isnit the easiest job in the world, especially when attacked with all the vigor that a man can possibly muster. Frank Goble has shown his un- tiring energy and spirit in the push he has put behind his enterprise. He is re- warded in part. perhaps by the respect manifested in the very attitude of his team towards him. That alone assures us of his success. VVe do not know where he finds time to study. His pursuit of knowledge is not neglected, despite athletics. Nor has he allowed his "linen to become tar- nishedg witty repartee and easy conver- sation are a part of him, aided and abetted by a subtle sense of humor and a most pleasingly pitched voice. Frank always stands ready to help. Let us suv that only "men" are cut out to serve! Sezienly-sfix . . s - 'rr are rrefi-eff-A v ff 3 5'f'X L R il .E RAYMOND EDWARD GARDNER WELLSVILLE, N. Y. Ceramic Engineering e K N l Wezzmzu High school. Football C1,:'2,3j,1Var- A' A sity "An Clubg Intramural Basketballg Ceramic Society. l "Ray" is first of all a stellar man on 'ij the football squad. He comes from a 'k family of athletes all of whom are char- l H, acterized by their clean-cut and hard l fighting qualities. Loved and esteemed 6 .I by everyone on the campus, begetting y I that respect which only a football star W, can call forth, i'Ray', still retains an air M V of ' modesty a.nd humility that charms Tl ll us through its sincerity. However, if "Ray,' cannot be measured entirely by ' ' his athletic prowess. He possesses other pl qualities even more important in the l long run-he is a good student, a real ' friend, and a mighty fine fellow to p il know. . . f, ffm l .Q HI 7 1 li A if KN: rx iw rv, ll 9 is M ith Nix 'x X l w lvl ls tiHl,lbS'l'l-QIX Sviux-. X im.:-ii. X. Y. Ni'zif'114'f' . 'x!'f""1! l 'f Htllfl 5171-'Hf.' .Yrlr l url: 1'Illil'1'I'- 1 ' ' 1 I n .V3.:'j til. I mv- lumflniff g,l,' l lrzxx Im.w'1IuH t,'l,' lu"'V7ItIH 1 ifflflt ,', In!mrr1rn'ul lfiis-li'f'flm41ll tjl, Louis is the sort of fellow with whom r l f 4 iii i fe! .My l 'ff v i , ltff' A J W lit 'ff li li ft-all .. vi X -i 1 yi., I. f ri t X .-W, fi. Xtl tfi ii 4 AI. X. nc :ill like tu ussociutc. llc is siuccrc auul ilctcrmiucil in cvcryl hint: hc under- tulws s scliolusticully or otherwise. In ill fl spite of his vurimls uhilitics. "Lou" is never ohtrusivc. llc has ni quiet, unas- sumiug manner that cntlezirs him to his friends. YYhcn it comes to ladies he is no slouch. -Xlthuugh he tries to convince us that they mean nothing to him, the rl nnmy perfumed letters and telephone VA,X-Kjell calls which he receives hetray him. He has the high zunhition of being a pros- lljil perous doctor. and in future years we 30.5. can expect to hear more of him. i sgjj Qt 'TX lxlflj -X ft. .C+ MAURICE WILLIAM HALL i i , I 4 CHESTER, N. Y. tgirl 'Classical K ir T Chester H igh School. Campus Court C215 Ceram- 'ic Society f1,Qj,- German Club CQD. What Words can do justice to self- effacing zeal, unswerving loyalty, and Iiljff unboastful merit! In vain We invoke the muse of letters. Suffice it to say that Maurice is the manifestation of all lf these qualities, and deserves due re- spect and praise. True enough, loeing a tl,la,fli:5 quiet and unobtrusive individual, he has attempted to hide his light under a 'glm bushel, but we have found him out dur- ff-.Fil ing three years of college association. ll ,,.l' i Gnly his intimate friends receive the f'f".fi full benefit of his personalityg the rest llit-if of us, We fear, will never scale the em- -,Ml battlements of his reserve more than to acclaim him a true gentleman and a T.- congenial acquaintance. p.r"t ilfjij, MM up U .QL-wx-, cxfswuxw CN, A C ,mx 2 WN A . Y.....A..,.. Seventy-seven .ffl-f,o',-QX? 3' 'i my i e I ,r 5 ,f 1.1 ff.. ,rf X .-x n. .,.-4.2 3. X. , ,M Awx . A,,KQ -. if-cj! EX-c?jf7'j5"Qf',:-T-'-1ljff.i34n-.ff-f'W-Zlgl 'fi V ,H 'nfl l HERBERT BARNEY HARRIS 'mil A Solo, N. Y. 5' 5. Science it lj l e K N Wellsoille High Sclzool. Intramural Basketball 'Q sl 625- li Although "Barney', hails from a M small town, he is wise to the ways of the fl world-and "collegiate" 1n every re- I spect. He is a consistent worker and ly li always comes through with his share of WF the honors. . H H k fl His friendly smile and hello! ,are A it always a pleasant attribute of any fl, group. He is a loyal friend and does 'his best for anyone who asks a favor of him. "Barneyv aspires to the D. D. S. VVithout a doubt, he will squeeze a mean pair of pincers. 'tiff l M ln! A Mir? iifga iii' VERNON 'WILLIAlW HEIMAN CLARENCE, N. Y. ' Classical Parker High School. Wrestling q1,ep,- student Campus Court CQD. 5 "Vern" is a sincere, dependable, and conscientious chap with a dehnite idea ll, of service. He does things in a quiet j-gy' and sedate way. Fairness and square- lg ii ness are a part of his make-up, and he always stands ready to consider the ideas of others. He is an advocate of the mat and thoroughly enjoys the sport, putting all that he has into it. "Vern" is rather inclined to be "clan- nish," associating closely with his par- ticular group of friends, and thus de- priving others of a valuable acquaint- ance. Is it not complimentary to him that many of us would like to know him better? S cventy-eight qi: 2. , ?.'f A N5 ik ..x E., lie 1 ll-YUX Xltll Nltllll-ll.l. lll'X'l'lXli l'1uxifin-i1.n,X..I. -Na'Ic'll1'r' U K X I'l.ifs1.'ii'l-r' Hzfylz Nvlnml. Vlnss Plays Lllg Slu- Jrnf .l.v.w'slu11! x.'.-fl: l'. .ll. l'. .l. l'ulu',,,-f bij,- Illicit! K-:Mui .Yu Vlziiplirirz t..!l,- .lllllllllli l'.'4lI.lHI' Kxxxxxlu-txt--'l. We have deterlninailion and energy personified in l.eonnrml llunling. llc is n first-elnss student :ind has developed the envinhle knack of shnnning that "Nlerl'5' l5ex'il"-l'rot-rustinntion. Abil- ity is his: ability to lst-get results through prnctienl and calculated methods. He has ai profound interest in social wel- fare. and his philosophy of life coupled with his ideals of service command the respect and ndinirntion of all his friends. Perseverance. self -confidence-the qual - ities which make "masters of men"- are Leonards llay they carry him far! FRANCIS REA HUTCHINGS MANH.AiSSET, L. I. - Science A249 Illanhasset H igk School. Class Basketball C1,i'2j,' Assistant Manager I nterscholastic CQ,3D,' Assistant lllanager Basketball C2,3D,' Intramural Basketball QQ,3j,- KANAKADEA Stqyfg Football C1,Q,3D. "Hutchv has a cheery smile and a good Word for everyone. As a gentle- man, he is thoughtful of others. His iirmconvictions will not let sentiment deter him from the right. "Hutch" is a human sport encyclo- pedia, and Well it is so-for his ambi- tion is to teach and coach. His stick-to- it-iveness will get him there, and We feel that his high ideals Will make him an asset as a citizen in training young America in her codes. f 1 1 f if 1 f ly L li . 'l llff, 35, . M, lg 1. ffl tiff lgfi it I ttyl My , l I We W s fit., fi E . .le ll? ll i-X lil 2.1 l i li it ll All lx. .X .- l. li l 1 1 1 . I! SX l lt 1 l , ,l . tg, .mil lil ,lk iw fifjtl lil fi will tilt - In 1 lil! f l f ,ll ill 1 5 ill, me 5 x W wt if, 41 my We i .uf .5 W lffi . -1 4 " lil! all 1 1 i a VI ill l llilil '4 iliiil 'lr l 1... ll, '. ft if it ml! f mf ll ,l I . 4 iflflit if in fi 4 ,--ea, W M., H ,,..., ,....---.N -N .'f"'2'f-X,..f-I--. .,,..v-1... ,,Q--P----- ,W-f----f N,,..-- ,...,.-..- ,.---1 X - -..,...,,,.,----...,,, .5-"-'--,,f ' ye-"Q, ,sm -...,,,,x4 Ae ffsf'-iq, W ,X -XT. QQX --xt x,.-.,I'+-7 ----If--5. .:1Ng,f :i',..--.rt tlsfjjflt ?f"f- Te'-S1 - K '- A-A" wx 'XX N- ,fxr-,X f' 'A'--' I '- XA' -' X' , " f" . t f.-'xl--' ,f 'NX-f' ,..f '-X E-f,2'X.Xff FX X.f,fu xojll "X, " ' eff,-' g,-" .ff 1 ,fy rf ff ,-f' ,.' 1-' :....f- " --f--"' -1,,-f' -f--.--f' fl----J s-.f--f' ,-'.,,,,--H ff ...D -- ,44..,.1-' -:s....f " f ..,4. N: '. I ,.,,,,.. ,,, , ,,, -,.. I, ,, 1, ..-.f 1,1 V ,fi f' 4, J ,. , JA, 4, ,. H . MDM 4, V-rg,-gp ,A ,,,ef ,i-,"""hAw-,'A,:v-vQ-'.,..-f.-XVnM,..-"- ,,,,.f --....,.,,.-0 YA..f,,- Lf-1 N., , W, ff' 'a.s.--'M '--..,v9- -1-.... ,..--2" --..,:n1,,---""---a,.,...-fi ,W , ,.. f' y-if-f ww? "' . Seventy-nine If V - I i 1 if r 4 il A 1 1 ,W f 1 A -1 .Q . -1 Af-- . , ,g::,,,,,f--1.- 1-AM' e --e -4 4. DAVID LEE HYLAND 21 'IA LIMA, N- Y- , ,Q ae " Ceramic Engineering Lima High School. Ceramic Society 23 jg F ool- .X IMA' 'U light Clubg Class Cross? Coulntrrgg Glee Club fljg ll A Choir and Chorus f1,2,-Jl- l 6'Hy13indH is the possessor of aakeen W wit, inclined towards sarcasm at times, gig perhaps, but. nevertheless subtle and ip A pointed. His humor runs. rampant X Wherever he goes-by his wise cracks so shall ye know him. He made a name M5 for himself during our Freshman year i xl as a laugh-evoking Stage comedian, and Nia thus far has beenvunable to live down his reputatlon. U e.st1ll.laugh, not at will him exactly, but with him. .Q well of i'Q'f,P natural humor never runs dry it seems. 537.6 qi The other aspects of Hyland's person- ality are more or less quiet and serious. I He goes about his work with an intent- ness and application that warrant sig, w gl 1 success. K filgl all i FE' sl . ill? KENNETH EUGENE KENYON HoPKrN'roN, R. I. f lil? Science lVesterly High Sclzoolg Milton College C1 "Ken" is 'the' kind of a fellow we see once 1n awhile like a fleeting shadow. If one has the advantage of his company for a few precious moments, he shows a jg profound interest in all branches of higher learning with an apparent hobby for working in wood. c'Ken" is always QW anxious to do his part and to be of serv- ice to others. Before joining us he had already proved his prowess as an in- structor. Since that time he has shown I V,li unmistakable ability in many lines. Undoubtedly, 'glKen" will come forth ' with sometliing 'gpretty good." M r il Eighlg f'x uf 'v l. lf: u X 1 Xt a X e X xl,- ll.. Tia' X L F i ml Q' . . gl tl w l E. K 1.7, the ' Q 7 ! 'fi x K 5 ' xl l Y D fi . XX Il,l,l.XNl l"R.XNC,'IS L.-XBIPNIAN l XX I'1I.I.SX'II,LE, N. Y. 5 if l Se ion ce lm U l' 2 1 1 .gil .lVfl!,w'!l,- High Srlzoolg N. Y. S. A. Cross Wai I mlmfrg! xl,.',.i,QJ,' Track Q1,Qlg "Spiked Shoeng Ilifz IN: lliznrgug Nfllflfllf Senate ,' Athletic Coun- iq, fff H31 .' I fn-.wily "A" Clubg Class Footballg Class figs! l'm.w.e I 'mmlryq Class Traclfg Class Basketball,- fftii "lfmt I,uf" ill: Slurlent Court Qljg Coach Cross lhmnfry Lil: Intramural Baslfetball Inter- lrbl -f'mlrrm'fy f'fHII1C'I.1 ggi " llillllllyu belongs to our "fast setw- Vlfg that rs to say, he has an admlralole rec- flffll ord as one of the mamstays of our cham- ljjr pion C 'ross Country Team. He has but tk, 3 lately turned coach, Wlth success and at a winning: team to h1S cred1t. Frank's we entire college career has been one of glll activity, to say the leastg hls loyalty V A and enthusiasm have ever been m evr- f ll dence. We can truly .say that he IS de- li! Ja voted to college hfe, espec.1ally when rt is centered around a certam phase of It fa phase with copper-gold halr. so so ft s .... . 'QD Eighty-one 3.j,1,K rbi? , ,l, fl 1 ll'f Wi Ari if I l if 1, 9 ll 5. X N lx F ,' fs' L Jgi-- A- -A f. s c js o r ,.i. .. ' L I gg , I v I W ,.. --- M. L 1 l WILLIAM HENRY LOUGHHEAD fhNDOVER, N. Y. Science K YP T Knoxville High School. Class Basketball Cllg Football C1j,' Intramural Basketball C1,Q,3D,' As- sistant Manager Football C3D,' C'eram.z'c Society 41,QJ,' German Club Here's a chap who has the splendid gift of making friends. Once the friend- ships are made, he sticks by them with all the loyalty of his being. Active. and overflowing with pep, "Bill" takes a great deal of interest in athletics. If he is not able to participate in the sport' itself, he is Willing to put. all his energy into the task of management. Such :L position requires real work with no glory attached, and a man who tackles lt, Immediately proves that he is no slacker. On the campus, "Bill" is usu- ally very quiet and serious-A-A hut let us not forget that the quietest smut-tim.-H win to the greatest heights. - .,,5,.--A -...HH . -- .Y.. e.. .X s., ,,r' E ff lCigl1.ty-two ISADORE LEES PATERSON, N. J. Classical Paterson High School. "Fiat Luxl' Staj C231 5 Campus Coizrtg KANAIQDEA Staj Q-31. Lees is one of our so-called orators with a ready command of Words and a fund of ideas. His keen mind seems to thrive on the discussion of the most ab- struse problems. His scholastic ability is obvious, and much to be admired. Furthermore, he possesses a sense of humor that is at once subtle and per- haps a trifle cynical, but nevertheless contagious. We Well remember the per- fection with which Lees enacted the role of the Suave City Snake. introduc- ing touches of originality and sarcasm into his interpretation. It may be said of this man that he loves to argue-it is a part of his nature. lVe surmise that he will some day become an excellent statesman. i l if H l .M I R A i ,I la ,xi ig ti. . I ik. Ml l t if fl t. i is fkf. A ax "Q, 1' N'-4" 'F ,f .,.. .ef , ' Vs, X xx F-1 A tl t .KJ N.. it -. 'fi " we 2: 1 . 'N ' 'Q ' "" ' ' ' -----. Ewa Yfwg K.. es. -'sm--r -,A -Q, Lx .w-M.: x N., -f , - . . -N TTI?--f7ti':i 53.1"--af':7.T'-:'1'i'i'3eWC'LTLTj''sr'f'i?i'-TTS' -. if P--SV ..J"3-...N 1---. -4. ,hw-J '1 ,f-" is. 'f nf'---.W if if . Q. ., X .A x,., ,A ,V,A, A ,v,,. ' ,fx x 'ii N. X. N iX',?L5.i ,ff fr' .wx . xxx N, -.-.NHL -..,u,,f.,, -..,,,,,,, .k .. w., .gsm K EN N l'l'llH L.-X FORGE RIAXSON WEST NEW Y onli. N. J. Science Klan Alpine lVcs1' New York High School. If11.tefrfrate1'r1i1fy Cross Clountryg Class Fooiballg Glee Clubg Y. M. C. A. cilflblillfd. Quietly, but st.eadily, "Ken" forges through life unhampered by the hurly- burly of worldly affairs. A placid exist- ence unmarred by beset.ting worries comes naturally to him. Even Cupid couldn't ruffle his serenity. "Ken,' has a surprising knowledge of things in general and a ready skill in fashioning with his hands. Next to a good soul-satisfying nap, his tastes in- cline to the out-of-doors or a spirited romp in his "fliver." "Kem, good-na- turedly admits that intellectual things sometimes annoy him-though ever so little. To those who are lucky enough to know him best, "Ken', is the acme of friendship and loyalty. "He's as good- hearted as the day is long." is s X ' ...lg X-1.JM.f"" if Lg af' .e-ft.-Alf' Af' 44,5-'iss ...J-fiff' -..w"1- a.jL..-'ffQ.Q.filff'2T1.1I1- f- 7ff,..I.L--fe-ill..-.-ff-"1 L..Zfl. -W---M' DANIEL WYNKOOP LUKS TowAco, N. J . Ceramic Engineering I K NP T Boonton High School. Ceramic Society. "Daniel" is one of our champion limelight-dodgers, for all the time he has been with us he has successfully shunned the maddening throng. Yet, we have had a few "squints" at him, and have found many hidden qualities -a sterling character, a sense of humor and a stout heart that will keep him for- ever in the hearts of his classmates. His ability as a musician has been given a hearing in college orchestras, and he plays with fervor and spirit. He has proven himself versatile, and we are confident that his many talents will find their own reward. iq- i iff ,, YA if iff if if , ,Y prix, if H ,Q 47, f .41 .f . i Eighty-three 1,7 , " ,- 1 l:fA' LESTER EUGENE REYNOLDS ALFRED, N. Y. Science Klan Alpine Agree High school. Y. M. c. A. cabma tsp,- F ootlight Club,' Press Club, Cross Country C1,2,3j,' Varsity "A" Club,' Track C1,Q,3j,' Class Plays. "Gene" lays claim to the unique title of fthe man behind the barsf' He is our active representative of Dan Cupid. 'Tis he who speeds our message of the heart on its Way and slips the answer into our box Where we pounce upon it With glee. Like Cupid, also, he posses- ses Wings, with the difference that his sprout from the heels, cm-1-ying: hinl with all swiftness over our weaiisome CFOSS-C0u11try courses. "Genes, inod- esty is becoming, but nevertheless we often wish that he would desert the background and let his light so shine before the Student Body. ki j jar 'f?:1"E5,fT'fT2,TfIfQ''fTf1ITI'I"1-s I f ,nm ,ff r . ,. fi .,..,1.:-l,fM.grA-J.:Lrm,5f'g If J,-i f- M....,f. ,,,,wN,.,.f E q AU - Eighty-f our DONALD FRANK PRUDEN PATERSON, N. J. Classical Klan Alpine Paterson Preparatory School. Class Plays C1 jg Press Club C215 Honors C2j,' Wrestling Squad C1,Q,3D,' Cross Country Squad Q3Q,' Intramural Cross Country C3D,' Associate Editor "Fiat Lux" CQ,3D,' Agriculture Editor 1928 KANAKADEAQ K. A. Editor "Pine Knoti' CQL' Editor 1926-Q7 "College H andbookng Varsity "AH Club, Class Football CQJQ Freshman Football Squad CQQ. Versatility is his middle name! We have here an artist in all the sense that a dreamer-a lover of beauty and grace-is an artist, We have here a statesman-in all the sense that fluency of speech, ability in organization and leadership are concerned with states- manship. Moreoxfer, "Donn is our literary star. Twice an editor and twice an associate editor of college publica- tions, we predict a bright future for him in the realni of journalism and letters. 'N , I " l Y fm ' y., L . . ' ' N N "' t 'x , fwf- . , 1 l XXV A xl ..,. c .- A .vi H --- X ROSS WRIGHT ROBBINS .-XLFRED. N. Y. Classical 9 K N Alfred H iglz. School. Stzldelzt Senate C1,3j,' Y. ill. C. A. Cabinet I zzte1jfra1'er11.'1'ty Council Class PI'6'SIill6?II.l Campus Court CQ,3D,' Business .llanagcr IQANAKADEA Track Q1,2j. There is no one in our three years at Alfred who has done more for The Class than Ross. His indefatigable energy and zeal have found their outlet in every activity with which he has been connected. He has evinced an unflag- ging interest, a faithfulness and deter- mination of purpose, and an ability-in organization and leadership, that has assured the success of his every under- taking. N o better tribute to his fitness and ability for ottice could be given than his election to the presidency in his second year. His tact and ability have conhrmed the opinion that he is moulded for politics and statesmanship. We look forward to the future-when we shall hear great things of Ross. -47. , t . N .4 ,-5' "" ' .-,-l'f"""" .H-4f""i"',Qff. s ELDON RAYMOND SANFORD TROUPSBURG, N. Y. Science 9 K N ' Troupsburg High School. Class Cross Country C1,2j,' Track CD, Fraternity Basketball Busi- ness illanager "Owl" CQL' Y. ill. C. A. Cabinet C3D,' I nterfraternity Council C325 Campus Court CQD. Eldon may hail from a small town, but that doesn't mean a thing. He is a hard worker, an excellent scholar and, above all, a good fellow. He is always ready with a laugh or a thoughtful sug- gestion as the case may require. Eldon aspires to the degree of M. D., and we are sure that he will handle a medicine case with the same dexterit Y that he now employs in the use of his barber shears. .- -C o we-2' - . D "si 12 -H QA ic' K xc -exq ,, , :A . ' iff".- ij .W xv g 1 .- ..5 , 5v,cf -sing A fs J R Eighty-five g SA j N.. il fp be -M A -Y -- my A. A tha.- A . fe - ' , X it -fe . -A A 2 -. '1.ixi ' QA - , T S i " 1 i A REVERE HAMILTON SAUNDERS lv BELMONT, N. Y. l Ceramic Engineering i Klan Alpine Belmont High School. Class Plays C1D,' Glee i Club C2,3Dg Assistant Manager Track CQ,3Q,' Stu- A dent Assistant in Chemistry C2315 Business Man- l l . ' ager "College H anclbookl' C3jg Campus Court Juror A A l CQL Chorus C115 Tennis C1 jg Ceramic Society C231 ,' Stage Manager Footlight Club C3D,' KANAKADEA l i Photographer ,' Secretary Ceramic Society. V ' 'Curley' ' personihes life and vigor and ' pep. His exuberant spirits are evident f in everything that he tackles. He in- : fuses each new project with joy and i F zest, so that what is work for others be- l comes play for him. "Curley" has an abundance of ambition, and he makes A All A use of every bit of it. hloreover, he does ' i it if all things well. He is equally at home in , the laboratory and in the ballroom. He l r i can carry out orders to the letter and, . when he is the manager of affairs, ev- V erything is smooth sailing and the ship i . comes into port with flying colors. Biay i he conduct the ship of life with the same dexterity! g STANLEY SPRING CSAUNDERS ALFRED, N. Y. A r A , Ceramic Engineering A I., v , -- ' AgfedH1:gh School. ceramic society gasp. g' +2 ,4 51 Stanley is a veritable Hbusybodyf' One never Ends him idle for a moment. W If lt 1sn't study-there is work to be A fl , i i , done. Truly it is work that makes the ig lil -Q ii t m world go round, and Stanley is doing more than his bit in aiding that revolu- g tion. He 1S very shy,.and we feel that li fl, ll i. few come to know h11n as he can be ,XXI 95 known and appreciated if one reads be- ii lg neath the surface. As for himself, ff. c'Stan" likes people, and is intensely in- 31 A .WE terested in the peculiarities of human Rl . ly? nature. Nevertheless, he abides by that . y :Q Qld adage which is so full of meaning: at A 1 'Crows flock togetherg the eagle flies i l ix 4 l alone." fr, "X ' il s l 118 - -in V - X .li X M X bgiffi -'w- Qzzizitipg--eczzrri fftfgff-...U F iff' .f'E157fii'fi:ii.1fiLi'?f?HiEQ4157 3? if . it X V "" "MM W, A QV i Eighty-six A' ' V ! 5. V ...AR 1. '. Xi. U . -X li ,,"'-ig, I .f l i "1 l s . , fps.. iii!-lil-f:EQEgQfQ?Qgif?1L'+'1i.lf9-'fiLw5gff45?''fl' - J---H - f' 'b N -A -,.- f' A-'- 844. 1 W jf, ,fs.,.i....f41'.':g3gi..Mmtl-.-r.a::s.A-sL...4..w-f1':.11'.-.-fQ'.--MWA-'...g.g-6 ll X ' ' W N 1 W 1 r 1 1-ll.l3lClll lllzlut llluli bl-llTl..l'b ll1.1.ic"u'1"1'x'u,1,1q, N, Y. Sl'I.t'IIl'l' A E fb E1lz'c'offz'1'11e' High School. Fooflm.H,' Intramural B aslfctball . s "Gib" is one of those quietly con- genial fellows whom we like to have around. If you want a favor he is al- ways ready to do the good turn if he can. Wfhen there is work to do, the first man to respond is '6Gib." His good- natured smile is generally in evidence Wherever you find him. He is one of those quiet, steady workers whose sav- ing sense of humor has made him some real friends. HAROLD OTTO STEWART 1 CANISTEO, N. Y. Science Canisteo High Schoolg University of Michigan C121 One of our most Hcommutable' class- mates is "Mike.', They say that the greater part of practical education comes from travel. That's Where "Mike" certainly has an immense ad- vantage over the rest. of us. Miles mean nothing in his life. Of course, his long jaunts to the home town have not left him much time to engage in college activities and have cheated us out of a fuller acquaintance With him. Our fleet- 1 1 1 . 1 1 1 1 1 1 lx! 1 1 an , , 1 I 34 ' 1 F1 ing glimpses of his character make us fl i wish that he might be with us more. ' 1 Harold enjoys taking a chance at life. 1x He has a charm and a delightful sense l 1 of humor that make him a good mixer V 1 f Wherever he goes. fl Y Eighty-seven 1 1 1 ll erffw ff,54gSrf23,gf2w4gJZ'lZ.,qi-fZ,Q4?Q X3fwyffy ff Ama? A X , V NORMAN HENRY STOI TE CLEVELAND OHIO Ceramzc Engftneerzng A Z CID West Technzcal Hrgh School Intramural Bas ketball CQ 3D KANAKADEA Photographer Student Asszstant Vtce President Intramural Assoczatwn C3 Ceramzc Socrety Norm 1S primarily a chemlst He IS one of the few who can l1sten to Ra dasch s lectures and know what he iq talking about We who are dumb are inclined to look upon him as a wiza rd- such lntelligence 1S uncanny All great men have their hobbies Norm s is photography At any athletic event you can End him catching the action plays. Norm has ever been ambi- tious and right there in accomplishing things. He deserves a lot of credit for the work he has done for his class. J r i l rl , ,Q We ie is 1 i li li ri X RICHARD HENRY TAFT Y J TICONDEROGA, N. Y. if' wi Science ls li Klan Alpine y Q Ticonderoga High school. Varsity Track Squad 1' ' C1,Q,3j,' Interclass Track C1,QD,' Interfraternlty . li y Track Cljg Assistant Trainer CID, Trainer CQ,3D,' I A 1, All Varsity "AH Clubg Intramural Basketball QQDQ i l KANAKADEA Stal? C31 T I I "Dick" is our original member of the I ,f fl ' Way and Means Committee. He has a 5 way with women and that means some- r , H thing. What a "medicine man" he will F yy V turn out to be! His is a charm undis- i I puted. Everyone has a good word to if "ff ' say for him, and that is an attribute of l ll which few can boast. "Dick" deserves A much credit for his consistent work in ASI, Q track and his successful efforts put li 'I A Q' forth as a trainer. Here is a man that A 55 5 has been invaluable to his Alma Matei' g in a way that gives all and asks noth- lx fl L mg. We admire him and wish him the l N best of luck in the profession he has l A chosen. Considering the "blue-eyed in- if l T' spirationv that is his, we feel confident l r that no failure will mar his future. J lxilxfi me x if-f----x,.fff-.., -i -.Neg--f.,NM,,,,,N ,MN -an 'n al fie 1 be ' rs s . Eighty-eight i Q, l'lll'fS'l'lCll lCl'GlCNl'l 'l'AYl.0lt l 'x. .1 .kl.l"lil'lD, N, Y, il , . A A bc'1c'lICc' Xi - . i x U lx ii V 1 .-llfml Iliglz School. ulsllllf I.u.r." 'K "Chet" rate-s high as 21 comedian and a creator ot uurth as well as a friend to V, ,Q all who know hun. llihether in a humor- Yiqf ous or il serious mood. he is a veritable demon for work. He tackles a problem MU for all there is ni it, and pursues the an- ,lg swer to the bitter end. "Chet" has no KK 5 fear of overtaxnig lns energy. He stands llki ready to be a witness to the fact that Qi, where there's at will there's a Way. One g never sees him loitering about the carn- A l l I l . V a 4 .Q il Li ff I 5 l Ar P I D B i 4 Q pus. lVhen he streaks by, We know that there is some object in view. As a sales- man, i'Chet', is unexcelled. We need not fear for his future. CLIFFORD LARUE TAYLOR CANISTEO, N. Y. 4 ' Science O K N ' Canisteo Academy. "Cliff,' hails from Canisteo and, judg- ing from the consistency with which he "Week-endsv at home, We are inclined to think that he has a fondness for the place. He shuns the social possibilities of Alfred with a completeness that We fail to understand, for surely he is no Woman-hater. Nevertheless, he shows the gregarious instinct in his love of ar- gumentation. He Will desert every- thing else to indulge in this pastime, and the more around to 'argue With, the merrier. "CliH:,' is a deep thinker and a hard Worker as Well. He studies indus- triously. The boys in his house find him a handy man to have around, inasmuch as he is something of a carpenter and a plumber, in fact, a veritable "jack-of- all-trades." - -c 4 f ii" 1 ff - , 1 , i "' , A . '-I , T7 v" " . " 'ff i f- 'A f f -4C"i ' 4-C' '-' iw' W Y ii ,Q A, Eighty-nine 'fa 3-+ .1-i 'LW 4 i + A -f ' CLAUD HERBIAN VOORHEIS FRIENDSHIP, N. Y. Classical K N11 T Friendship High School. Class Football C115 Basketball C1,QD,' T rack C1,Qj,' Class Cross Country CID, Varsity Cross Country ,' Intramural Con- ference ,' French Ulizbg Assistant Manager Tennis ' Alfred knows the long and the short of it. Claud is the latter. He entered college with our class as its infant prod- igy, but three years have boosted him up into the ranks of men so amazingly that he can no longer claim distinction, as of old. Ever ambitious, Claud speaks and acts with spontaneity and an untir- mg energy that never leaves things un- done. He combines work and play with discretion, so that each will complement the other and leave ample time for the cross-country jaunts that signify his loyalty to Alfred and his desire to serve her even as slie serves liim. NATHAN FRED TUCKER ALFRED, N. Y. Ceramic Engineering Alfred High School. Wrestling QQ,3l,' Ceramic Societyg Student Assistant. In general, "Nate', is of a serious bent of mind and seems to be naturally inclined towards the practical, always estimating worth on a basis of useful- ness. Yet he thoroughly enjoys a battle of wits, with clever repartee running riot and words clashing merrily to gain the ultimatum which speaks victory. "Nate" studies with an industriousness that shoves all college activities in to the background. Others may play as they chooseg he is here to work. Despite the fact that he is very reserved, "Nate" is not unresponsive and becomes a most congenial companion on occasion. I 1 .. MR W l w ,,,, . , ....,!,t-ff-2-L-,qv-"S 7--'-'-A-x,,1:fb '-NF...-N., ,W-.F-...., Mm., A wvmmyw U-,,,, Kr qf A-.,fjh'j"::v . 'f'f,..ff-:'n',""'f s. 'Y""JN'Ya'r':f'Q7r'Q"-lifx.-7:27 mf---r 3 A-' ,.,f' -J,m"',-f 1.,f"',.e'Xv,,-'r",rXLni" .-We ,X e xwmffr - Mwlw-'RISK -.- vdifw, JC2.,.s., AVAL,...1FMu,1,xV.1 .... -,.. Ninety W.- .Y .... ,,,,-.,... i..N,,- 1 1 ii Q . l l r l all I J . X N Q r C I 1 wx fi!! X .W r lgl il l ml 9 J. ' Af' Xl M F ll l 1 N Vi i is Aix. x M, ii L' X Mi X 1. all X? X silt xv- WE X, li .S x tix 3 f it Y ,lg 1 1 . All ft? lg Jil f 'f 1 'I I f it 2 1 1, J l 4 .l' 1 i J R 41 1. . i p 'f ll! l I ii .ls . 3 i X X lYll.l.l.XNl l'll.XNll'lUN WXXSUII Q x . . l.1'. lim. N. X. l-lll.N'.N'l.l'lll URN D ' ' ImlwyI11gl1.Ni'lmol. "'lllll'00 Cllcvrs for tht' ll'isl1," says "lYillie" Wausor. and we echo him with zest. .Xsidc from this one outburst, "Bill" is very quiet and reserves his thoughts and feelings for himself alo11e. Nevertheless. a bit of his Irish luunor escapes now and then. to our delightg and occasionally a spark of his Irish temper flies. to our consternation. "Bill" studies rather diligently and 11ever gives much time to the lighter things of college life, although lately we have noticed that he seems to be seek- ing the company of a certain fair young person. lYe wonder was ever a man a sincere woman-hater? It doesn't seein quite possible. does it. 'tBill"? g . . . f , 3, f'i15,fs", 'or'--ffgiiio'-H-Q1 lt fl ...is-f..sl-",.,..s'f.,:f-J" .-111+-'t' ,,fg.'1,4vf"2isif,..wj,,"C'lff' ,N - .... ...M-e.,.,....uf-wfs--.r..-u-f...,,......-fHf,..,.s.- . .,j1,y" JACK WEAFER KENMORE, N. Y. Classical K KP T Kenmore High School. Class Cross Country C1,2D,' Track f1D,' 4T1'easw'er Kappa Psi Upsilon Campus Court We Wonder if it will be possible to write about Jack and not say one Word about V eva. It is a task insuperably difficult, but We will do our best. In the first place, Jack is one of the "old faith- fuls" on our Cross Country Squad. Un- swerving perseverance and diligence such as his are the rungs of the ladder which has raised our team to the glori- ous heights of championship. VVith the same lust for conquest, J ack tackles his college Work. His stick-to-it-ive-ness is evidenced even in his dating. Jack is not fickle. -af wwf -C' - N57 W "ive 1 Y - gi , 'Q p-if ' t '13 Y Q, - 5: 9 V . J l . u V, f .Q I i i Q .elf f 41' Ninety-one -.-...,-J:-4- -L-:Le -. -m--: 2 V V- - 7' - - if . P l . Vx ' r l hailing ' FRANCIS JESSE WILLIAMS V A ELMIRA, N. Y. lb if A Ceramic Engineering 1 ' X , Q I A at ' 9 K N l N ' Xi ll Elmira Free Academy. F rosh-Soph Debate C1D,' W I I Track Cljg "Fiat Luacn C2,3D,' Honors C1,Qj,- Fra- . it N ternity Basketball Theta Kappa Nu Oracle all V x . a a ,, ll' ' rl ll Look! There he IS, "our Wee Willie, j F . only six feet two. Like some other men l I gl I' of his height, he traverses the nchemi- pg, ll l cali' path with a great deal of enlight- qv . X i l enment. He IS one of the few of whom I , X 4 it may be said that he really enjoys it ,Q W study, but why not-since it gives his i lf' brilliance an opportunity to come out I ' All and play? One must become thor- . ' i I oughly acquainted with "VVillie,, before I i real understanding and appreciation I i 1 are aroused. His cynical smile is but A thin ice beneath which flows a wealth I of sparkling humor. One does not know l i i Willie until he has had a taste of that , wit which is his contribution towards t li' l making life more livable. ' RAYMOND BOWLER WITT ER 3 y ALFRED, N. Y. il. u A . Ceramic Engineering l i Klan Alpine' y It AUred High School. Ceramic Society C2315 I V Cross Country C1,Q,3j,' Glee Club C1,3j,' Intramural , , ' Q Basketball ap, Y. M. c. A. Cabinet ap, Waaaaag i i 3 C1,2D,' Freshman Track Manager C3j,' Manager ' I i ip ' "Handbo0k,' C2j,' Chorus C1,2,3D,' Class Cross p Country C1,QD,' Varsity "AM Club. ' l A 1'CV61i11g, prancing entity of ex- l ' tl uberant vital't "R 't ' if 'l I l 1 y- ay. is a sturdy 1 l M specimen of manhood: Big in heart and i 5 bQdY, every fiber of his being vibrating ' l fail W 1 with the flush of l1fe, little wonder that BSS! , hi! Alias ashllelveg disgnction in athletics l 2, . re . e as t e happy facult of M taking the sunshine of existence land UNK A i Ei-HV111? th? rang fir more sober spirits. in l p s a c ose rlen , e is loyal and gener- f i Q Q, 'ly ous beyond bounds. If you seek sup- ll l 4 port, he will lend it, and leave you feel- i X li A 1 1ng as though you .had conferred the y lf g in favor rather than hlmself. g i ig 'N ix " atv lu lr- E lfii K ' 'exif W , .1-QTNQZX ,,.-..nN,,,-.rN,d,N H 5 it . N inety-two S.Xl.l.X l-fl.lA.Xl3l-f'l'll .Xl'S'l'lX NN 1-:sri-in1.x, ll. l. l l'l1lN.'-'1l4'4Il OUX Silo!!!-Ilflfilll Ilriylz St-lmnl. 1'j,1,,.HN Univ. Ujm. fl-Ml' tlli fllwlf' kI..'.-fl: lllltllllfl .l4'1'oI1zpa1l11'.s'f tll: .N.sln.'z-,Nnzzu:' lhzrfjf l'lnj1.' l'. Ili. l'. .l.,' l'l11'1'.vl1'41n I-,'rz.:'ri11'nr.' Nolnzlvl nf lhllrgr l'om111f'm'4'1m'nl tI..'l. .X plensunt sinile. 21 pair of diinples, at broad New linglnnd dialect. thor- oughly inixed with wholesome fun- that is "Sz1lly." A girl who always has a pleasant word when the world seeins blne: whose lilting voice drives sorrow before it: whose unflinching dCt6I'l'l1lI1Z1- tion brings shznne to the weak and in- spiration to the disheartened-such is "Sally" We love our "Sally", to us she is the living definition of that much abused but in this case potently-con- notutive word-szreet' f g I . 1 , , - . ,Q -' , ,.-' -1 i.-Y. h - k 4... J. U, , . .., J M- UW TILLIE BREEMAN 2 ALFRED, N. Y. A Science 9 9 X Alfred High School. Womerfs Glee Club Choir Q1,Q,3j,' Class Vice-President In the very beginning of her college career, "Tillie,' was elected vice-presi- dent of her class, and this choice by her 'classmates at that time shows her instant popularity. It has lasted all through three years and, obviously, is not undeserved. We are first attracted to her by her lovely blondness, but we find on better acquaintance many things which hold our attraction. Dependa- bility is always a trait to be admired, but when it is combined wit.h a marvel- ous smoothness of temperament, it is doubly valuable. Our space is much too limited to permit an adequate descrip- tion of her sweetness and charm, but let us sum up our opinion in two words -"worth knowing." f:1Q7"RQ if xc' xi? if-ii -i s xfigx iii Ps-.ff:,..a A., no i ilnetgifhree X5 lf rt lil 1 i n ' s l ,L W" S' ll i All ,w V l 3 l l . ' HAZEL ELIZABETH BRIGHT V P MASSEN.k,'N. Y. Classical I 2 X N g . l lVIassena High School. Women's Student Gov- . ernment C3j,' Secretary 135, Alumni Correspondent O at sigma chi Nu 435, Y. W. o. A. 419, Tennis grep, ' German Club ' 'Y r A A gentle manner, a ready sympathy, A a and a contagious giggle are the out- . Ward signs of a lovable, dependable pal. 5 Hagel., despite her demureness, has a devil in her eye and a song in her heart I that .make her the best of companions. L She IS always what We like to term a good sport. An exceptionally sincere student, she could never be accused of p . I "grinding," but dilutes her Work with ,Q bridge and laughter. Then, of course, p X there are social affairs that claim the lg attention. It 1sn't often that Hazel is ' A V willing to demonstrate the latest steps, Q, but when she does - ! I- no words ,AL l needed! 1 xl ll "-.f""""---4.-c""' ""r--.rlt"""4"-N . --f-I-'..,,,M-M--N. ,,.... W. CECILE EDNA BRIGHAM FILLMORE, N. Y. Classical Fillmore High School. English Club CQ, 3D,' Spanish Club CSU, German Club Q3D,' French Club Cyl M . A Hame of red-gold hair, a reticent manner, a close application to study, a fine sense of humor, true and loyal friendship-these make the unique combination which is Cecilels person- ality. She is one of the few" redheadsl' Whose temper cannot be said to match the fire of her bobbed locks, for the most outstanding virtue of Cecile is her calm, good-natured manner. She is one of those rare individuals who loves to do things unostentatiously. 'W , rs-a""v-1 X --M, f--"rr N--f---1. 'kr--A . - . .-.-..,jX-it V-. '-"ff 'QQENQ1Q"f,'f1Nv,,g'ijjix . - - V- Q 4 '- 'A-M ,K -A QQ:.Ix49,1Qi"JN,bf".PriJi:w-A-'hs-iwirtwxiix .. x. sts. srl Ng- airy qv H-g x sflorxge--EWR N X .- h an t 5. -V YYY- S. - X t X E K --i, lr ,Q N S Q Q - ,z Y xxx up ,ss Ng X -- K 1 .., .V W '-N.. . ,. r --, 1 e ,I V ,, ang- A " Q. N inety-four lllVll-X til liXl-NI ltltl Xltlhlf il Nl 'tl l X, X N t , g wh'-t,!,l l,'1 it it X xl, H " ..', lit... 1 glfjdlx ,lu . N ' . . ' 'Y ' I ns". I 'fir-frH.1-. X,1f,s ,1,,,1' 1lcZ'5+ l. 4 lf'.'i f, A, -i . nv,,,,,'j- Xin. --'I 'ffi l"'9f " 'fe' I "WW 'Y , li'f lnlifi V llillIlllll'.N' -N:'-UH ,,.- 'N K 4 l ,i.'.,, -I ,' I f fHl',,fll,,l l'llI.hl l'J: '-If 'S' - . ""'.l' Hfftl l I-rirlfili flu' l"l'r'Il1'll vmzl :mi ' I ,HMV bi' I. i lu this nge ul liuniilruui saiiiicm-ss, it ts uulcetl at rvtrcsliiiig tonic lu :issot-latte with one such :is llclcn. She possesses ai siiperailniiulainm- ot' vitality. initizitivc, :intl zuuliitioug she tlocs things: she worl-is with at will. Qtllll plays with at zest that is contagious. 'l'lu-rc is ai uiuguetic clinrui about her personality that in- stalls her :is ai faivoritc among girls as well as :uuoug uien in spite of that ten- dency towards lmloutlness which is sup- posed to influence the male sex alone. Ornaunentul and useful at the same time. Helen is our main argument in de- bating negatively that tender question: Resolved that the beautiful are dumb. l l . -"fi uw 'ly -,, . - - ef' .4 at ,M-L RUTH EVELYN CLAIRE ALFRED, N. Y. , Ceramic Art 9 9 X Ab'recl High School. Ceramic Guild C3D,' Class Basketball C1D,' Class Baseball CQjg Theta Theta Chi Treasurer C3D,' Y. PV. C. A. C1,Qj,' W'ornen's Student Government Council C1 D. If sincerity could be spelled with four letters, they Would be R-u-t-h. Were these same four letters employed in spelling originality, dependability, am- bition, succor, perseverance, and intelli- gence, We might arrive more nearly at their true meaning. Ruth is a girl of versatile genius. She is a clever artist with an inexhaustible supply of color- ful ideas, she is a level-headed mathe- matician and finds no difliculty in study of any nature, be it ever so diversihedg she is a real home-maker and nobody's fool in business. In summation, Ruth is totally and absolutely competent, more- over, she is true blue. 'Nuf said. . 4 ,vp .JK L55 ' l li l 'i I x lf ,i , N znety-five 4...-..-. ff' f o 1251 '?11'5Tf1 i2f? xB3ll X 3 5 e MARJORIE LUCILE CR AN ST ON BOLIVAR, N. Y. Classical Bolivar High School. "Marjorie"-earnest, conscientious, cheerful, a congenial personality. Prove lt? That's easy. Earnest, conscien- tious-Just note her attitude in the classroom, on the campus, in the libra- ry. Cheerful? Guess weive all seen that pleasant smile. Congenial personality. The girls in the Brick will vouch for it -so Here's to "lVIarge," with a heart and a smile, Who makes this bubble of life worth while. 's....,1""""""'-,Q ""'s'ss,,,-""'r'--.,,,..,-ff ' ....,.-...m .-.l,,.- ....,-.....- .,, ...,... I f 1,.,.'.s.JT-'f,Zw"' gifmfif? , N incty-sia: BEATRICE BELLE COLEMAN ILION, N. Y. Ceramic Art II A ll I lion High School. "Been is one of those people whose willingness to work always assures them of labor unending. She is always busy at something, whether it be study or some college activity that claims her attention and, of course, there is that extra-curricula class which she has long been attending, dealing with the "novel and intriguing properties of human na- turef' We feel that the latter requires altogether too much of her time, rob- bing us of the value of a closer compan- ionship. "Been is the type of girl that we like to see in office, as she is always in- terested in every project as well as be- ing dependable and enthusiastic. X g 2 f,,r'jL..,,.5 - xTff.Q5..x t 4 rs' "tip, sfgilvw --"' '-wa-f-'r---A.--f"wwf 4 " N K' X'1""""s---.-----'-----...M-M---...M-A'-1-.W--M--me.--.f--M--- Q' , WNV' .Hi '11-1 A K -a '-12 A, .Qf--...T--i, .nkgp-W "1 f Q rf, '- XX, ,!:Q"""-7,-,' A..q-..,..Vk,i--.Lf--L:p.X Nj.--. ni A -..,.L..... M' - ,f...19M0,V-:-ffj-- . Y X-sE:?iR.l:.f'jSLbi-Nj f iii-315.24-firl.'f::?i-L?.1C,1Ll' 'ri-1j52f'f',:iL'f.l2f155ffgi'f:5ff:f.'g,.""1?ii"' 3 ff' . JANET PARK DECKER 'llOTTENYILLE, S. I. Science H A ll ' Tottenville High School. "Fiat Lum" Staf 02,31 ,' Class Basketball Q1,QD,' Class Tennis C1,Qj,' Class Baseball f1,2J,' IYANAKADEA Stcqfg W'omen's Stu- dent Government Council l3D,' Athletic Council Secretary C315 Eta Alu Alpha. J anet? When we hear the name we think of one who is always in the midst of the merrymaking and who has un- selishly offered her services to her Alma Mater. Ser-vice? This is reflected objectively in her activities as a member of the KANAKADEA and Fiat Lua: ' editorial staffs, the Women's, Student Govern- ment, and the Athletic Council. l Scholarship? She is a member of the Eta Mu Alpha Honorary Fraternity. 'N uf said! Popularity? Janet has gained the re- spect and admiration of all who "known her. g . DAISY MAY FAIRCHILD PORTVILLE, N. Y. Classical 2 X N Portoille High Schoolg Hunter College C1 Y. W C. A. Q1,3D,' English Club CQ,3j,' German Club ' A Winsome lass is she, with a smile for all comers. Something about her, some- thing intangible, inspires conhdence. An innate quietness assures one that what she knows, 'gDaisy wonlt tell." We liken her to summer, she is like a summer breeze-soothing, refreshingg she is like the summer sky-tranquil, serene, smiling. Above all, she is like that summer flower whose name she bears-modest, shy, and unobtrusively sweet. 'Nqr , of x-syn' , '-1 : SC ,if iff Y Y H ,fi lQ gi .fl -1C i 1 Y . i 41 !g. - gg Ninety-seven FE C W, .,,4-. A af' A X flsxx Y- fr f't'y.ffi?S.sfiXk?r:sf3Qw -:i?s?14?b,fa as if RUTH EDITH FOX GRACE CELESTINE GILL OLEAN, N. Y. Classical Clean High School. Class Tennis Q1,QD,' Class Basketball CQj,' Brick C3j. y It is hard to be with Celestine and not laugh. No, please donit take the wrong impression. She is not funnyg she is contagious, rather, with her dark eyes constantly rippling over with mirth. Her disposition is as care free as her smile. Even-tempered, sunny, she is a veritable "bluev chaser. She is ca- pable of serious moods, too, beneath her lightness is an intense desire for service and development of the finer traits of personality that are the exem- pliication of true womanhood. "Cel" will never be guilty of boring others with her ideals and ambitions, but they are "there', nevertheless. Q FINDLEY LAKE, N. Y. ' Science Finfllcy Lake High School. Y. W. C. A. C1,Q,3Dg Treasurer C3D,' English C7115 4239! Tfeasulel' Class Basketball C2J,' Class Baseball CLQX' Tfflclf l2j,' Class N urnerals CQD. A stately Junior! How well that ap- plies to Ruth, she is loved and respected by all who know her. A bit of humor never escapes her, and whenever we hear peals of laughter, we know whence they come. To be industrious is her sec- ond nature. Absolutely dependable is a rather pertinent delineation of her char- acter. These attributes together with pleasantness, frankness, sincerity, and reserve, A can only begin to describe "FoXey.', N lim l -.., ,-1-..., .--,, '-Y' '-fC".'1,'vs41'1ZTI1Nsff' ,.. 'Nr-"xx fur-X '7yI2ijg,.. H55 .xi u ff? my ,xy X I -. 5 :iii A A This-W lit? Vi N N lnety-eight .pt --,N ., .' - X. as -S, . 3 ,LX 5 . - X .,,,kA, , x, H, . xx N i' X xx Q. V ' SC' ' -K -A "K ly xlilifjif-.'lfQ.',g5fff'Ljj I ff.. ,',' "j1ifQQ I ,f l "7 . .Lynn .- :il ga E, We ye 1 i ' , i ,g ,X Y, Q ' HL sl ll 1 , U 4 4 U .f l -I xl ti if l ,itil L L l lx fi r' V X 5 ' Il Ili, 1 L i i 5 L A ff, l Q , Q lf Q' 1 ii 1 ii . e-.M g, ' -- ., -. L N xx.. . - rx, 1 -.N iw 'sw-N... .3 'A K, "'t'H'-..-ng -Awe'--N. ' THEKLA AURELIA GROSSMAN CLEVELAND, OH1o Classical lllest Technical High School. Class Basketball t1,.2D,' Class Baseball C1,2j,' Class Track Nnnzerals Y. IV. C. A. C1,2,3D,' Freshman, 0O'llZ-'7I1Z.S8'1.0Il Q1D,' Cabinet Choir C1,2,3D,' French Club Q2,3D,' German Club C3j,' Honors Q1,:?j,' Class Debates Cljg Glee Club The college curriculum holds no hor- rors for Thekla. She came to Alfred, primarily, to Inasticate as much mental food as possible, and has been drinking her honors as demi tasse. A serious- mlnded student, a diligent worker, there is an intangible something in her rnien that instantly assures us of utter dependability. Always an interested Christian Association member, Thekla spells service with a capital S. Just re- cently We have been hearing inklings of romance, and We are told that her lat- est hobby is some sort of motorcycle horse. X' nfs' ...sm-f-'.. -f..-eff As., ,,,, f'1 All Ja' -1 Ns.. .4.,-,,--s'rS.......- f-w..,,,,,,..,.w' 1-A W ,,-.--' A -11" C u DOROTHY EVELYN HOLLAND HEMPSTEAD, L. I. 1 fCera.nz1'c Art O O X Hempstead Hfigh School. Class Secretary QU, Class Vice-President Class President Ceramic Guild C1,Q,3D,' Class Basketball C1,2,3D,' Captain C1,QD,' Class Tennis C1,QD,' Class Baseball CD, Class Track CQL' Class Plays UD, Footlight Club C3D,' Phi Sigma Gamma C3j,' Chairman Class Party Nurnerals C1j,' Theta Theta Chi Enter- tainment Chairman C31 "Dot,', due to her executive ability and Well deserved popularity, fulfills the office of class president in just rep- resentation. Her ability as a basketball player made her captain of the girls, team for two consecutive years. Taking .M mf' lk w. N I it 'l l. It lr X y L all l l K sf El x 'r il l J, l rg li . 'l im 'Ei . L ll K :V fl is l f l l i M. P1 4' .ii ll h r, l 2 N : lt " l X. ,H lf T5 W I I l , l f A n 4 into account these abilities, to say noth- A l Q ing of her exceptionally fine cheer-lead- p p ' y ing and other activities, we acclaim ' l "Dot" a true Alfred girl. Q it F ,A I 'Af - , 1. , ff -c fl K V , - j I ixf I ,iff W- .iw ' 'i W jill Y . WHJQ- ' A - i .x - g . ,VY i x N inety-nine 'wr ii' LT C I g ' g A 2 g A H u 4 .. THEDA MARY JOHNSON i A l WELLSVILLE, N. Y. . ll i I i . . ' . Classical A M U Wellsville High School. Y. W. Cz 'AJ l Class Baseball Q1,Qj,' Sigma Chi Nu' Critic QQX Treasurer C3j,' English Club C31 A 'V . EXN V i . A likable lass with a twinkle in her it eye-plus ambition and enthusiasm! f A keen sense of humor and a conscien- i i ' y l ' tious disposition make Theda a de- l pendable friend. Somewhere within her . make-up lurks a "tomboy" spirit which i Ends its happiest expression in the pur- . suit of the baseball. She pitches a wick- , i li ed curve! There is a mischievous, fun- ly loving spirit, too, as well as a solemn y l and studious one. Oh, she is just bub- l . bling over with spirits and spirit is . Theda. . . , ii ly y , VEVA ANN KEELER l Pi ALFRED, N. Y. V 9 ' Classical i 1 i Belmont High School. Y. W. C. A. Cljg Honors i l if English Club I y l Veva is a girl of unusual patience and A i i i A depth of character, concealin behind a i rl , . 2 A calm, passive expression a mind keenly if ,V alive to all things about her. Veva has 1 l i proved to be a very consistent attrac- llwfl i tion .in the eyes of at least one ardent if H ,I - admirer. A careful student, there is no l Qi 'Sf danger of V eva's lagging or falling be- gl is I hind. We wish her .every Success, and .fr . y know that she will reach her goal, for H lj such sterling worth as hers carries one il. fi ,xg .T far. Sli A1 xl ill . Xia 4 .r gl i hgh i2ii1.:-f5i::'Ncmr:rfffv-v-:f"M::-.T-he-g-N .----M -.-- W- -s A--- N.. ., W . . ii ll -rsizfffs e -'re e-Qf A . A Tix iw -s sf - --W" N-.....ff1i--MJ--fL.1,,s-f'f-jg'g-1...,s.-Qg3ii- "gg . A .. fx sk X K One H anclred lv, . . .- 9 ..i'fQQs g S , MN AWA .7 u A 1 f if -H H. ,Q -A A ..f'f'f 7-TW "'lgQi'5-- -'-'A"r-a--- 'jiifl J., "xr XX QQQZZN---.L--W-Q..-W---we-'M-qv---sag------A-we-c4gf':f'f XNNWMNQNC-5,.5f - New ky, X, W- -..-lerizfsttfw--wr':w5 .-Tr-iisfs-N-- i:twxf:.':.'im--t':::mk::?Pr-W" Jjr11Jg'4Q'Lidgfe,?"asEMeLi:4i'i2f9-f,.cE"yaef3:,fsMffy RUTH YERONA LUN N XVELLSYILLE, N. Y. Science E X N c lVellsvz'lle High Selzool. Athletic Council C1D,' Class Basketball C1,2D,' Class Baseball Captain C1,.QD,' Class Tennis C.QD,' Honors C1,Qj,' W'ornen's Student Government Council CQL' Nurnerals CID, English Club C2,3D,' Secretary CQDQ Y. TV. C. A. Cab-inet C3D,' Student Assistant in English C315 Sigma Clzrzf Nu Secretary C3j. Ruth is irresistibly impulsive and gay. There is a certain force in her per- sonality that attracts instantlyg it fair- ly bursts from her eyes, it is apparent even in her speech 3 it is manifested in every- gesture. The very epitome of en- thusiasm, she is easily an leader, and seems to find her greatest glory in sports -Whatever the game. Ruth possesses a very clear mindg alertness characteri- zes her. Of all the qualities that are in- herent in her make-up, frankness and integrity are perhaps the most out- standing. Here is a type of Woman that will gain many friends on her Way to success in life. MAY MARGARET MILLER PATERSON, N. J. I Classical Dralce's Preparatory School. English Club CQ,3j,' Womenls Student Government Council C3Dg Press Club C2D,' Glee Club C3D. To know May better is to like her more. Under her reserve, one Ends a personality Which is an unusual combi- nation of sparkling Wit and deep intel- lect. May is intensely serious in her pursuit of knowledge, she is out for facts-the "ifs," the "Whys,,' and the Hwhereforesf' Grades are merely inci- dentals on the road to ag richer under- standing of this great mystery-ulifef' Armed with such spirit and ambition, she is sure to Win the battle which all of us must ight and many of us must lose. . Y , , x , . uv' if n i . V-W gi MY . 'i f Y Y .. iw i f K Ai V One Hundred One ,W,,,-.M ,..f3,W-R,,,.Nk, SVT, Nj, , .,, X ,K .N , ,. fi x If . is if a , , HELEN KATHERYN MOOGAN C CANISTEO, N. Y. Science HAH Canisteo Academy. F rench Club QQL' English Club C2,3jg Glee Club Q3j. A mathematician of the feminine gender is unusual, hence, Helen is un- usual. She treads the path of her col- lege career with a serious mood and in- tent Which leave no room for doubt that a convincing "juggler of figures" is being developed for the promotion of mathematical art. In this age of flap- pers, Helen is a relief. There is a sweet primness about her that is easily lova- ble and a reserve that compels admira- tion. She is altogether a determined young person, combining independence with a Warm-hearted, sympathetic in- terest in people and their affairs. With- out hesitation, We prophesy that what- ever the World may hold in store for Helen, she will "never say die." -t-, A- v:',,.fv..,,,K ,.-'---.. Y -..fu-A-.,., ,,,,...4-.- on h -,MY k -W V, M .ax ,,, N., . ., ...nw L,,,.'1-aff.,-'4,,..wf,.. '- ,J H.. '2"':a.f-. - X. - - One H undred Two xx is ANNA MINOFF ' PATERSON, N. J. Classical Paterson High School. Eta Mu Alpha, W. C. A. CID, English Club CQ,3D,' Honors CLQD- Anne is clever and vivacious. Though of a practical turn of mind which ad- mits of no foolishness, she has a sense of humor which makes knowing her a pleasure. She is an enjoyable compan- ion and a good friend. Her one great delight is good music, and much of her recreation is secured from indulging in it. Anne is one of those people who suc- ceed in Whatever they attempt, and We prophesy a success for her in the Hwide, wide World." . . N -,X . .wx X s Q. 9' i i l . X v I i 4 1 K f I. i l. N. R F Q xx 'i K lt .' wf V .XX -,Xu . I V rr C' ' yrs- "'w.-4 -sf H .RLiis"ljf'si1'i.'QV"' - 1--- X-A --DA -fs--..W-W-A-1..lf--f-H-Af-sfr-f--r'--f-h.f-M-'M--Q11-f1:?T: 'r'1f4I"slff"', 5:15 2-Tir-fr9fff5EQ:friiPf+itil?-' ....f1eQQigg. Ulyggliillizs -.,.. f-.. l --xr V -'-A 'N-ummm ,rf --...Q,....-S-'-..,,,-,,.--Nxw., X'-.K 'l,.-, ,.fJ-.MNQUM ,..- NAM-,,C,,,,.L,,-A:-,n,,,,w--..,,,,.v'4,r,,,,,,.,f' 's.........,--' , ixmax' QUINN Nnwcoivin c c ,QC l BROOKLYN, N. Y. ltd . S f Cllasszcal gl H s n A n ,ll r Flatbush High School. Treasurer P27 Alpha Pi 1 A , Sorority CSD, lVomen.'s Stu.den1' G'oz'ern,ment C1D,' Class Termis C1.2D,' Class Plays C135 Glee Club C3l,' 4 i I Spanish Club CSD. ' Vg V If ever anyone had a winning smile, l ' f who could it be but lVIary? She is en- , thusiastic, generous, impulsive, and in- , r ' terested in everything and everyone. l . ' I' lVIary is the sort of girl with whom we C - all like to be associated-she is so sin- Q. V cere in everything that she does. One I ' A can always be sure of her friendliness 2. r and sympathy, and if she be given a it task to do, you may be conhdent that it A fl, V will be well done. Somehow, everyone - seems to Niall" for lVIary. We beg to be given the key to her charm. What a . group of co-eds we would be if only lp we might unlock that treasure vault. . p G'wan, Mary, give us a hint. Will ya, ip th huh? p . ' ' ALICE RUTH PARKER ANDOVER, N. Y. Science 9 9 X - Andover High School. Vice-President of Brick, A C Secretary of Brick. Dark, wavy hair, sparkling blue eyes, , the sweetest of smiles and a charming personality add to the attractiveness of C this petite little miss. Her mischievous, fun-loving nature, her kind, unselish disposition and her sympathetic under- H standing have won for her permanent C y places in the hearts of all her friends. lp No doubt you have already suspected that such a girl would hardly go un- C sought. 'Tis a Well-established fact that where Ruth is there also must be ' 'Dickf ' Few on this campus have failed to re- mark at one time or another, "What a darling couple." 4 l NC if i 'C i -' 'Q X NC i R My R an -ff wg if-ff-sa R c .aa A Q. 1 r ,Q i ,Q ,fir li?-C ,fir .AL .-, E4 Y -'ff JC f' One Hundred Three AUDREYE HELEN ST. JOHN , Q ELMIRA, N. Y. s Science . 11 A n S Cuba High School. Class T ennis C115 Class Plays "Jack,,-now don't be misled,, for shels a girl and not a boy even though she aspires to be a doctor-is the kind of a person that people quickly learn to like, and esteem more and more as ac- quaintanceship ripens. She is a loyal friend and true as steel. Bubbling over with enthusiasm for activity, she has a frankness and earnestness that fasci- nate .and charm. Hers is an affectionate and impulsive nature, she acts on the spur of the moment, reconsidering later, perhaps, but Why be staid when one is young and full of life? Fond of a good time and happy in the company of the opposite sex-we might 'mention one in particular-"Jack" still manages to keep ahead in her duties as a student. LOIS KATHRYN ROGERS ALFRED, N. Y. Science GSX AU7'eal High School. Class Basketball C1 jg Class Baseball CID, Soph-Frosh Play Committee CQJ. In a little White house with green blinds on Sayles Street lives a little girl. She often reminds us of an old-fash- ioned, shy little maid in appearance, but her ideas are very modern. Nor is she afraid to state the same upon occa- sion, frankness is one of her most out- standing characteristics. Without being bold, Lois is far from retiring. She is a laughter-loving creature and crinkles up her freckle-sprinkled nose most adora- bly at a good joke. That such a small head can hold so much knowledge is the marvel of many, and We mustn't forget to mention that she has athletic inclina- tions. How faithfully she has guarded our class basketball team! May you guard your own interests in life as Well, Lois. ..........,w,,,......,,w,,.-...M4,,......,xq,,..-sn,M.W,,,,-Q-E,MnN J-vamp M H W fq"'f-M ' ,- S ' . eff' ,Q X .X -N,..-..skf'ea1 UM NC U x , t-f M'-. --f -'-- ----.. '----nw - -A-...X .N .,,,, ,f,2-s.,'S.."1" - J. ,,-XCJ,P",X Q , sg-fp . ...X As- .- . W , , C N fff.Q1Jl'ffll..-f-xilzciey..--i 'Yiffrfn ,fifliiifffii AIX!-ix-P..'?Ev'jlf'r1Z.fp-,J ji-9 ,:.g'ifNwx , -fj: ., N "x it-X 'fxffx One Hnnclrerl Four ,, - i A , H.. . XXX ...AX Q, W i . v X ., , it 1xA'.l'HER.INE BERN ICE 5 i, SCH ULTZ Xi, BUTLER, Pa. l Classical ' l V 1 l 1 1 1 l x 1 1 I Butler H iglz School. Here we find the unusual combina- tion of intellectual superiority and a frank, fun-loving nature. It would be dificult to find a ,problem too deep for this brilliant mind to solve. She is the teacher's nemesis-the perfect student. Yet the appellation, "grind,', could never be applied to Bernice-the proc- ess of learning is a painless one with her. Add to these mental capacities a quick and ready Wit, an unfailing sense of hu- mor, a Warm and sympathetic person- ality, and you Will discover that Bernice is the kind of a girl with Whom you have always wanted to become acquainted. ELIZABETH WHITING A SELKIRK ALBANY, N. Y. ' Ceramic Art II A II Albany High School. Art Editor KANAKADEA. In this young soul one Ends a most 'sensitive appreciation of the beauty in music, art, and literature. "Betty', is a genius, through and through. The fact is eloquently displayed in the original- ity and exquisiteness of her art-Work: in the delicacy of touch and depth of feel- ing with which she fingers the keys of her piano, and in the joy which she takes in everything of beauty that she encounters in life. Despite her genius, she is not temperamental in the sense that most geniuses are temperamental -she is innately sweet and pleasant of disposition. In fact, We all love "Betty', and Wish her everything that her heart desires in this world. One Hundred Five 1 'N me lx E rf? ti If A 1 -ff-Qf ff-.j , M, J' as an - ' 1 ' v as 'c be t N . B I DOROTHY ELIZABETH A UTTRICH ALBANY, N. Y. . p Ceramic Art H A II Albany High School. Secretary Pi Alpha Pi Eta Mu Alphag Assistant Art Editor KANAKADEAQ Ceramic Guild Councilg French Club When we speak of c'Dotty," we think of Dimples, and Warm brown eyes, and golden-brown coils of hair. To the image thus conjured up, we mentally apply an innate sense of the artistic and a deli- cate love of the beautiful-that is our conception of her painted in words. Through perfect co-ordination of brain and fingers, 'cDotty" turns out master- pieces in ceramic school. When she tin- ishes a bit of work, We know that some- thmg worth while has been done. In all her classes, HDotty" exhibits a delight- ful intelligenceg she is always ready with an answer for any problem that may come up-an answer that is the re- sult of well-balanced thought. HELEN MARGARET STUART CANISTEO, N. Y. Classical II A II Canisteo Academy. Class Basketball C1,Qj,' Class Baseball C1,QD,' Class Track CQL' Chairman Brick Prom Refreshment Committee CQL' English Club CQ,3D. In estimating types, Helen would be an excellent example of the athletic girl. In addition to being tall and well built, she has the sparkle and vigor that come only from good health induced by exercise. Like the athlete, too, she tackles the game of life with sincerity and a determination always to do her best. Fairness and squareness are her check-reins, far be it from her to rebel under their pressure. Strictly speaking, Helen is essentially feminine. Her spon- taneous giggle and her delight in frills and furbelows are evidence enough, to say nothing of her disposition. VVhat masculine athlete could ever be so sweet? 'N-fi 'M'--, - . -- , V ---QR -N , . ,.,, W4 xx 'wr-.. 'eff ---.., "wiv -- 'N.- .. N' "1 'Ns- , M ,X .X . I ,M q-.N . -.XX ...A -.N ,M xx -.-,- F vrfmm., ,. fx. we :5 rm-3'-""""'-N.,-f "rw-nf--"""'r'--...rf-""0 ""x,.---'--N,------S-.. il CMA- .,.'ef"'2rfs,. '-f"'1---, c'e'c xv X A-PM - - Mflfi-Efi1Lil:JfiJ'9f2Z' I 1311 if N N one Hundred I llli N WX -I 1 r kk '-.xl . F !'x,,NNX xxx yup, , .., . i .lt I F I l g , E m if ', El. I px it l I 1 l l . , w 4 l I l V FI gill N 1 'N I . I 4 Ml it fi W to i K Eli NF -.a, Ylx Wife fs. -- ff: f .. . 1 .N A,,. L..N?1fr-N M X ll-. ?5..?s4w,::sil1f--s K Q-37.11 'fl'7Q:4... 7 reall-lfAsilizrlrflrrrfslzirsszzikw'A lJjx,Qtf41fllf.i1+-:'IliJ2+-J"..' X ' l hl.XllGgXH l+1'l' .-XlNll'll,lA y be YUURHISES y T Y .- u N ILE. B. X . ll'lc1ssz'0al ll A II Frzelzdslzip High Srlzool. En.gl'z'.viz. Flub CQJD: Spanish Club UD: Frwzclz Club QQD: Y. W. F. .-1. Q1.2.-SD. On the campus, lllargaret presents a quiet, retiring demeanor. To her friends alone is revealed the subtle humor and the true charm of her personality. She is very industrious, and faithful to the extreme, working her Way surely to- wards her ideal of the well developed woman-one Hto warn, to comfort, and command." She is conscientious and serious-minded in everything she at- tempts, scorning laxity and procrasti- nation as a few of the good reasons why. people leave school. Wle feel sure thaikc Nlargaret will live up to her ideals of accomplishment and perform only the Worth While when she is put to test in the life that is Waiting. l MQQJ- l MABEL EDN A WAGN ER ANDOVER, N. Y. Classical e H A H Andover H 'igh School. PVo1nen's Student Govern- ment C0'Il7lCZ.l.C3D,' Eta Mu Alpha, Y. W. C. A. CD5 Honofs CLQD. Mabel is another of our pluggers. She works and Works and Works, but still is dissatisfied with her achievements- achievements that would 'fill the less exacting with pride and self-satisfac- tion. Needless to say that she is an "Av student, with a fund of knowledge gleaned from a real intimacy With those faithful friends-books. A heart-to- heart talk with Mabel instills one with a sense of peace and good will for the world. Her quietness is like a tonicg her nature is an oasis of calm in the desert of this turbulent World. By being just herself at all times, Mabel fulfills a real mission in life. l l e l -Cf KQ -fifnwrii-'iw 1 H "S H X , W' 4 f V ffA,,1'i-,,4f,ii,-Q ,f ..a..., - ir, fsqiwkisqf . Y , iff Y-fi .,':f?i-2' , X -Qw:,,fQ' 41 W-figf j One Hundred Seven CORNELIA JANE WALDO CANISTEO, N. Y. Science 9 9 X Canisteo High School. Class Basketball C21 ,- Class Tennis C1,QD,' Class Baseball CQL' N umeralsg Class Plays C1D,' Footlight Play CQL' Student As- sistant Mathematics C3D,' Secretary Theta Theta Chi C3D,' Chairman House Party C3D,' Eta M fu Al- phag Honors C1,2j,1Junior Editor KANAKADEA C35 . What have We here? A spot of bright color, deepblue eyes looking up from under black lashes to see 1 what you think 3 daring you not to approveg gold- en ringlets on a daintily-poised head, to say nothing of even white teeth in the flash of her smile. But beauty and charm are not all-there is a certain briskness about herg an air of accom- plishing things. There is a sparkling bit of laughter and a love for dancing that comes naturally as do her Wit and good marks. A party in Alfred would not be complete Without her. Thatfs Jane. Y was X531-A-- S . V t o ST. f Juniors Sadly, regretfully, our Ship of State is nearing its port' we have yet to navi ate . , V g only that calm, smiling inland sea of the Senior year. Our bark was launched auspi- ciously many months ago from a sheltered harbor upon turbulent, uncertain waters. 0 . 1 Q Q ur crew was verdant and unversed lnnautical language, even our helmsman, although intrinsicall ca bl y pa e, was new at the post g but our vessel was sturdy, our sailors d . , . . auntless 1n spirit, so we staked our hearts against fate, manfully weathering every break, drowni f ' ' ' ' ' ng ears 1n song when skies were darkest, acquiring skill from each con- flict with the elements, until now our "sea-beasti' is easily the best-manned, finest- equi ed e l f ' ' ' pp xamp e o the high waters. Our crew works in perfect co-ordination. Each member is exceptionally versatile and has contributed his all towards making the vo a e w th f ' y g or y o a full account ln the logbook of that great Heet of which we are a unit-Alfred University. It would be folly for us even to attempt to enumerate the multitud' h' inous ac ieve- - n1ents that will have a place on that list. Our class has given richly to each branch of ll ' ' co ege activity. There is no line of endeavor in which we have not d't bl d' cre 1 a y 1s- tinguished ourselves 3 distinguished ourselves in defeat as well as in victory A goodly proportion of our number has expounded its energy in roundl thum i Alf d' y p ng re s opponents in her athletic battles. Others have turned their attention to more sedate b. o jects-debating, the literary staffs the scholastic clubs The social ld h b , . wor as een brightened and glorified by the whole-hearted participation of our lively crew in every function. We have not been selfish with our love for life. We have ever shared our joys with the othe l ' ' ' ' ' ' our philosophy. r c asses, 1nst1ll1ng them with our enthuslasm, our merrlment, Ripened slightly by experience, we agree, perforce, with Byron in saying: "There,s not a joy the world can give like that it takes awayf, The reminiscen- tial pleasures of the past seem magnified and multiplied when they are gone, and 6X1St solely as scenes in the great panorama of memory. Our Junior year fthe bright- est in college life? is nearly over g-its joys and little triumphs loom poignantly unfor- p gettable in retrospect. Shall we be laughed at as prematurely doddering if y I "We turn to catch one fading ray l Of joy that's left behind us"? The Class of ,Q8 has given of its best to every function Cscholastic, social, or athleticl with which it has been associated. Whether that unit has been sufficient i or not, we are in no position to judge. We leave that and this humble account in the hands of our contemporaries. - j ,, ,AY 1 I -,C , 4 Q s . o - f ' ' L V B , One Hundred Nine -S Y w v R . fx, L S F N W fy E I J W 1 1 ,fax ff? f 1 R V 'i I . I ' 's I ,1. A xg Q'-1 M WI my Qi? 2 ' ag: EQ! XA fe gy , 9 V M g 1 3 gi 2 ,4 fy Q ' 1 J Zgyg If GQ E' H! aff! mix K' rl ,RJ Q W vi Q l Ag ga X ' fx JN ' ,Hg 3' Y Z , l X5 3 All f N Ai M A 'Ml Ala az! ' 3 fax AXE , li fl fi S53 f SYS fy QXFAQ ei 1 K is vhs ,l Xf 5 A EX I . Y Ffa Ji 4 1 fx Y 'X X 3 , fi 'A 'SX .45 1 n 41 fig? K ix? -'.""7"' if "" " 'fTV?pf"', x 3" A. J, ,,, .FJ-,,J ,,i, ,VAN M -LA ff! -I -- V-ff 71, ,W 'M,,. Una IIIIlN1'l'l'lf Tffn ., ,pw-L ,..,, ,,.,--,--MM, at -.A f ,V ,P f. ,W ,f .f- .-,,A V . b -, x, , .. .K Q I --X X .Q y - X xn X: X . 1, Wh' 1, 111 5. fy . 5 - , 1 2 , a j NJ Ulf 1 1, 1' K 1 1 ' 11' 1 1 If -111 - W , 1 ,, Ai ' ' 12. . . 1 1,1 w ,'1. X- I 1111? 1 1 1 1 1 A 'A W! . it X. 91 1,7 'A wx R ,ff A1 Y. XJ' '111 11 R -. Q. .X ,. NI ff: 41X I 1 11- '1 " '11 15 E151 Q1 , 1 1 115 V yi A .vw I k'H '5 - Ng W. Xi . X fx . HX? 1,' A ' -3 nxt, ,1 X F: Y X1 f fig 1 5 11 x 1 .Q 1'1 ii Q LU 1. X Xxx 1 S iv 1: XXLWE zkf. .kg XY 1 5 1 ' it '1 W V 1 G P gil Ji 1 1 E 1 1 3 ,.i' 1 Q V1 S. 11 1 1, ,1 .I 1 'I 1 f 1,1 El 1 1 1 1 ? e 1 1 g 1 5 ,1 if J '1 f 1 ,' I . f 4111 A e F 5 E? '7 e ja, 1 12 5 1-ke , .M ,, A V 1 ? X 1 M 3 1, - . 'lr Fx-gg ,Y--5 Z" -,fir -V-iq! Hxf' 'Y ff Y, Tff Q 'wr X-:ji -igir' 'I Agfahl Jw "1 Une Hundred Eleven M ifeyif ' W 1 Thus quoth Alfred: Boast shouldst thou not, nor chide with ia sotg nor foolishly chatter and idle tales, scatter at the freeman,s board. Be chary of Word. The Wise man can store few Words with great lore. Soon shot,s the fool's boltg whence I count him a dolt who saith all his will when he should keep still. For oft tongue breaketh bone, though herself has none." Proverbs of King AUrecl Delivered before Weitanagornofe F l 14111111111111111+1-111111111111111:f111111H1H1111s11111m111HlIrn1H11111111 1, 11x - 11 ,f , 1 1 1 'ly' 1-" 5 If 1 f1'?,finfgE'! 1, , ' 11 111111 11,11 M,!,1,1 1 V X d 'N ':.,l- 'fc '. I. -I W K ' ' hifg . ...IE :gif MQ 1 , '55 ,H-4-jQzj,Za,?tf 11,?Z4i...1, :Ai 7 QfWxMQf7 11 Af? .1 f WK' 1 fs 1 1 9 LT? it I ,N C9 1 If W ,Ing ff, . ,x1Nf '- SWA .- 111 ,K V 1, f 11-nv - mga: 1 WW if "' f 1'3" - bf'- '1i,5"1f "" WWW! ' " !1'J1'l v'fff'1 " ' 'K' 4- NV ' t 'IJ fl '-Q'11.1vli X1 M41 ' 1' .M ' -W' NK 12111 Af WZw111N'W11 5111 ' 'ww MTI , 'Nh' Q P' Ng A v' ww "'-I .. 'V I 'A' gy '12 QM'I57"'. 53111 X If Q lfifl-'N -1- 1 '1 1 1'-:mf ?x:ijg?! :Jggk nj :L I XXX Egiggzl EE! 3 cX1gff g3Li3 -' f K, .vi Q 1 ' '1 ' ' -N " ' ' ' 'f ", ' fin 'W if ' 1Q'Q'HfQ1 39 'fn 1,6 1' i-'ii'-E1 ,. .'l. f 1fiEf1f ..' jff-,-"-:Z sl -1,4."?-.Q K-1, 1' 1' 11 1 Q?-1' ,...' f ' i if Cf ,1f'Qlj5 I 1 Q, .,-up ... 531, 1 X H uv I , gg xcy pu . I K. U lgellyllilw' I., 0 ., .Eg lx I 'U -fx v 'Nr-5 ' X --' 1? 1241 31' 16111512-'.l,lx1 , I I f I mgttzszllzlfllil . rs sl' - . N' u . 15" --ff f ' I Nh' lm IQ 13 - I Xu., xo . . A X '44 X Ming hllsfw' 'I' EE! ,Eu W' " 'yfgxpf fffgtfl 11 "-f My :fi X-T-fx I .,,c,fI:' ' ! Xlwlmuumn - u - 1 A J... j X . Au 1- 1 gftgw 11211 X XXX X f ffl N " - - 1 ffl " X . "1 T43 K F" 9 X X . M i 1 1 A NK f 1' ' 4 X .51 j,f,X1g11 4 1,11 Q XX 04 lik K 1 ' ' -:a X s ,J-1' fl , . 1 ff 64 . 11 622 ff" I5 OR xx 2 2:1 131 131 QW E211 XL 5555 Z' g-:ji .REL ,EW ff' J "fT'i'fi fi 11 1 1f1,115 1 11 1:, Qy1311iM!i111111i13131311111115115i111Q1111i4j1i1Y11gs351151111,111111 4111jg131i1,uj1gnwpjiigf M ,,. 4. .., 4 1 ,1 1 1gQ1L,z1,111,f11 111111:1111'1 11,1 1 1m1im'x 1'11j11ui1ini1 1 1111111i1ili1i1ia 1 1 1Ye ru1 r1'1le e1T1Qi'aQ1i1'1T1 rr1'11'1'1TUgE RNQJXB 219 ff' ': f11 l: X 5511 X I 1 I fx. , V - 1 1 -1. -R '- 1' " 13? 11 E, M ,fx 15.1 , Cn. 11 X fy :U- zf. ,1 11,1 -ff 1 M., ll , 1 1 jr ff, fxxf! 'Q ff! ZX! L. 1 1i U1!,c?j LQ A X 1 JA-, -.,,,,,.,-. ' 1. . fl W " '1 "Vi1X5, :H 1 I 1 1 1 ri'N.'xff, , . M1111 31 1. 1 -'I 'Q' gyf ' 4. V L' 4,111 1-11 'L' ' .QffV?A:Ij4 'H' ""n"'-"im " -:J ? 4.......-..n..........-.-. -A-A I 1 1 -...f-f . ... ,......-f-- -1 V -.., .:..,, ,.:,,,.,.- A--...--f-....i-- f f- -- -. - -Y -. .. . V - Nl- -Q M...- , L,:,f+af:,:::-'::.-:,ni::.L::i"'-.-.:r::"..,ln 'v,gv:.-:--vw 4-1-1--in-'Q"'--f x-- -- -- -if - 4 ...Q ' , ,.. - 4' - A - - ' ": ----Y-vv - ww-v---f --V Y, wvwn, ,W -, Y. ,.--,Y , A, ,,, . V -n.,,..,, W , .-.,--,,,,A Wu, H, Y V I - I W U4 l f X R Q K, iv 1 -3 . .z X 'X my if . , .. ., - .X X X ' X, , -. X W 7 X x. 'N X, w w ul. X, w. - , x V 1 y K W XX ' . N' -X ,NX Q- ,gf , F N R 5 5. Xxmldkg -., xii . . Class of 1929 OFFICERS Class Yell Up and at 'em All the time, A. U., ,29. -N-f , A I. '21 I ffl -,A -1 vw A vrx V l 1 ,Ax 1 3 ,I 'I U 'If I . A lf' .Il If!! if fx'-, . X I . JAX' :'i' R :JY 0 ,-e AE A fff""'1fS -WK 7' 'ff Qlff'3 llljfii Lf' ' 3 g lllfll Ur' ' '21 ,I - QL! 2. ill if h f 1 If' OYHOLCS 4 A A OP flyly C In . K OTTRELL . ' Alf? CHARLES CYRUS ABBATE LEE BAIZCOC S , f - ' 6 I'OO 11 071671106 jak' ll Lodl, N. J, Scienc Y wg MAY RAYMOND ALEXANDER ACKLEY WESLEY ARTHUR DAILEY Q . 'jf 1 Avoca Science Arcade Engmeermg -'M W 51 PM HOWARD LEWIS ADAMS GRACE MITCHELL DASSANCE 1 . iffy 553.4 Euicottville Engineering Wellsvllle C lassical tf,fg V fl 5 all ' 12:32 lfxff THEODORE NORMAN ANDERSON HELEN MAE ELLIS Glas n al fix X haf: 1 n n K KR E W 3 Beuona Engineering Stephentown sic is 2 1' 'if " ' if FREDERICK JACOB BAKKER SAMUEL LEONARD FELDMAR gm 1 A, . ' ' ' ' 4' ' I M! P1,-1111e1d, N. J. Classical Sprlng Valley Science sk I ,l 'Q ' ,fllfgg EDWARD J ENKINSON BALL DONALD OLIN FENNER . Paterson, N. J. Science Coudersport, Pa. Engineering Q. in Srl' V113 Sfgjl HELEN NIARGUERITE BARMORE ' CHARLES HENRY FIELD Q3 'gfm Gerry Classical Weehawken, N. J. Science I Q Ski E STELLA ROANA BASS LEE CONSTANCE FINE gre Nfl Baltimore, Md. Classical New York City u science I W ARNOLD BEACH DEAN HAYES FREDERICKS ff Lakeville Science Flemington, Pa. Engineering GERALDINE EMILY BENEDICT GORDON ELMER FRENCH Elf 1 Wellsville Classical Rochester Engineering HAROLD BOULTON PAUL VICKERS GARDNER fsfg Luzerne Science Canisteo En ineerin ln 7 A fri. Iv. A 9' ' 9 22' WM - I Ililgtlillf ROBERT ELLIS BROWN WILBUR CHARLES GETZ A .E Almond Engineering Lock Haven, Pa. Science lil l lg l f. 4, xg W ELIZABETH BARNEY BRUNDAGE ANDREXV FLEMING GIARELLI wy- , Alfred Classical Bridgeport., Conn. Science X14 l N A JC WE ROY FRANCIS BURDETT CHARLES LOUIS GILDER O 5? H0I'I1611 Engineering Dansville Engineering IK jf DIGHTON GROW BURDICK ROBERT LAWRENCE GOLDIN Alfred Classical East Randolph Science A '-l:l'j 3 WW N lm JOHN LLOYD CALL RUTH PATIENCE GREEN!-L lyk 1' . I L. I Q-.fel If Buffalo Enflmeef U19 iklfrcd Classxcal 5 if , 4 , HAROLD FREDERICK CARPENTER IDANIEI. l'uu.O hmm.Ex' In A ,454 H I . V I Q . ' ,, g. .ll CHHISULJO E7"9'm00'f1"157 W vllsv Illc I. n az nvrrz n g ik' f' ' IW'f,jiN 2 NICHOLAS LORD CASINI IIAROLD SISSUN ll-y3111.'1'UN gr- N- J. tic Slqiemyz CF ff A Q1 One Hundred Sixteen '31-.f ig A ' l I Il I lv ll DOROTHY ,ADELL HAWLEY ONA VICTORIA LAMONTE I Rochester Art Arkport Science , I lil p p MITCHELL HELLER LLOYD WINTON LARSON X ' A Spring Valley Science Johnsonburg, Pa. Science Qi my ELEANOR HENRY JOHN ENFIELD LEACH .I New York City Art Salamanca Science ii l DORIS MAY HENSHAW i PAUL LEFKOWITZ l pg , West Falls Art Spring Valley Science l l ESTHER MAY HINKELMAN GORDON EVANS LEWIS Terryville, Conn. Classical Wellsboro, Pa. Engineering ROBERT HOYLE HINTON WILLIAM GEORGE LEWIS l Tabor, N. J. Engineering Watertown Engineering y it ALICE CAROLINE HOLBERT WAYLAND BROWN LIVERMORE Genesee, Pa. Classical Alfred Classical LILLIAN WARD HOLMES - MARIAN WINIFRED LOVE Alfred Art Cuba - Art SAMUEL FRANKLIN HOROWITZ ' RUTH VIRGINIA LYON ll Spring Valley ' Science Bradford, Pa. Art HOWARD LEO HOWBRIDGE LEO WILLIAM MACKENNA Friendship Science Fort Covington Science ROBERT NORRIS HUGHES LOIS MARIAN MCCULLOCH F i East Randolph Science Randolph Science ' WALTER THURSTON HULSE ROBERT EMMETT MCMAHON i Chester Engineering Belfast Science Q INGRAHAM HUMPHREY JOSEPH GEORGE MERCK l 5 Lima Engineering Queens Village Science 1 g MARIBELLE AGNES JOHNSON , KENNETH GORDON MILLER ' 4 Gerry Classical Ticonderoga Engineering l LEAH MILBURN JONES ALFRED SAVINO MOSCARELLA it i Avoca Classical Spring Valley Science l ' ALICE MASON KANE WILLIAM ROBERT MUELLER Q' Paterson, N. J. Classical Elmira Classical ' DANIEL GEORGE KLINGER JAMES PHILIP MULROY Q Friendship Engineering Buffalo Engineering 4 EVELYN ANTOINETTE KOCH HARLON CLIFFORD NEWLANDS v' Queens Village Art Woodhull Classical I A I I A I I g ' F N B C J H 3. f' 9 i V W 1 l ily l A 1 W One Hundred Seventeen iq gel ll I l L 'I A "i 'I I . A A ff?-fSfffS fs-Af-sf 1 if . 1 -A ff I 'A Ae Sf cereus. 1 - . M' L Qff.ffgf5.f1,3f-A-gfwc-..AffSSfX'Ref+b'QfSS2ELAQAJfeLf1fILL-Lf, .ff-A-A. - , . up 1. I Y Ll 1 I ' ll. 1 A GEORGE WILLIAM OSTRANDER VERNE PORTER SISSON . . Xl- w l Almond Engineering Luna Engmeefmg lf ll ll ALICE NATHALIE PALMER MARIANNE SIXBEY Cl D A iii West New York, N. J. Science MaYV1l1e asmcal lv 5 MAURICE JOHN PATANE EDWINA ESTELLA SMITH I A Al Weehawken, N. J. Classical Bollvar Science l 1 J' KENNETH DANIEL PERKINS KENNETH EUGENE SMITH . . Q fi Savona Classical SC10 Engineering I I . l .7 A ADA MARY PIANTANIDA LOL IS SMOLOWITZ , QII West New York, N. J. Science New York Clty Science I n ll FLORENCE ANNA PLOETZ ROGER JACOB SOMMF-R ' l Ellicottville Classical Buffalo Science 5 l HELEN MARGARET POST ERMA ALTA SOMMERS 3 Blogmfield, N. J. Art Ellicottville Classical W l IL g FLORENCE SALLY POTTER RHODA STEARNS A Friendship Art VVaI'saw Art lil KENNETH WILLARD REED PAUL CLARKE STILLMAN sl! Rochester Engineering Alfred Engineering N ll 45 ,gg WARREN WILLIS ROCKEFELLER CHARLES LEROY STUDWELL Port Chester Engineering Port Chester Engineering J lv 5 MARY KATHARINE ROGERS MABEL ELIZABETH SXVAIX Daytona Beach, Fla. Classical Hornell Classical 1 A .Q Iflgg ARLENE WINIFRED RUST ELEANOR THACHER 'Nfl Great Valley Classical Hornell lxlassical 1 , .ilq gfxl, Q95 WILLIAM BRADFORD SANFORD CLARICE MARIE THOMAS f - Wjrl SHVOIIEL Science New Haven, Conn. Ari M 19243 MILDERENA LILIAN SAUNDERS ROGER SHERMAN THOMAS jf Belmont A rt Alf red Sderzce Him,- Wl CARL FLARE S - ' ' XM ,E O NCE CHWENK DM ID RIEYER 1 11.1.m 1'-x ' - - . . N , , X , Sh1l11Ugt0H, PH- Engzvn.eerz.ng Sprmg N alley hczmzec' I if LAURENCE RUSSELL SHARDLOW ALFONSO 'l'uoM.-xs 'IRIRREGROSSA Van- ' ' , . NOTH1 B100lT1fi6lCl Engzfncerzng Brooklyn bczrrzec N? F ll' 3 4 T r x v w gflffg BERNICE MABLE SHDETZ NN11.1.1.-m lRl'Il.U.KR llcrtmzxxlvx 'af . - , . . Alfred Classical Johnstown. Pu. I'.fIgIIIIt'f'!'HIg fly' . llxjjl l-Q17 CLAS: LESTER SHERMAN ll.-KNIICI. ll.-xnxm' 'l'm-zxsrncn if f, Lltt e Valley I""!7"'f,f"'?"!I BVUIIX llnssicnl ,a R Ip I 1, ix ,.f-,- Am A 4, .fx an Q M .. ,.' Mn V, . MRF... ..., ,A .V g. . ,... ,A , .,, , 1A ii, my .Pr4. Y, Q ,, .5 One Hundred Eighteen ,V v 1 ' J. .A A, V W 5' 'H A ' H N' -A .,.-f A rf :.,,I-A---Q ,Q-I-1: ,sepia -ff-wa ,,-Dfw. - I J G Q SY 7" rl 1 fx 'f QL JOHN WILBUR TURNER VERNON E. WIGHTMAN l, K A BSHOIIR Science Avoca Science Il gl . f . lt I I EVA BLANCHE VAN SCHAACK . GEORGE LAROUTTE WILLIAMS 'A 4 A 4 Coxsackle Classical Cuba Engineeying W ll, A N 7 l g A g If IEEED JEFFREY X OORHIES , GRACE DELSIE WILLIAMS N ll Scwnce Canisteo Classical L I l ADELAIDE PEARCE X7ORES ,J E W A New Haven, Conn. Ari OEIIN LEON ILLIAMS E , , A 1 orne ngineering , g HOMER WARNER WAID " ' 1 1 Elmira Science LELAND ELLIS WILLIAMS J' g A 9 Hornell Engineering , Iv HERMAN WALTHAUSEN g ! New York City ,Science HERBERT SMITH WILLSON r Add' E ' ' I I ll HENRY ELDRIDGE WEIR lson. ngmeermg ll gr Belfast . Engineefing BERNARD FLOYD WILSON lg WALDO EARL WELCH Canlsteo Engineering Hg R' L d 'll S ' A eonar SVI e meme EDITH MILDRED WINDELER j I, IRENE LUCY WELLS Farmingdale, N. J. Classical f ! A Friendship Classical N ll , I W W PEARL ARLENE WOOLEVER A . ILLIAM WARD ELTS . 0 Arkport Science I Salamanca Engineering , g 1 DONALD ROGER WHITCOMB LEWIS MILES WRIGHT U A V A Belmont Classical Alfred Scwnce l g l BET'1lY JANET WHITFORD FRANK GEORGE ZINGALE . :N ' Lg ll l . . . g J Westerly, R. I. Classical Brooklyn Science A ' 1 I A L1 Spec1als it lg A .A 24 A I ll, KENNETH NOBLE FERRIS MARIORIE HOPE RUSBY Ml ,R A W Wellsville Science Alfred Classical JVPLQ, A I, I Ffa, lf! U MILO MAXSON LANPHERE ' lx ' h fl 4' l Alfred 'Science BEATRICE VIOLA SIQAGGS Q J lg V ANDREW WILLIAM MILLER Alfred Ffemh ily Galeton, Pa. Engineering 'AX . I 1 I r ' RAYMOND LESTER QUAILEY HAZEL I. STEWART 'N ' Jersey City, N. J. Classical Almond Psychology ll ,I X ll! , 1 'l my ,X Y TX-Cf? xijfri jfY.f'fiq"'Y-7 ,,,! R- ,, 'W Y AC' ,Af " ,AL L..- fi 44 .Lai f W 1: A, f Y, ,At i One Hundred Nineteen 4 I I , . it Sophomores fi "Safe, safe, in the Sophomore Class," serves to express in too slight measure the vast changes that time has wrought in the immortal Class of '29. It has often been said, and not without reason, that a Sophomore year is that been our attitude, but we feel that we have good cause to voice our virtues. After a to 'accomplish things. The various activities of our campus life show the zeal that the members of '29 bestow upon extra-curricula affairs. The Freshmen will well . attest our vigor. Athletically, we are far from failure. Our triumphs in such aEairs as the Proc Fight, cross-country running, and the Football Contest are but the minor achievements of the same men who have contributed to the Varsity teams in ability and loyalty. Our very presence bespeaks those victories that have come to us scholastically, for we have lost but few of our large number in this way. l But, enough, this is the KANAKADEA of Tradition, and we believe that we hat e justiied 'our position in such a volume, yet our eyes must ever be turned forward We have lived, planned, and labored for the future of our Alma Blater, and looking 2 backward might well prove fatal to unaccomplished tasks of tl1e present. 1 t Unmindful of a favorable past, thinking only of the more favorable future, the Q Class of 1929 will continue on its Way-struggling, ever struggling-for Alfred. 4, . t. Q , 1 1 . - , One H undred Twenty time during which the Sophomore knows absolutely everything. Perhaps that has most successful Frosh year, we returned to Alfred full of inspiration and the desire 15 M. s in .4 f-. Ar f K' .N p 2 O 1 E 1 -6'-4 I fi :Mikal .1 :kk :F 1 . A x " 'KWQ ,V 1 6 kfg jx' ,wfx wi 2 rh' "4 Wir fyfff' !!': I YN ,x 4 ,aff L., I "V V' im if V Ti 15 7 I Jax 1' f 1 536 1 W., v . 1 i 4 1 Wg . W UK. 4 iw fu, A 1 Y W .1 M ii mf, 5 H Q4 ef ,ax yxk ip 4 fx 4 QQ A fy , A. fN , 1 A i W IA! A15 im 1 WWW!!! 5 fy rx ' u' A 5 l Ki q 4 'f f I My V One Hundred T wenty-one Thus quoth Alfred.: "The earl and the lord that heeds the king's- Word shall rule o'er his land with righteous handg and the clerk and the knight shall give judgment aright, to poor or to rich, it skilleth not Which. For Whatso men sow, the same shall they mow, and every man's doom to his own door comef, Proverbs of King AUred Delivered before Weitcmagomote -. ' A 1 11. ,f ' 1 Lg 1 ..- I 1 1 1 ! I . 1 1 1 sf., I1 U ,- ,, .1,,1 S1 1, 11 ,A 1' 11 " ' 1' 'IJ ' - 1",f'f ff! E 11Q1111,.l' .Ql11M1, l11111 'V:1!11'L-11 11? I 1 1 ' 5 W1 J I 1' 1 11141 J , ,1 X KX. 1 N 1 , f' lr' 5' ' 1 ix 1 1:,5'1' jf 11195 .15 N51 K XA K 1 J A 1 1 xx 12 M 1 1 1 51 fl 1 :js 1, f N 451 X ge-E :: M X fi -1 1 1 :...1 :Ag S ' Ei 1 F3 F 12:3 5- 1, 1: -5333 5 X CQE111' 51-1 -1- 1 ,--1 mx .IL A 211 1 1 5 12 A111 if i 1' ,C Xl 1 1 1' 1-3 ll 33-1 15 ' W Xf 0 ' S-111 11 1 1: J 1. 1 '-:UU E I :E ' 1 V 1- 1 -1 1 " 1,1-1 1 1 1 '-1.1 3 X X, F XJ V 1 ...Q 1 1. X Qg' Q." 1-1 :ek IX X31 1. 51lxX11S 153 Q X 1 1 A 1 51: -1 Q., 4.-.if , 1 C-:K ., 1.5 -' 3 1 E1 1-1 1 3 E q11F' 52 1 1. X CTS 4' 1 E 1 SS if 1 'X J FQ, ,VK A. J' , u f I '1 1 he 11" M- fd- 1 1 1 a1f,f11'f111111:1 1 1 --1 1' ,f 1 Q tl 1 1 :1 Ly 5313, Ip L.. if 1 1 -in 1 ftfy QF11 1:3 11111 , ff! X j, 3 H1 1 51 1 1 1 H15 -1 1 :ff 111 ' E1 ' 12 -fx 11 S1 11' Ee L ,f T5 .-. '11 'Q' ,1' '71 : 11111.13 M-, , XX,-31 .-1 1-wx E?-it 1: yf 12 11.-11 1:5 'QR XX 11-T pw ' 5111-3.1 1'-1 lx Ek. J '1 1 L' --f 12 2:5 ' bw ' '-I ff fi .... ... - ' f if E- 1jf'7x1.f7"1' E YT- E 1' mf cf' Q 1 lyzmxd, S I 91,0 I 5 LQ .ffl 'Zn : 3 N 13: 1 .-1 ,ff CE- XT., 11:4 ,1 : 1 1533 EN X 1 151 Z' 1! 5 f- 1-2 41, .1 W E I Ml .fbi-V fx sill K: :ti :, if 45:1 ,311 3" :Q y, 25-11 --2 11,1 1: -: ' "Un, 2,51 E :1 1 11: 1 1: 1: ,g-1 ,1-1-1.11 111 .: ' 1,1 R W 11.11 11 it-1 5111 13 'Ei V9 1 C fl! V1 Jfl ' iff 7 1121 :1 1, 12 7111 '1111 ig-51 . EEN- 1:1 L1 ,f 1 11111 E-1:9 4113 SEE. 11 1 1 W 111, ,, gf, 11 1 A , , 1 --.EE iv' ff W 2 EE' :I L 411 'wif fiimiieif15.111111Q1111.u2ii'1.111.1-.u.1-u1.1.111111.1111H1.1.11U11uf.1.1.11.1f11.1.1.L1.1'.11U.'1111,'w1!1'123111211512ILQ'12-LiifegwligifQ34-1511Ji','J14,?f1'1U!,if'FW-"5"-''W LV!! uf1."1:1iE1 - 'if KT' wmiiil-T"I'T'f'?fA"h-f-1,1 x.. 'W g-il 1152335 r- X 1111 Q 1,1 1 , -5 1 12:4:l5?f 9 TCF I . QL? -'i L1 V' f"s"x"X,2 xi-tx fx - KQN if I N-Xxx-1' 'XJ' NZ! ' 147 Xxx, x7 , fd' X ,,. 11" E' ,- P' f ' I 11 'I -f-jffjiffj'-1"-jf?Tff-ifif1i':"7TT'iT"ii':'.5'ii"iT2'T, , ,N J., X 1 X11 -l Y, ,- U' t .,f:, 1 , Iii , -4- - ,ui - H 1 ., IA, If 1' -,F . --.A if-'yjf 111 f11,1:.g 1L5-1111.11111.g11L1111111111111111111111111111111111111l1MUlUl11113-.1-11111 1111111111114Im1111Ll1X11L111l11111t1I21W1lliI1111I11H!511!111 fg1Q mix!! 13,1531 1 if 1 551 1 M! .Q HIE Z ,f 1 I. ff: I, EM-, 'f .ml SVA 115,41 Ei Q 531 gg :Q 9. 1 ,1 7 LJA4 -1 . .1 1 W., 1 if W1 1,11 N51 QE! E1 Ifi ig 1 ,111 1 1-1 'jkl 11 1 1' ra 1:1 'A -1 -J l.fyi KJ "" X- ij! 1' 1-I1 ff: :Z Nik -1 1: 1 -I1 3'-.1 J-N32-S "5 E' ffifg 1:11 fm J V1 1 4,111 ,g,1p wg, Q-1 El Ifd A 'ji 5 , Nfl 2 311191991 111 1-fl Nix ,111 11:3 ! --- 1 2 1111! ff 1:1 1.1 Vi' 11119 ,ffg7jf! .Ill Ii-'TI sf Q11 iz!! Zi :WJ fyfy 1:3 PM 71.I1::i lf f ,ff I 5:-V Ag 'I 1:5 fg 'Lrg 11' Q?-Ii? :jjlfwhy tif ,lil 11' fra 322:36 1 M1 X ':4......f11.- ---- --11+-----fr-4--fAf-1-1--fvwf -1 '1'-if vw' f 1 -51+ 1 1-W 1 1 1 1 1 1 . 1 1 1 1 1 . 11.1 1 1 A-1f -1 fu f iz! f J'I?51"Ufi,.U,1.'.x K R.: 4 V It 43.1121 1 M NM-a-15-' Q,-4.7, , W E:5'?,i'l I M11 M ' I I V WW' , 1' A W i 1 iEs,l1:,,,,LpQ:,'1'5U'115!1f1m'g1.:,R",jLliDJij! 1 Ll 'ff.!1-U lj E1 ffiif -.. .Y"::l-:?i11i1:SQ 'ffl -ff-11+ :gk .ff . ' 'ff 55,1 1" f fx, ,P if 1 ima kLf4Rg3Z,f'1i,,1jg1.:1, 51 ifglfji J E ul S 11241 A 1 ,fyf -N rg.. 1 L.lw , 1 ' ff ig , A ,,,. 1-, 4,0 ,1 f"' ,-.,.3k Q-,M 15 1 1 11.5 .1 ' J f 511' ,ff-1, ' 1'-1 1,.-,QW fr!!! .QR x,.l:QTf1Tirsfm ig X X-xl X, 1:1 '1 X ,I -1 AE X 41 X rj 1-1 ,f 1 1 -,'1 ffafx gif f-gf X., "Q 1 f--H ' 1-1 ' -' ' J' - -riff ,,. if A A 1 . 1:4 , lr!! NAYSf':'f""4:f 0 --i v:5f5 .,,?::2'f"Kf' 111. 11.LL11m1J111111,111111l11111,111 1 1 1 LJ 1 1 1 1 1 1 U 1 fi 1 1 1 ff 1 1 1 Q1 4 111' 1 1 1 1 1 1 1 1 1un.u11w111,1 H1 1 11111111w1 -1-If 1-4-ears ,Q-,zum ,, lax-.v -.-wr: -1-iff?-.nz-' -N ' 4--16.-.?'1':?f:.?'a',i'...--f'.1? 1:.w..5Tg:-rr'-: ,,4:-':- -' ..' 4. W ':,. . ' : - ' v '-L. - - ,J - - ',.::--:Lp es-LT.'T' 'T..1 L' ' ?"'T"" 'ff f "' 1'-" Tv '-73,24 "'-?2?+f-G-f'-,.- :.."-f:,'"'1:::.-:lF,-i,,i'.'.:r:fi11f. -ig.- '. -JF 1? 'F' 5, 1 'ff-- Lf? ' ""' '-Y S-A - ff-v wh- L- 1- Q 'N ---f'1'i'if:e'lf-'Ie-'2:"'T:f,,.. -- ,--.4, ni-ff? , w.Wfv,. .-Y..,N...--..,.,-cQ'qi-U-T'Q'5-vf154,-ra, MILL- ' - Y, , - ... y.,-, ,- ,Y2...,f..-i ,,.:w,,:,,,,-, , , -,..,.,f,,--,, ,--- -Y...-,f..,, Ti.-ww - W ...1. 1-1' fm X I. r E Q' 1 Q, X I' 9 , f xr. rf P If A ' .4 kj.,f Y L'-1 - 'ara ', , x , H 2'-1 ,f ,4 up 7, 'Q-5 , illfl-,I 'f , I1 f .. , ,. , . L ,ff , N. uf' - 'X 1 ' ffgf, 5 Y? ,M I ,J . K 1 w ' ' 1 . ,VL-My rn Af rw' 5-.JJ n,W,, ,Uv Class Of 1930 OFFICERS I f K I 6 JOHN SPICER . . . . President FRANCES ROGERS . Vice-President A. BRUCE DANIELS RAYMOND GEARY Purple Class Yell Never slow! Watch us go! A. U., '3 0 Frosh! Froshl I ,xx gs - ! v1 my :wr r ,,----A. A Af-'W ----,,, f ' ' f-.. --2 We -xi , . S ecretary . , 5- 51, f li W Vx Treasurer ' '5A1,'S:. M J xi 'I , A it-.Nx": Y ,Z ', if gi iw' fr if HA SW flj FI'OSh! ,THQ L - +1 xg it Gray U fp xr X .fir 5 5 fl-Q, f 1- wr A '. Xi if :Q Egxv' , i' V, 3' if gi YU lx 5 Xu' 1 N ' 5 , 5. lx xr vg ,jf f e inf - gr A A . . .N 5 Q :J rl, T if Y lf? ' fx", r ' A A .. f 1 4. 3. X in if Q ' 5 H fi I ,ix :K , K1 V I1 'fiddle . AKKQN-431' 'V X .SQQS ' ,,.QCN,w..sf:-mia-'F' - . - A Y' . X. ew 'fave . uf - 1 ,- 'lfilgyfli Q I , S ,H ,xxx ,. xx lu X ff., , ' 'V One Hundred Tweniy-five . 5, f 1 X Lv iw X- 3 4' 4 1 . I . 1 1 A, 4 I x rr .Q O -3515 ..3.iw.f2f .w Freshmen I . X i LAWRENCE MAURICE ADLER ALBERT JAMES COE .' I Hornell Seience Jamestown Cl!!-S'-9'5Cf1l I EDWIN JOHN ALLEN MARY ADELADE CONDERMAN Paterson, N. J. Science Hornell AT! ll KENNETH BRAINARD ALVORD P AUL EUGENE CONRATH g ' Andover Engineering Ripley , Science Jiii NICHOLAS ROY AMENTO ELLA MORRISON CORSON , U Paterson, N. J. Science 1 WoodstOWn, N. J. Classical LELAND REUBEN ARMSTRONG KENNETH WILLIAM COSGROVE . Alfred ' Engineering Hornell - I Science , GEORGE QUINCY BASS - LAWRENCE CRANSTON U , Baltimore, Md. Engineering Paterson, N. J. A 'Science g g ROBERT BLISS BASSETT WILLIAM JACK CURRY g 1 E Alfred Engineering 'East Liverpool," Ohio Engineering lg CLARENCE TREMAINE BENNETT MONA MARIE DANGLEWICZ Rockville Centre " Engineering Paterson, N. J. Class-ical RICHARD RAYMOND BIDWELL BRUCE FLAGG DANIELS . East Rutherford, N. J. Science Homer Science ,MARY ELEANOR BORDWELL FLORENCE THALIA DEARBORN 4. I Warren, Pa. Art Paterson, N. J. Classical 1 V GILBERT FISK BOYD CLINTON WILLIS DEKAY b Union City, N. J. Science Whitesville Classical I WILLARD EMRICH BUCKLEY RUDOLPH D,ELIA East Rutherford, N. J. Science Paterson, N. J. ' Science MILTON DEWITTE BURDICK HELEN ELIZABETH DILKS Alfred Engineering Swedesboro, N. J. Classical J . JAMES STAHMER CHAPMAN . . XMILDRED ELIZABETH DORSEY Rochester Science Wellsville Science 2 WALLACE BURTON CHESTERFIELD JOHN WILLIAM DUGGAN Newburgh Science Bradford, Pa. Engineering It ADELAIDE ERNESTINE CHITTENDEN DELMAR BURDETTE ELLIS ,g A Hornell Classical Stephentown Science A 4 HENRY ESMOND CHRISTMAN WILLIAM LEWIS FABIANIC Delanson Classical Ridgway, Pa. Engineering 1 WALTON IRVING CLAIRE NATHAN JOSEPH FASS I ll Alfred Engineering New York City Science NEIL KENYON CLARKE NATHAN LESTER FERRIS ll 14 Friendship Science Clean Science g ERNEST WALDORE CLEMENT SARA MARY FISHER A ,ii Bath Classical Springwater Classical ROBERT CHARLES COCHNAR RAYMOND RIOBERT GEARY 1' Rutherford, N. J. Science Hornell Classical W- ii-ci Tgnwcifr' W- ,M lf One Hundred Twenty-six M W kwmkwl' Moamlxwl 'P 1 X l I . A... . A- C - 'Cf . Xl. J " . A .J -' ' A .gg 11 ruff S HENRY l':l1W.kRD GENT 1 I I IVIARSIEIALL RAY IJILLS Q W cllsvlllc lu ngz m'e'rz ng Friendship Science I LIARION l.UCII..I.E GOODWIN v ' lim-Ty SHIPLEY HOOD 1 Horlwll l Iusszcal Atlanta, Ga. A,-,g I . A HELEN 1'AI'I.INE L-OUCAS CORA. FRANCES H0051-ON c ,I OWWFIU .-lrt Haines Falls Classical ,A RONALD G IEINT i LEON HOROWITZ If Clifton, J. Sczence West New York, N. J. Classical fl BERNICE ROS.-XXIONIJ GRAYES . CHARLOTTE MAY HOYT A A Bulglmamton Sczence Thomaston, Conn. ' Arg FERNE RAMONA GREENE NORMAN LAKE HUBBARD Alfred Art Hornell Science A FRANCES GREENE RUTH VIOLA HUNTING L Ancon, Canal Zone Art Plamfdeld, N. J. Classical . K I REBECCA INLARGARET GRONQUIST 'HOWARD CROSSLEY HUSSEY Jamestown Art New Canaan, Conn. A Science BERNICE RUTH GUILFORD MARGUERITE LOUISA HUTCHINSON Fnendshlp Classical Falrport ' Classical YJATSI IGNATIUS GULLO GERARD JOHNSTON JAQUISS A Sllver Creek Science Floral Park Classical I DOROTHY ELIMA HALLOCK MARY ALICE JOHNSTON Oneida Art Slnclalrvllle Science JOHN FLAHERTY HAMBEL HAROLD EDWIN KARTHAUSER Brooklyn Science Greenwlch, Conn. Engineering HELEN M AY H AAMILTON TIMOTHY VINCENT KOBY , Jamestown Classical Naples Classical ' HELEN MARGARET HAMMOND IRVINC. HENRY KORSGEN Q Q Salamanca Classical Pallsades, N. J. Science I GLADYS LEOLA H ARDER EDMUND JOSEPH KREITZER . 0 Wellsville Classical J ohnsonburg, Pa. Science l VIRA JUSTINE H ARDER WALDO WHI'1:NEY KUHL c . . 4 Wellsville Science Lawrencevllle, Pa. Engineering I MYRTLE HARRIET HARDING . HAROLD BARRY LAINE ' S c 1 BuHalo Science Hornell 0261200 V MARION EVA HARDY ANNA ELIZABETH LAMBERT . l Almond Classical Rockaway, N. J. Classical Q THOMAS GRAYDEN HERRITT l A JACK RAINEY LANGWORTHE . . Jersey Shore, Pa. Engineering Orchard Park ngineering I GEORGE WESLEY HILL NICHOLAS JOHN LATRONICA 0 Pittsford Engineering West New York, N. J. Classical ' JOHN KARL HILLMILLEB ' . JOHN EDWAIRID IjEACH Science V1 Salamanca . Engineering Paterson, . . l ? ,Y L A ' gf i . - ' v W I Q 'J ' A J GJ J A C . J 5,Q1, ' 1- I ' A A ' . it . One Hundred Twenty-seven ff? I 'Q , , 'I F , .', k I i , IW, , , - ,nf ,. ,f -f'f-SS-S,,,,.A--Rafi--SA, ,,,,. ,S M---Ap-W M MARY CONSTANCE LEACH ALfR1EiDgJANGW0RTHY PERRY S . Mt. Morris Art OI' H 1 0167106 EU! ANTOINETTE PERSIN WAI OLIVE ALBERTA LENT A t CL53IfEsA glassical fr, -,H Canlsteo T FLOYD CARL LEONHARD . I JULIA AGNES PETKO C , X Tonawanda Engmeermg Warsaw lasszcal -big il, MARGARET EMILY LIVERMORE O WILFRED LOTT PICKERING D . Alfred . Classical Horner Engmeermg 'A f--I f D jffc' FRANCIS JAMES LOOP . ORTENSE ALBERTA POTTER . W Avoca Sczence Frlendshlp Scwnce Lf, lf: DON CARLISLE LYNN . VVILFRED- JOSEPH RAUBER . Srnithton, Pa. Engmeermg Dansvllle Sczence 1? , , f l ,P R CHARLES FRANCIS MCCORMICK. D LOIS MAY RICE 1 . Homell Engmeermg Angellca Classzcal .gf JACK EDGAR MCGRAW . RONALD IDANA RICHARDS . Hornell Engzneermg Wellsvllle Sczence Q57 1?vV,' 1 RUTH IRENE MARLEY MARINETILGLENN RICKERSON Q My Homell Art Ellxcottvllle Sczence 1 A KENNETH GEROME MARTIN CLAIR ELMER ROBERTS Ovid En gmeerz ng Scxo E n gz neerm g ingv ' .4 ', PAULINA MERCIA MARTIN EDXVARD EUGENE ROCHE Salamanca A ri Lawrence Classzcal , 'H 'vs TECLA GRACE MILLER FRANCES RANDOLPH ROGERS , 5 Alfred Classzcal Daytona Beach. Fla. Ari ,wx HARRIETTE JANET MILLS SIDNEY RUIXIN if Akron A rl H averstlraw Science EARL THOMAS MILSOP STEPHEN lNIAP'ES RLDI-:N Paterson, N. J. Smvnm' .lmmlica Science if Tx MARIE LUCINDA MOIJITOR FRANK JOSEPH RVZZI Sweclesboro, N. J. I 'In.w.w1ml New York Pity Scierzcr JOHN NIELSEN I J Am ES Sxxrmzz I Port Chester I'1"!l""""""!I Ridgvfivlml Park. N. J. l'Inssz'mI ' GIEACE LAVINIA NIXON MAx Bn-:uN.um Svuxr-:umm aterson, N. J. I lux.vu'ul New York Fity Smhzm' ELAWER ELI 0LAN"E'i . . , VYRII. W,x1.1.,u-IA: Svmmxxa un-in amestown 1'f"!If"f'f"'U1fl llninvs Falls xC'I.t"PIC'f' LTEILL52 MARIIE PAR,l'1N'l'l-I u l"m-:m-zmvh Wl1.l.1xx1 Suu rz 11W CII, Qonn. l'lc1.v.vn'ul .X rlqmrl Smlrrzm' PEARL- R ',1"' - . I HIIARRIb ,l l.c,mlAm NN I-:1.1.x1 xx Lsxm lax N1 muin Westerl R I - y, . . . . I lu.v.vn'a11 Nlnlmllvimxrn Scrum' MAllGAItl'I" A .X ' I - . . . . , S'Llam.uILltflA1IIl, l lulllxlfvw Ima l'm mlm. Sr nu un S C ui , ' ' . . ' A 1 film-V' Nl llI':l1lful'nl. llil. -N'trP!1'c Une II U7lll'I'1?ll Tzlwzly-m'ql,f va -U 1 ,. 'O O ' ' I I if 1' N 1' LAWRENCE ITEASLEY SHANER . ANGELINE MURIEL VAN DE LINDER I Bolivar Classical Canisteo Science ifg I lui.-XRY ELSIE SHEFFIELD LAWRENCE EMANUEL VIOLA I I :X11g6l1C3, Art New York City Science ' ' STEWART STILLMAN SILL u LEONARD FREEDMAN WACHTEL l Sodus Engineering Garnerville Science N I THERON DOUGLAS SMITH i D AN-IRL EUGENE WALKLEY . g Buffalo Science Bollvar Engineering SEYMOUR CHARLES SNELL ' D AVID ALBERT WALLACH Schenectady Science ' Brooklyn Classical JOHN .REED SQICER u DELOS HERSCHEL WAMS LEY T Plalflield, N. J. Classical Alfred Station . Engineering CONSTANOE HELEN STEINBERG THEORA MAE WEISHAN W N ew York City Science Ellicottville Art l l DONALD BAKER STEPHENS GEORGE PERCY WHITELAW lg Canlsteo Engineering Stonington, Conn. Science MARY ELIZABETH STEVELY U HAROLD CARLET ON WHITFORD Fairport , Classical Hornell Engineering JOHN JOSEPH TANGNEY CLARK JAMES WHITMAN Vilaterbury, Conn. , Science Ovid Engineering JOHN WESTON THOMSON MARETTA WILCOX g Buffalo Engineering Canisteo Science .WILLIAM BERT TILBSOR WILLIAM CLARK WILKINSON Brooklyn Science Brooklyn Engineering ALFRED ALBERTI TITSWORTH L DONALD EDWARD WOLCOTT I Alfred Art Fillmore Science HAROLD HERBERT TRAUM 4 DOROTHY HELEN WORDEN West New York, N. J 2 Classical 1 Brookfield I Art A ' , J OANNE MAROEDAS TURNER SETH WELDON WRIGHT. Bolivar Classical Warsaw ' Art l HARRY LEE TUTTLE SMITH DONALD WRIGHT . U , Scio Engineering Preble Engineering Q , bq ERIC EVAN TYLER , MARGARET DEBORAH YOUNG n g Plainiield, N. J. Classical Hornell Science Q EUNIOE FREDERICA UPDIKE WILLIAM HARTZELL YOUNG . . Trumansburg Classical Hornell Engineering I l WESLEY HOWARD VAN BUREN EMIL GEORGE ZSCHIEGNER, JR. ' I Hempstead Engineering Wellsv1lle Science . , 4 I Specials i JOSEPH CHARLES BARNETT PHILIP ANDREW LINDBERG . J 1 i Hornell Science Cortland Science , I BERT ELLSWORTH DENSMORE ANNA MAY RYNO v l , Ashville ' ' Science Dunellen, N. J. Science I l . 1 . . A - A - I if DB I f I YS I v L L One Hundred Twenty-nine I, li rl - Q. ,s , A g -r t s, A ji ,I W if y Freshmen l 'I' ' The Class of 1930 was organized with marvelous celerity. Being one hundred lv I I 0 fi seventy strong, we have already established an enviable reputation. 4 n, ii, g .Our first event was soon to startle the Alfred students, townspeople, yea, even I the Faculty. VVho.needs to ask what event that was? It is as memorable, even now R inthe history of Alfred, as are any of the decisive battles of the world. Ah, rusty i Sophomores, do you remember our splendid resistance during the Proc Fight? Al- . though technically adhering to the letter of the law, we were beateng yet, for some " reasons the tangible victory seems to lie with the vanquished. 'i A We have proven what We could do with respect to earthly thingsg' now, we are P to show our ability to be of no mediocre type when we attempt higher and more uplifting feats. , We have worked vigorously and have rated highly in our scholastic pursuits, for WI the Upperclassmen have taught us of the ancient traditions of Alfred. It is now our greatest desire to uphold them with that forcefulness that has characterized the Class Q, of 1930. 4 . lr 'K I lm li Zip All Ill ,l f2F:fifi?Qfj,2Qi , t"'rgg5kA'1f35,, One Hundred Thiriy N I A ' K X 1 ,1 1 1 1 1 1 1 1 1 1' 1 1 1 1 1 1 ', I , ' 1 I fy H I ' 1 f fr ' 1 V ll, l 'I L 1 , I 1 W!! '1 1 1 V N L "V 1, if X 1 1 11 Ar wi ,H , 1 .- 1 A 1 11 f YN. 1 Qief 1 EW ' 1 1 Y N 1210 W 1 1131 1' K SX XJ .X ' 1 L 1 ' 1 1 1 1191! glxbff 1.91621 if 5 11 1 1.11, W ' 1 Vx S,6W1" 1 1 ' 1 ' K AI 15,7 2 Nfl 5 H1 L' 1 a if 5 S 1 jx, '11 11 A Xxx Z 1 1111 Q 1E 17f',1l 21: V! 1 f" ' 1-YK 1 X flf-. ry A X M 1' 9- 1 I f " xjly ' '1 gi XJ! x1 X '1 1 11 J 1111 1 AW 1 If A, I '1 I X gf! Y -kj, .K Qty 51' X15 A 1? W 1 11 1 V 1 if xxx! xx x'- 1 ' QNX wi' Nu' i 1 5 'A 1 I 111 1 ' ff 1, fx 111' 1X'l i MX N,-11 1 111 1 1 W1 W' f1 1 51 1 , ,W VX !,11.:J 1 Z S. lljgfrx '1 1' 1 Q .V If X I 1 ' N1 3 fy' ' 1 f'. - ' l V Q U 1, 1 E uf 1 illf! Y, kk! l 1 ' V3 1 V M M 1 .f 5 M ,j , 7 ,...,-, M, I 11 1 '1'.'ffjilfijf'77 :--1-i2T'3--'-?'1TifIX-f:'1'I:N-1-iv f---f--.,,,..- I l gil, ' -' ?'i,,1"' 1Tl?iEijQ1'5 fl 5'5,1l2if7X .3 'JQPXLEJ 3? ff Xi A LX 'X Qi-l"fil?QX1ihNX 5113-' 1 W- - Nw-- 3 ff M'-'LJX-fil1-ff-1.1'.-14-fQi.::l 1f??33-1 X"! XE: 5123 q is 431 5153 ' X111 X5..,..-ff N-M ,ff 1-rf ,fQ,f ggff 1 A' "W ' - ' ' """"" l---f'-Lzfffffi Q12 One H zmclred T hirty-one 'Ill fares the land, to hastening ills a prey, Where Wealth accumulates and men decay, Princes and lords may flourish, or may fade, A breath can make them, as a breath has made, But a bold peasantry, their country's pride, VVhen once destroyed, can never be supplied." -Oliver Goldsmith U-f 111-1 i 11' 3 E .E 1 i l 1 1 "1 i 3 1 1 ! 1.4, 14-,'1 if 1 1.1,-.. 1...'! 1.1: 1 V I 1 1 L..- 1 11,1 N A 1 . '111iX11 1'1111H11L1111 'AEYQWMWWKUIWWXIHWWWWE5El1W1lW1W1U1Nl1HHNWWRERWMNHWHW!HWH3'YW1HI!HHlWHIIHHIllilliillllllllbISHN' 1 Ti ..-, 1. , 1 "1 LIS 1 1 .Q 1 1 1 1 'I 1 I w 11 1 1 1 1 1 1 1 1 1 11, 1 1 1 1 X, M' " ' 'X Q 1' " A ' ' 1 'iii ' " ' " ' Miiiigf " ' '4'N "'1M"' fL.fX!fi' M 1" A la Q , 1 1' X- 4 X 'swf-1111111 , My 1' ,,gg:j J ' XXX xxx X-X .. 1 ' U mx X7 X' 'N 1 AW .' X X 6 ,, X' X ,-wx 'X V Alf' ,, 1 fi? -, l-AQ X fx X N51 KX K. ,A WP xg i' N 1 X A27 X f'XX1'fgf257f"f X' 'LX 1 N " ' p . 1' UVw.,f X1 K I ' .9 X XX! XX 'iff' f +1 XX X-' N K ---. Xi-X,7'f X 1 AQ X- XX .X X . 'X XF. , ,, 1.1 'X ' I ,1 A ' Q . N X Xx x X YN XX X Q XXX X 11 X! X ff X X X 1 1 X ' 1 Q9 . NX . vw-.1 . 1 v4r'igf g2fff1f' Qglwi-1 mr: Y ' X NX 9 "'-U45 X111 -5,1 Q ' N-..,,,L-Lf' U "" iLui!QlxlD::f7XX"'A ki' YQLLLQJQ-'4'9" X Sfl:: f,6f ,d,Q3yfllfL0g , ,Ar 'Q 'X lil 1 , '1j,11,11,xL1L1l11L151 11111111Akl1 1,1,11QQv'y111 Y1'1'1'IT1i'1X1'r11'1'f1Tij1T1i1'1T1f1'1rj1i1 ET1i1Yi' 11Xi11T1'1H11111'1 1'1Tff1'1T1X1f1X1:111111'11fi5T1Qjjj1f1'Q711'A111:X1i1i13101:?1'1i'i1gjl1jj1jj5jy1X- XX, Qjjj ' . ' v' 314 X- X91 XQt- Fil - 31 X---1-?7Xf1 2? .jg 'N-X, 1'J '1 . ,XID :I rg, X PM 11 ily-X Rfk? fu- wg all ,.....f'x A-3? xv 1 x Q7-'il ug 3 XE X71 X122 ig .X 2'-iif ig HX 5 , ff- -f X S1 , f Q 1 11 'aw 1 1 1 Va - f 91 113' 2 1 - X 'XX - 14 - - Lf -1 1 1:3 ,-. , - ss--f 1 'EXE Q X? 1 XTC X ' X fit' 5 1 X 2272, N -Q? X1 hmm? X X ,.-Li fl X 131 N310 1 1:7 QXQ-XX PX GX W :XS 1:-:V 1 1-1 "1 ' ' ' 11 -11 ' K if 1' XVJX X X!! X 'X X XI' I 121' J 1 fi ' 1 xx N11 XY 17511-QJXXX 3' X1 M A ' 1 7 . 1 1211 S41 - 1 M .1 .,'L-,151 3.-. -3 . .. gig-aw ' est- r 6 3 1 it r-if ' ' N 91 1-,g. ' IQ X 'Q , X ' . :1 1 N- -. f .. . Fd . 1 1 ggi h b I I 'I i K 'Si-.. :ls Xu-4 1 , F. M H351 I ' l ' Jx l ' ,, "1 Aj V 1 '51 MMA 1 -1 ' - 1- A . f 1 fflfw' J K 1 . Q 1 1 1,3 X Q.. 5 ,, Il 4 Af..-i .. W f ,,A" - , 1 L. I I fp- wa K- 5 it -Z 1' xy? 1 J 11 fr 1 211 I f X' Q 7 - , , v 11. l I 34 J M , hz 1 H 1 K 7-5 tj, ,K ' I ' 5, U: 1 f ' E 5' fl ' 'X , lg- J' A' x up f B . A ' , El - F.. L X 2 H1 Q . - -. 1 4" 'I ' "' .j 1-A J. X -v 1. ., -A .In -, ,! , ' B if X X K, l f m 4 UO' . VV. Q X FJ! - 4-'?"4:,fIS U l M f XYX VT X? 11:9 X1 X X sig- 5' 55-..-.-,M X-QgE"!' .-1.-"Li',2-4 ' ""' " . -'iii ' ' X1 - 1 X' 1 1 1- 9:'X"X1 2 fX"'M:7's xff XX XX' ' , ' ' :fm JIM- lk 1 XX I X ' L1 1 2 ' . - Wm 1 ff- Q- -M1 ff' ., 1 rf Q CXX X' E3 'Q 5 1 'qv-1 1 'I' -C -'vi'lM 'P' TR tfknwxtfo LL v'7'x:f.glY., ,1 X X hx . A Jai 1,3 X P1 11 wx Wa- - 1 f ' .11 1 41. - .- -1w ff 112-11 AN xgx X1 11:1 "' ' ' 'f .- f f , " - - 1'-5? ' X w2.::fT1f-.F 4 " ' Nd- 2,11 fy fi. 1 ' X311 XV 1 ', Q-T - ' -' .z'- ' " 'T-J N X' "' "X , 0. -'5' 7 1'X1 A 162 Xgi 'Mala' X Mauna X 'Q 'V7"3?6X55 linux. .XX n,,'fgr:Y' ,- .- ' ' 0' XMHMAMMA WX 1: K! X N 1. L- K1 ' Qu Ms U . . vi ' A 1 ,Za 1-A 91 sf D K., M" ' J' ' "'-Q' -rw-.., E'-.11 'ff 1 R jxyflpyii ,Qj MA...-vw ?'oL?.5f lsj4 wa4u EXW? H,.- ws wh! x Mczlix ff' gig Z 1. ff N 11 -2 ' x - ,usuv , ' '--1 Vi 1 11 1 2119 fy J' "fum '- ' W WM:-W -w...1-w- 1 9 11 2 U My .y.u-RWM" .W--fm" ,., " .1525 W' ie Xb 51:4 ' :T ' 1 5-51 1 125 -Ji?-, EX! 3' wc :Jkt ' If 9' mga-A-A-qukn---5 sn- r . ,VX E v-uyaiv. x tq" ' I- M: U-,hp . ,LG j1fl1..L,. -1 R eg 121 4-4 , sw AW F l X ,,.1J1X1 II: q M ffyj I V11 - 1 1. 1 N 27 mf- E5 1? X 1' 71:1 L'1?11lF5Y 41 124, . 1:Q ,fix H7121 'ij '11 Sgj X331 A 1 '- gifD1g11,11.fgf,f.1g1 -111.1111 1RI1'-1611111i1g1Q11T1g1Q1 1,1 1 1 V! 15113 1'l'3fX'1f9' X' ' 'l"'XLli?S?-il.iIg5SfL--MXX :ii ,.,' fQ:i5-: Xf ::if "" ,..,Liif:iLQXQl2l4lQli3l31XQllEf. V 'i. y1'F'X IE, X ref F. .gf I N M 1, 461' 5 "J 'X 'Til-TTS"-Tif 'ffi'ij1f"fff'f "in f'i'Yfs"i"' r'f'j"' '-TTTWTT' i:??f???XTf'g'f "" " f' '?T"""' Ti' .T5T?i'lj- . fi- fl-7---, f X W X X1 ,ff Q,W1111,11kE1I111111511QLL1lr.Lg5i11111l1HM!UjjjlQlLUjjl1j1LU,U3L11: 211111111 11121111H 1liM'1'111j i1 YiV1 !jQjj lI'131P5NE'lifiibliirl-EQQLQILMQ1 Qlywjf gi 15125 P" X7 T-'21 'S f 54.11 313, ff' If 1 1 711' 'Xf1X 11X ff' MX 11 9 ' 41 N11 ,1 1 'Z 1 1'-15 1, 11:1 ,ff 2255 ix fhffwf- IE 1, 1' xl fXA in 14' IX. 'Z 11: E'-J! X1 XQ1, EI: Exif 11 113 P-Vi X. is AW MX ig XZ' XXXXX x X 1,3 1 Z I: J 'Vw XX , :51 1: E1 Eff 15 5' 1 +321 31 ,A 0 X EX ,IL 1135, E11 913 12 121 ,gp A 14 111 i111 11:31, , if 1 'gs 'J " 1.11 Wal KJ 4' ,L 211 JX 11129 XJ, 1'X1"' 'Ax W 1" 151 If 1 5 N Q+l1:.-f 1..11 v V-P -. .W JJ - 1:3 my v5Q,1f11:-1 1 1 1 1 - 1 1 51151. 111 1 Fit? 1? 112113,DKBA!-lYUf3.U,l l,IVl l j,U,Y,Ll.Ij,H,Fj 9-Li-RMUwU,lwf,l-V?,l,I,i-ILU,-jzlri if 'rf H kjj,1-I-liljvl,Ujj41lljvigijjwljxlilj,LU1jYLLUJ-lj-LLU-Y,LU,U-Ujjj-DjjLU,Uf1.U UXUQKXEW I 1,1 , f XT 11 fi, -1 1 W " M 7" , i ,K ipx W- ,... -f A ' , S2 X Q 1-11 X ,f A if ' 4 N ff Q f 1 11 X G bw i1,,Jw2D 1 5 HJ - I X kQ2"311r4.fL Q--2-f"',t' Q A SQ 3,2 RN DEU1 Eff' 1X:jXwjffQXXlTQ 11'1'1'1T1'1 lXm'l'Hm HTL'l'l'I'lXUD'H'US'If1'XflfG7!'WiUMWHWh'9TI'5'WlU'UWWWBXUIXQXVDX9XH'B'B'!'!'EUWHTIXQTi'l'I'lTlTlXlHHl'HTl'IlAl'l'lX'ElXl Ulf! mfmlXlflXXlXlTl'gXff1T 'Ld X 1 I.-. k ,W A .-.nv-f ., Xu- 1- 'A .' ',x"i'l! ix-if A-,xfif e "ff Xi, f ' . '- -. - 7 -, 2 .fa l . , - . .- Jlf- W? V I i if .np ,-lh-g ia .. af' f3"'v A --f " 5 l A l A Alma Mater As far as we can ascertain at present, our Alma Mater will be discontinued at the close of the current school year and our main building loaned to the State Ce- ramic School. Therefore, we feel that a brief outline of the history of our school would form a fitting part of our last KANAKADEA contribution. In the year 1902, a general course in agriculture was offered in Alfred University and continued until the year 1908. Efforts were being made throughout the United States in 1905 to establish special agricultural schools which would include a domestic-science course. On May 6, 1908, by an act of the State Legislature, pro- vision was made for the establishment and maintenance of a State Agricultural School at Alfred University. President Boothe C. Davis was one of those instru- mental in bringing the school to Alfred. The school grew rapidly, and in 1912 there was an enrollment of over two hundred students. This number was maintained each year until the World War changed the "scheme of things." Then followed a gradual decrease in attendance t'l h l un 1 t e ow mark was reached in 1925-26, with an enrollment of forty-eight. This year finds us started once more on th sixty students. e upward climb with a registration of more than All business enterprises move in cycles. Agriculture has been in a state of de ' ' ' , pression since the war, but apparently is due for a revival. VVe express the belief that in a few years there will be such a demand for men with a scientific knowledge of agriculture that we shall once more find an Agricultural School in Alfred. YVe feel faSSl11'6d that, Should necessity arise, our Alumni will exert all possible influence to b . ring our Alma Mater back. ""' - sff'tX-1--safe---N.-0--A-M -9 - ..., , ., One Hundred Thi?-tfy-four A R ' 15 R W s 1 I V pw 41 r 5 le if I H ,+ 'i e L x it V. 'L 4 K l .ll X55 ,QS 5 la ,. .1 1,1 wir 'i J 4 4 N fif5Q5wAXx Mmx jfZN'.TE T!I'ffq'i1Tf-'iii A fm so ' Q .Emmy X153-Q Kfix-E-5e32:+-ELDEEQASQfl-f.ii:55S74Siff"'75 ax - A"-I-f - "'+t-1f-"x""-a---1N-- LL,-a""-L, A-ff'-. ,fi-flffyxxrf mrljX,,,-fgzuffgsiffzf ' ,,,gfg1-g,,f:1,Q?:.Ii,,gj,, T, J 4 Y I 5 H ,f l MCM XI vs X1 ff 'i Qi jk ik w M 1 1 1' X' Wm M5 ll 1 A ' NE UU AN , , J! I! 1, ':. , fr A ll lv N Y 25 ' - F fl N A' 1 ll 1 A Y W .I F It W w M il . . 3 T rl W ,. -T nw 2 ' A A , .I l ' F T H F SENIOR CLASS j . Q T . Q V N L J S, T 7 Class of1927 Q ,H N 1 ,Q , OFFICERS Q f NEWTON M. PHILLIPS . . . President 1 4 l MYRTLE J. BROWNELL Vice-President l ax - 'Q FLOY M. PRITTIE . . Secretary ROBERT F. BENNETT . . Treasurer L ' J Q Class Yell 1 J l S 1' E Who are We? m A F ', Don't you see? i4 L-9-E-7 A4 5 Ray! Ray! Ray! T A ' i. - N Maroon Gray l , M ,U QM gs N we W fl lv ,N T + 3. zlpf' NGS "1 FFS?-Sli! 'ie fe 'fe Y' Y' ECW 4 ff Y Xf ff' CH E e of EL , J L 4 ,Q X54 Orze Hundred T hirty-five 1 V I xml lv ll l 1 l if u 1 N IV l z S , r ,. 4 lex. r-. x- 5 , -. Y.,,, .-..- A - --Hg ff- -Q Y. 'A--f-:S--.,:,z'-z , ,,..,,..,,,,...s-T-Nt,i...fsf-f..,ffLeK-.4-1-6'-'j"vf'fff?-if 'ff 'xrf,ff'YQ't'pQTfiT3iZ.1TiQTal5f'2fH-7' flfrf'i1?'3i-',J-1ffisi"ffl'i?.f'T A':' - i f eyes.:-ycwgffjgfg--31,.-,..-64,4-sf ,QV- , A 'Q'fEf:',f-et""",1'3f?"E. fm .yeffcg-ue. Q - ,xrf"BYj,, Jie time DORIS M. AUSTIN ,gf 3 :lslggbl SCIO fltllll t lr " e pw Rural Teacher Training lr 5 ffljfll Ahfred High School. Country Infe Club,' Member of lalflil f l f l Student Life Committee. ' l It seems as though Doris, chief joy in life is to be ll l "forever springing new onesf, She is an unfailing source ft Ejj of surprises. . 1 ll Doris is serious-mindedg she is the essence of serious- 5 E I ness and earnestness in her Work, and her willmg ways I t ll, and a Winning personality never have failed to make 2 X ll true friendships. 1 , l ll Mil ,I llyf lt H l . M 5 ig 5 . ' l ROBERT E. BENNETT gg , A HORNELL f . ' l f f I Agriculture 5 Hornell High School. Country Life Clubg 'Class Foot- , ball, '25,' Class President, ,Q5-'Q6,' Class Treasurer ,26-'27,' tif Q jf N. Y. S. A. Basketball Team, 'Q6,' Student Senate, '26-,275 ff .fl President o Theta Gamma, '26-'27. ' ' T xll' 5 l "Bob', is everlastingly "alive." Whether it is dancing, A If basketball, or card-playing, "Bob's,' presence insures L l pep. He is a bit quick-tempered at times, but his en- ' gaging personality much overbalances that fault. M When there is work to be done, "Bob" is one of the . fl, . . . . . ,M most lndustrious. But the minute work IS over, his H Wjfl main interest is thoroughly to enjoy himself. "Bob" gets . A the utmost in pleasure from dances and parties and is an ll " enthusiastic follower of all sports. , 1 iw K Y i lil T Q35 HAZEL J. BAKER gg Scro Rural Teacher T rain ing ll Tf'clIsm'llc High School. Country Life C1 nb. i Hazel has the ability to impart her vast store of knowl- ! edge to others. She is ordinarily quiet and reserved. but when she does speak, she is well worth listening to. ll By the proeess of talking little and listening mueh, ' Hazel learns mueli. When Hazel states an opinion-it is A respected. Y, I l l l 1 l l A l One Hundred Thirty-sis: R J f. 1 ,L '. x R .'l"'J V , l -"l "Y A ll .,,. .H 1 , , F l 1 v l I 1 ill l. x V, 's t fx I - l x K lt , .-f , . 1 1 W! A l ' X Nr N X U' gg. R IHEL M. BOYD ily CANASERAGA ff. I : 3 Rural Teacher Training N ' fl. W Canaseraga H igh School. Country Life Club. 21,72 city Q G l :bv A-' Ethel s word is as good as her bondg she is nothing if e not dependableg for Ethel .never does a task entrusted gf j to her half-heartedly--she Just isn't built that Way. My Inchned to be a bit quiet and studious, Ethel puts lllllyf across what she ineans to say in a few well-chosen words. ' gli f As a scholar, she is near the head of her class. EW itll. at I iw! llfifl ll lv R l "l cl lily., l f Wy f lll il' u ll :At 1 4 . . ,ISU l . lll lgyg CLIFFORD CARRIER my if , g ' li llfp CUBA lm T l L5 Agriculture ly it . . " fi el Cuba High School. Country Life Club,' Class Football, filly' .A 5' s " lilfllfe 25' lltfl "CliH"' is always "there," whether it be work or play. K' N Rl ' il! gl He is ever ready to lend a helping hand to any worthy gff cause and, once started, he will labor conscientiously li lflllal l until his task is completed. His is rather a reserved 'QR' HW t b t d th 1' bl - Htl , y Zi y na ure, u un er e reserve ies an agreea e per .Q tj lat: tl sonality. ' 1 ,ll 5 5 A il l 5 1, rl "', XJ lu l T 4, jwlli, l if s all ,lx 2 Q! l R lf l I I MYRTLE BROWN ELL A lx CANASERAGA ' , f it Rural Teacher Training J I i ill Canaseraga High School. Country Life Club,' Member i R .ll of Student Life Committeeg Vice-President of Senior Classy tl Ll Class Cheer Leader. lg y Myrtle-"action!,, ,"f.l Qffa Endowed with a vivacious nature, Myrtle's mascu- l ljjl ,fl line popularity is not surprising. Her hilarity is of the flfm j f highly-contagious type, and a never-failing source of Wx? f tl Ui sunshine through the blues. Myrtle is a true "life of the Nl 14 ffl pal-ty,', and her gaiety is always in.demand. In addi- lxlfffi ' tion, she is a pianist more than "passing fair." my gl! LE lf Myrtlels school, we understand, is to contain only one llylgzf pupil. 2, tr, 3 ll Ill Hifi' 54-',fQ'jf4111ifi"f-fit A-eff-f 21,41--air Tilliiipir--:.1ig.L.ff-fL:ful One Hundred Thirty-seven 5, 1 1 2 aj X 1 .ry- 7 l 1 1 11 .x t -f f- ff'-if L" -1 L S 'A1,viTf'f.., QE1Lm1if?L' f-!q'1'iN:-'i g :fq Q -inf L fi 'ali 1 f I 1 HH ' ' - i V W' li V 1 A 1 lit' at ll 1M My 1!1.y' W-A 1 MARY J. DIXON 2141 V21 4 HORNELL 1' 51 1 . . lljf . '1' 1 lv Rural Teacher Trarmng X l . Phil' 1 1 M Hornell High School. Country Lrfe Club. l " . il V ll, We have yet to find the person who can gaze vvlth cal- fly 1M as lous unconcern upon "Dickie's" dazzllng snule and ,, '1 1 shining eyes. She has a spontaneous good humoruand an ' lf irrepressible inclination for jollity. Any entertainment .I 1' i1 A without "Dickie," just Would11't be. . 1 1 X1 7' - Mary's life does not consist Wholly of -"good timesng il 1 Al Witness her graduation from high school 1n three years. Ili ' ,11 1 . 1 - 1 . ' 5 My lib ff 1 1 1 if , y 1 A A V 1 1 1 X W Y l Y ' - .f 1 if ORVILLE B. CRANDALL 1 LITTLE VALLEY U p Agriculture l Little Valley High School. Country Lzfe Club. Ap either with characteristic vi or g . E1 We can always locate Orville by his joyous chuckle or a certain twanging music. In fact, Orville is a. real fi virtuoso on the jeW's-harp from which he coaxes ex- 1'i quisite melody both on and off occasion. N o one has yet found Orville unaccommodating. "He ust ain't.,' I 1 pi 1. A . 5 1 l1 I, I Orville is a "live wire.", He is equally ready for busi- ness or pleasure, especially pleasure, and enters into MARTHA J. DUN HAM HORNELL Rural Teacher Training HornellH1'gh School. Country Lzfe Club. Always ready to laugh-and make others lauch too To be dull in Ma.rtha's presence is a practical ihipossil bility. Martha never aspires to at fast start, but she is the slow and steady" kind that alwavs wins the r-ice. With Martha, perseverance is an outstanding virtue. l F1 l 4 K , 1 1 1 ,V l 1 l 1 5 ,xl 1 Al 1 fl 1, A Q1 5,13 7111 M L. f Qt 1 ll E s . 1 1 1 1 x wifi 1. Q. tr 1. ,E 11 2 1 Z Li ' r Y Y One Hundred Y lmfrty-evfghl N - t v ' -, : X . f' l l s- M X " -. -471'fflf"'-V--i",'f'f'i.T . 11.1,- Y 1 'Ji .nh 4 1 m l l n S T his ffl if 'ffZLQPiQ,f'i1'ff'.i'-3i 'l..--f-ii! "', ff- 'etifl 1, . - - M--. ,, L, -M-...,-,.,----NW,.,-----...,,f- s,,L,.-,' -t,.....,f-4 -- A . 1 itll. t2'i.l' MABLE D. FLICKNER gg ARKPORT ' . 4 EERE Rural Teacher Training QWY. . N tl fi' gl? A rlf port High School. Country Life Club. lgll Q Q5 'gg ks. XX' Q gh sunny disposition and a rollicking laugh are Mable's 3 if chief claims to distinction. For her, every happening has 1 ,will "xx its humorous sideg and every "humorous sidef, an 11fgflgy P All Q opportunity for fun. la gsfxly Mable is a most enthusiastic rooterg her loyalty is i R l Hg? boundless. Many a tiring athlete has given defeat a lg Al backward shove when a certain clear voice of feminine li. I lg -'fm encouragement bade him "play the gamef, llxlm I E31 1 5 1 Ei c ik! , . W 1 x It l ' -fli Wy .W 1 .5 WILLIAM S. HOUGH 1.x W gl ' BROOKLYN ll ' ' lr . W ' 15 lg il Agmculture it 1f ll it . . 1 l j 1 Erasmus Hall Hzgh School. Country Ltfe Club,' Class ly 1 , Football, '25,' Class Treasurer, '25-lQ6,' N. Y.S.A. Student A1 ! A Senate, '25-'26,' Delegate to Intramural Leagueg Agri- ll A ' 1l culture Literary Editor, 1928 KANAKADEAQ Secretary of dx 4' 1 Theta Gamma, '26-,2'7. ,fy k l A man of affairs is "Bill." He is the sort of chap any 1 I' A fx y organ1zation needs. For "Bill" has a part in everything lx f 1 1 1 X -and usually a leading one. ' i T W It is darkly whispered that "Bill" is the fabled "per- , 1 feet lover," but no one has as yet produced incriminat- 1! pl 1 ing evidence. Rumor also has it that "Bill" will present- 1' -I lg 4 ly appear in the limelight as the author of "A B Love 1 A. V 1. Way." ,,1 lv A 1 ' 1 j 1 3 L L A 5' . 1 . lil lll, ' l X l 1 il ll 1 li RUTH M. HACKETT .I lk I HORNELL Ml 1 lx W1 Rural Teacher Trainzng 411 A yy Hornell High School. Country Life Clubg V'lce-P1resi- ,ll Q dent of Student Life Commzttee. 1 yt thi i Ruth seems born to be a leader. She "pitches into" it 1 li l,1 ll Work with an ardor which no obstacle can dimimsh and . V l I il is a past master at handling difficult situations where ll l fl' tact is required. 1 I , y Q l In Ruth's cheerful though quiet scheme of th1ngS, there is no room for gloom, for she 1S both capable and y ,Nil , busy. "Whatever is worth doing at all, IS worth doing -I1 1 lp lg Well," says Ruth. . . ' . ? lf 1 1 l N -1 Y 4, ,.. Az- . iq.- . W ,f Nw- .. , - . , - XQ 1 lf! iq . Leffisnifgimi XV - e e X'-e B ff? rv gf."-L . , - 'rf L Qwf- '-1, "1 One Hundred T hirty-nine f-3. lf v ! ,-fits. r H I ,f .. I N2 w ..f-Qiiifgirgts. , M W, me me .me ,N f l , 9 A V fl. ALICE 1. HOLDRIDGE gl CANASERAGA f 1 ll, Rural Teacher Training ,li Canaseraga High School. Country Life Club. lx fl Alice has a sympathetic nature. She is one of those ll g f rare creatures who delights most in the happiness of fl 'le others. ' . 'yi ll Although Alice never emphasizes a good time at the X expense of her studies, We find her usually in evidence g when fun is on. Alice can dance-and Well. 1 lg . 3 l l E5 l .5 L ll A I l Nl TTT T i A . HAROLD F. OSTRANDER 5 AUBURN fi' Agriculture . C Auburn Academic High School. Country Life Club,' Class Football, ,Q5,' Y. M. C. A., ,Q5-'26,' Treasurer of Country Life Club, '26-,27. 4 . L Y "Enthusiasm" describes "Bugs" perfectly. He enters ik 1 into things with refreshing Whole-heartedness-and pushes. His is an outdoor nature, for "Bugs,' is a true A follower of the mighty Nimrod. To see him roaming the EQ' I hills with his trusty Hshootin, iron,', is to see him wan- ,X , dering in his own "seventh heaven." 1' E "Bugs, is equally at home on skis or at a congenial if card ame. A d h ' ' g n e IS a proverbial Jack of All Trades- "Bugs" is a man's man. one rlundmzim-zyy FLOSSIE M. HUNTINGTON CANISTEO Rural Teacher Training Canistco Academy. Couniry Lzfc Club' Secretary of Senior Classy Vice-President oj:Co1m1'ry Life Club! A 5 "Flossie" takes her high scholastic standinff as a mere D . . matter of form. And then, too, she doesn't study very hard, either. "Just u. httle genius." A Pleflsinfs' Dersoiuility wins friends for "FIossie" in l I l w 10 esu. e fashion, but "Flossie" entertains at particular regard for a. eertaun lumdsome Ford. Question: Is the owner to lihune? 5 v ,--V 'M -"tx ,I X my , , -- - . W-N. ,M--. , ' 'v' J K -, rv ' -Y . -A M , E.,--f-fs-. ..-- - .. . .-A---N-H , f - ' -V -- ,...-..--.. A Y M rs x,3A-QW' ' J -i.C""r,.- " , ,,.,,, fl. PM -""r'?i ..g't'i' ,J is ,'-:gift in X ..-...T "-'-T"'? 'rr--K' ""X.4-"""""":.."""'n"r--r"""""'---4r""' "' - ' - ,, - mm V' - .. we .- Y f -.nz . ,M ,xg v A f , - X f ,yy -.5 .mam -- -1-.N -I ..--,...v -rf.--ff--,ix -.,.t..1.,,,N, qu, ...,, , .VA .--f--1-- wemfk. Nkr--A.-..1t.x N-Lian A--..-. N--+..g,b,l, 't--4, rs., -uw," J 'K-f r X. QE! 4' X N 4,-A " ,,v':sf3..J,LJ-. 'H af' M. 5,,,z',f--, 'ff' ,,.f,.,f ,J",,w ft-g.,,,f?,: -1- .S . Q-, m.,,, X3 X. -N -N-X., -,, f , V, X.: .V any-f .,-' .1- 1 pf' , ff' fx ' ,.,2--" ' -J' X V .J-W .Jax -...T V---.-.N-f -hiv..-1 S... mr.,-,N QSM.,-v-.,, Q., ' ,, 1 V, f ----A ,fww--J v,....,..- I ,f--- .,-...J--H-W H...-H ,Q " 'M' 'r-Q-2' 'Km-f A '--.,...,-..1-f"4-...,,,,,.,.n'M-..,,-'4..-,f,--,-"x---...---m"'-...,.,. f.m....---' W' --.. MAE HUNTINGTON PoR'rv1LLE I Rural Teacher 'Training Portrille High School. Country Life Club. As the proud possessor of beautiful auburn locks, Mae should really be blessed with a temper. But strangely enough, no signs of violent behavior have ever rufliled Mae's agreeable manner and easy sociability. It's the "problem of the ages." - Wie canit just say why, but Mae apparently enjoys work. And we must say that the results show real con- centration and elfort. T LOVINA -E. MILLER CANISTEO Rural Teacher Training Canisteo Academy. Country Life Club,' Agriculture Art Editor, 1928 KANAKADEAQ Secretary of Rural Teaclzer-'s Class. A .Q I A merry laugh usually heralds Lovina's approach. Care-free, fun-loving, mischievouse-a "dancer through life" we might call her-for Lovinais existence is a happy one. , But beneath Lovinais pert exterior is a steady sense of "the eternal fitness of thingsng she has a.firm manner of expressing her beliefs which IS astonishingly like r,,, NEWTON M. PHILLIPS VVELLSVILLE . Agriculture Wellsville High School. Country Life Clubg Delegate to Intramural Leagueg Class President, '26-'Q7,' Agriculture Business lllanager, 1928 KANAKADEA. "Newt" is a steadying influence. I-Ie believes firmly "that all work and no play makes 'Newtl a dull boy"g and so he is an enthusiastic follower of all outdoor sports. As President of the Senior Class, "Newt" has done his work nobly and wellg as a student, his high grades testify to his brilliance, and as a crafty checker-player, he has tallied many a victory. piety. "f+Q.fq ,iq Mywf Ji "'f'Qf if NC - X31 'Kill if I A as .,.5ik One Hundred F orty-one fl :lr Q la X ......fi.1f1"x t. Arbghg r,::...x flat xfnxri 6, ...Y ,f--.,f"!iT" j'f"'il.f"fbin,T'iiTll'X,ef':K:N,,,,Z.i,s.,,p -Hbax ,Y 1-.af -- f -lam? M- fa, 4-.far-ssrgfse vJ' 1- f N- 4 ijresiiflflbigS:11Q?i:fxii5::t3E:gf.f-ifQsy5c.::4E.:.faf'3e:f"r:ff.ifE:2f-f?f7i?El'gfj4 I b' a it I Y fiskllv. . fi HARRIET R. OSBORN fy! xi H ij 1' X ' 1 I X ARKPORT 5 A ' lu E. . inf Rural Teacher Training QW? 11 gi jj Howell High school. country Life Club. I A Harriet puts her heart and soul into everything she does. She has a quietly earnest determination which even the hardest of problems cannot withstand. Her 2 Q a . , manner has an engaging simplicity which carries a true note of sincerity. . V, il The round of social events is not foremost with rd K7 l Harriet, but she enters into a good time to enjoy herself fgzlnl -and characteristically, does. M i W . ff . 7 .gal ,fi 'EAU i lk 5 W . 5 lkfg, fy. BURRELL A. ROWLEY T ll J AsPER T il lg, l Ml ' Rural Teacher Training X ul if H ornell High School. Country Life Club. 1 l 1 , n fl- fl . :I Brave! What man must not be considered brave who 12 ii spends six months in classes with twenty-four members f of the gentler sex? Burrell claims the distinction. More- el ll 5 over, he enjoys it. - Though laboring amid diHEiculties, Burrell remains Jw F faithful to his Work and perseveres industriously in his T5 studies. His sincere and quiet Ways command the re- l 'ff spect and wonder of our more susceptible brethren. 5 . 5 l l ll H l. T? 1 - . if. rl- 0 I ly l 'ali 1 ' I 2 f . ,J li FLOY lVI. PRITTIE llhil JAMESTOWN Rural Teacher Trainiing f il ' ' J amcstown High School. Secretary Qf Country Life X Club. 'W :N-' Wir. Floy is typically French. With her. life does not drag X for th ' f' - ' ' r ll e recipe of F105 s personality contains a generous nl. pinch of ginger-or shall we say pepper? V 5 Natural dramatic ability keeps Floy in constant de- lg Q inand as an entertainer: sho is a popular figure. Floy is li, a mundane spirit.-a magnet for men. fi ". l ' x One Hunflrcfl Foriy-Iwo 1 R W R 1 . .if :ll .I gm: .ll D X N. xv - M lit .yssx - YXXNX S---- XXX.-4 . N, e . K. ,, , ,- . vw, ,F VK. ,..- J' .. faux -b,, lf, .g-7. - -.,... - A ' 1 4+-' M... ,.1- f -,-.z,.Ae,,,--f L-4. .1 N.. ' -, ' sf , ,N ,i.- ,f 1 ' ,1 ,Vx -- .A ... - ,-,... ,Ply -gm., N-SQL.- NNW V.. , ,.1:,.,.., .K E ,Q ALICE NI. REYNOLDS N BELMONT tp. Rural Teacher Training Belmont High School. Country Life C11 bg P 'cl T t ,Mi . Student Life Conznzrittce. L mm en of Generous in height and mind, studious to a degree, tg, but still imbued with the spirit of fun. Outdoor sports fl and sleighrides are Alice's specialty, though she can be l X induced to dance-at times. 'W rf I Alice enjoys herself wherever she happens to be, and pig, likes to talk and joke. . y As President. of the Student Life Committee, Alice gleefully doles out punishment to the misguided ones. fi K irln' Rig gl' Egg: ji Q 3 M E s 4 14,42 . I Fl Nt JOHN SMITH ggi l ALLEGHANY S l . . ' it Agriculture 2 ll ly, ' Agricultural School at Crailsheirn, Germany. Country A .1 i Life Club. tl I Though John has been in the "land of opportunityi' 5 but a few months, he has mastered the art of taking a A w joke in the American way. John's perseverance coupled with his rigorous train- T ing in Germany have stood him in good stead in quickly li l "getting the hang" of our customs. Besides, John is a if hard Worker. Early morning hours often find him at his desk-toiling mightily. l r fi ll Vi' i lil 1 f 4 I , ISABEL A. SCOTT Y CANASERAGA Rural Teacher Training lL lt Canaseraga High School. Country Life Club,' Member li of Student Senate. , , .Syl High grades seldom come to one who studies little, lfitl but they come to Isabel. For she is one of those rare persons to whom knowledge comes easily.. . M l .3 Isabel's fondness for long words 1n nowlse makes her T fllll difficult to understand. What tune she does not spend gglfllll in studying, Isabel devotes to her friends-and she has I many. ll 44 in ill Qgllial vf i-J'fg1'C,Vl-stil-T-'i,-E ixh W S 'f e fe XT -if "Cf xc Tag' S' f' j f- One Hundred Forty-three matter of concern to the curiousg but notwithstanding, T KX ttt - ji, T if 5 is .5 M E ADELLE STEWART li' 2 5 T CANISTEO f T L Rural Teacher T raining if Canislco Academy. Counirg Lzfe Clubg Member of 1 t Student Lzfe Committee. T l As a source of knowledge, Adelle has no equalg she is T A an oracle and encyclopedia to those in doubt. l Just where "Delle,' garnered her store of learning is a ' her advice is authority and her Word law. l But Adelle is not a dry sageg she has a frank and l sincere manner and a sparkling Wit, yet modestly often l yields the credit for her achievements to others. .I e FRED H. SNYDER CHURCHVILLE ' Agriculture l l ' Churchville High School. Country Life Clubg N. Y. S. A. l Basketball Team, 'Q6. l Fred sees the bright side of everythingg he can't help it, it's his nature. No amount of "kidding" can l rouse Fredg he takes all that comes good-nattuedly. Basketball claims Fredls chief interest, and he is an . exceptional player, being a mainstay on the Ag team Fred has a good many likable characteristics and, i consequently, a host of friends. r H l l all i' Y n N' li F T T 1 Q li ,Ah ly ' it l ELE.xNoR fx. sw.-xRTz ? il ', D.-XNSX'II.LPI qi ,i ig Rural T caclzer Traz'nz'ng Da11.v1'1'llf' High School. fltlllllfl'-ll 1.z:fv fillllh' Svcf'f'i.zrj1f of Sfudwzf Life Clon1n11'flm'. i ' ll fi. Always sunny, :ilwziys smiling. l'flc:inor enjoys life llxll INIPIPINI slim' iievor fngs. llvi' lmppy disposition bolsters fix! ' up our spirits in depressing nioniviits. N MX .lust why lfllcauior should get sur-li :1 "kim-li' out of life. fi u sometimes puzzles us possimisis. lllllxxll. ilu-rv is lim' xiii Slum!" f'0l15ll'l1l'5' ll' lllkl :ilisviil fiuiivv. -li-spite other , 'Q niusvulim' aillmvlioiis. llul. aliiylmw, I-fI,qm0r is :hp l'2lIlllTOW wliim-li syniliolizvs lliv 1-lv:iriiig'nl':i storm. 'XX I lgiill 1 W, X ' H .v . - -- r .5 .. - e P. I , ji Y -fl, . I . . , h . . tl ii .mlb H in . V Une llurulrerl l'Y0l'fl - 'our .l . x PM-X 1 .. ..,,... .cs ..x. ., ,A1, , ,,,,--x ,AA- ii...-fx",fQsQxc,,.-,..,K um M-, W, .5-Q se . lks qos-..N..ge--e -at'Mitre-siege-msrs....s..:s-...s..-was .jiv-fi.rfg1..efi,.esrfgffe-..sfo X-t. A,v,, . 1-...,,,W. -A-,,.,,,---N,.,,-,mnmfM-..,,,,u:A,..:x,,x-Anjsxglya, ..- lj vyasgrwp..qNn:Ap,,4n:'D':K,.f-""-""l,,..r.i,4mM,,,,,,::fum ,Ji 'n.p,,,,1-'lg' ...K MABEL M. SWICK ARKPORT Rural Teacher Training Canaseraga High School. Country Life Club. Sincerity, reliability, and a quiet determination- hiabel. For her there are no half-way measures. What hlabel does, is done well-always. Under a cloak of thoughtful seriousness, she conceals a genuine sense of humorg but it is not for everyone to knowg it is a prize shown only to a deserving and worthy few. 5 3 . ! HAROLD H. WAY CHURCHVILLE Agriculture Churchville High School. Country Life Clubg N. Y. S. A. Basketball Team. "Where there is a will there is a 'Waylf' Harold faces work or pleasure seriously, as if each action were to be accounted for. He is a good scholar, but does not restrict himself to studies. When Harold plays basketball, he puts all other thoughts aside and HELEN E. TRACY CANASERAGA Rural Teacher Training Canaseraga High School. Country Life Clulng Member of Student Senateg Treasurer of Rural Teacher s Class. Renowned for possessing the sweetest disposition in her class, Helen makes friends easily. Though a bit quieter and more studious than most girls, her likable personality is always in evidence.. u . Helen "goes about things" wlth anialr of sincere cheerfulness that lightens any task. She IS ever an eager helper and a staunch friend. "lives" the game. Concentration, the key to success in many a field, is Harold's "long suitf' at - ' or zfe--C i f ' f ,Ixi 4.4 gg ,xg f ,cf 4-C' One Hundred F orty-five 1 I 4, 'a A . 1 1 c , e 4 - - it N 1 f Y ' 'W ' .. H. l W, l lr X , ' l I . . , -,W I F l 1 Q 1-:fw-1f-..,e-M',,,....-f-..,NK....,,wxi' ff,--,,X F,,,...-...ms ,N .M . 4,-'-P:-1-si.,-" jj-wx 4,.-A--M... 'r ft 'ft V-Ifmfs'-1",',fPbs.TSP'be232iTelfsi Nff a,,.,...-ff-'riff ,jjljj,f"'f""' ,,f"'r" fe ft" ' P. ADELLE VAUGHAN l r l HORNELL Rural Teacher Training " ,Delle,s" joyous presence forbids calamity. With out it, no Country Life Club party could be complete. And when there is work to be done, ",Delle,, will tackle it ambitiously-and presto! But We suspect that school work is but a side issue with our blond goddess. With a sprightly interest in all things, a friendly aggressiveness to accomplish, and a boundless capacity for ambition, Adelle leads life a strenuous chase. MRS. MABEL E. VVHEELER ARKPORT , Rural Teacher Training Uanaseraga High School. Counlry Life Clubg Vice- President of Rural T eacherls' Class. Vlle all admire lllrs. Wheeler as one of the most in- dustrious students in the class. In addition, she con- tributes much to the spirit of the school. lllrs. Vllheeler tries hard to conceal a keen sense of humor .beneath her quiet and reserved bearing: but evil will out. No one enjoys a good joke more than Mabel. EUN ICE B. WORDEN ANGELICA Rural Teacher T rairzing ll'1'1 vonfan H iqh QPTIOOI F' X 1' , - . 01l7Ifl'jlI.I:ft'C1Ilb. lunnxee places progress before all else. She has chosen hier .goal nnd spares no effort in attaining it. When IDIIIHCC works, the sparks fly: when Hnniee plnvs. she enjoys herself thoroughly. I F Despite her interest in the seholnstie side of life. ,1nn-- f " at ox ts n good tnne nnd IS intensely hnlnnn. ,ww s.::igg,. ..... fee ,N.,. r lib X Une Hundrczl Ifbrhf-sin: T ,wwf - as - g V- r A f I Seniors As we, the Class of 19927, leave our Alma Mater to follow in the footsteps of many others who have gone before us, we leave with a firm resolve that we will uphold the traditions and utilize the teachings of our school. Glancing backwards for a moment, our determination seems justified by our achievements. To write of them is needless and boastful. We derive our reward in the knowledge that we have added something worth while to the school by our service and spirit. While we have aimed at, and achieved, high scholarship, it has also been our policy to enter whole- heartedly into the athletic and social life of the school, we have tried to give of our best. We leave reluctantly, for the years we have spent here hold many pleasant memories. . One Hundred F orty-seven 1 1 l N 1 l T 4 l '.-' ,, .1...E-4'j.ff"gT-w-'52, M ' . " f - ....f'7- filf' ' ' , A , xx , f . 4-,5-I--A--e5,f Hx- 'Y . ,, - i . M " '. . v-- il-Awgiu -itqlfx-fr Y---'iii' if-1' Ei-Q YY, W l 'B' PAUL F. GRISWOLD CHARLES W. WARDEN LEVAN A. ASHLEY GRANT BAKER KENNETH M. BENNETT CHARLES E. BLACKMER HENRY A. BUTTON HERMAN C. EASTERLY PAUL F. GRISWOLD A. NELSON HENRY HARRY M. BENNETT EARL V. FARMSYVORTH HAROLD J. ARONHALT HARRY M. BENNl1l'1"l' EARL D. CARRIER EARL W. FARMSWORTR WALTER FROTIIINGIIAM new L- A,T....A.,! Nr... , - , -. .-- 1 V, uf ., A .f 12...-fn-QA.,,q.,.-4-+-,.. 4:,..,f,--- O 5...-. Y W 1 J UNIORS- FRESHMEN The Class of 1928 OFFICERS . President . Vice-President Livonia, N. Y. Fredonia, N. Y. Honeoye, N. Y. Jamestown, N. Y. Cllaffee, N. Y. Mt. Morris, N. Y. Canisteo, N. Y. The Class A. NELSON HENRY' . MELY'IN B. ROSS . JEROME BIYERS DESMOND A. PARKER HERBERT C. RAINKER BIELYIN B. ROSS SRELDON A. STEYYART SANTIAGO YENEGAS CHARLES W. YYARDHN H ARRY YYIT'I'liNlIERG of 19129 0l"lf'1Cl'ZRS . I,I'CSlldt'IIf . Vice-Prcs1'rlm1t Angelica, N. Y. Mt. Morris, N. Y. Cuban, N. Y. Cllllil, N. Y. Y Flnlsluixlg, N. '. One II?L7l,ll7'Cll Forty-m'ght EARL D. FARRIER . llARo1.D J. .1YlkoN11.x1.1' l,lTlil'l'Il.l. T. l.1'v1-: . Secretary . T rcasurer East Otto. N. Y. Bolivar. N. Y. Cuba. N. Y. Canisteo. N. Y. Addison. N. Y. New York City Coopers Plains. N. Y. Brooklyn. N. Y. . S vcrvfu r y . Tmxszz rw' Alfred. N. Y. l7oNAl.n G. Monms lsr-Ima. N. Y. 1'Al.x'1N V. Nlvuomox llornvll. N. Y. l'lIfIN'l'UN ll. Smoxsox llzumnomlsport. N. Y. .Yl.lH'ZH'l' ll. YYINSUN Belfast, N. Y. . i ,V 1 1 it 1 F I lt vm EE- N-A R or 'B N X Q x J it r . -f . I ,N 1 'A ' '-. ' X-EA ' H"-, .X f ' xg - X 24. :-.NWN AA-,J I yr, - I .Mb Y VV Ag 1 I I .X , xx . N XL . ,, X4 R tty X It-Nu .N M X ,. .N-:,... .A ,,..-..-...,., ,V ..,......--K ,gs -..ni ,..,. ,N N .y....,, Xl5,...h.,r-.MF-.QA-K-.sf s-.,,,. xx, W. sex XXX, QM T g px l .X ,,gfxvQQ-fi-s.,1H-A-.,t. AT1N-,.Zk:f1f,.,rs,H-SIE.,-.My-Ji.,5f'N, "-X- T. -gsm f'-N...x+ X --.,,, H., '-- -B , 'T r--ee, E----A -..,,,,. ,rx ,. ,- ,. kd,-r , -T ...W ,.ffm1if' pf' ,,.1-' ,, A- :gif ,E----L, T.- ,,re.T N. . ml ' " ' r'-'--- ---f' '---A--.V-'AW' 'H-..A,,,-H-.. .r -- .v ,f I A, B-awww., ---51' ,,LT...Ewv 1--L--" 5.-T E..-f-P .EQ.:.-W--' -,W L tk . N- X f X-R YEMEN X . ...P-we .,.1ANSi,,.,,y--Q.....,A.pLa'gf-, ...-,.t,ww,.-w-.rj3- -,ff - ! , V' "Mr -1 M- - if X ' ' I T s lil. X x l ME lx :U 4 .Qi tl i In lvl It Z in .X , W. -,,, Y. ' Us RE A X. fl? AV, IIXL ',.k l Ai i Q fl. il ,aft 1 : , ,X H f 1 ww, Jllifr A,-X . ,E W "Q, I QM ll? it , ,Y ' rw, . il eral lg lik ',l A I ,I If l swf ?Yi l liifi il 1' ffafl 1 T IW' lxlfiil T le A tl 'mf i if 5 41 5 i .1 1 R 1 1 1 , i if 'l ,w s l l -i 5 Rf, F . H. .pl T.. N. Y. S. A. Student Senate if 7. fl 'X ll .l ROBERT BENNETT . President ll ly HELEN TRACY . . Vice-President ll .1 GRANT BAKER . . Secretary- Treasurer All If . il' ' if .ff fy ,TQ MEMBERS . A X ,I sf T T iw ROBERT BENNETT ISABEL SCOTT HERBERT RINKER fu' -l F ', A . A , ' GRANT BAKER HELEN TRACY HARRY WVITTENBERG ,N I . f"f 'Ji as ly 1 llijfi In the school year of 1914, a representative group of six members from the Agri- their cultural School was elected by the students for the purpose of developing an honor system of self-government. The six members were elected-three from the Senior ll Al Class, two from the Junior Class, and one from the'Freshman Class. The Senate has an enviable record of wise and just rulings in dealing with viola- li gli tions of class rules or regulations. fl ld' The organization is expected to continue the beneficent work to the school that fp ilgf it has been carrying on in the past. ,T l I T 1 , K M l if: -T, Sf' TT' - ' QQ f 7' Kr' X-f ' , T - . . A l One H zmdred Forty-nine . y ,.. . C g 'fi Y i f J J , If w I S lr l li' i i In ., 'i' u ., , .. . Wi a I 1 , gi il T 'IIA It Fi, il i 1 A T l H V l 5 Ar ii, T liiiul fl it A Vw lt it i . fi T l' t F ill , li x Q ,, 1, A l ll ' 4 p f Y V l ie r A T- l it y w The Country Life 44 Y , . Y fr T ,ig The Country Life Club was organized early in the Fall of 1909 for the purpose T 'fill of furnishing relaxation in the form of discussions and debates. The twenty-six 5 8 it K 11 charter members did much to insure the success of the struggling organization. As i attendance and interest grew, the club became a leading factor in the social and - . scholastic life of the students. Through its activities, new friendships were made and old ones bound closer together. Gradually, the mode of entertainment changed. until at the present time, the meetings consist of dancinv' and frames. y za rw rw Ji The club has been and always will be something of which we are justly proud. it A al li U 'V 3 ef, rl M if tti , 'itil l U .,,,., , -:h,.,.NM....,,,,,.,- .ig NIH- ' If ,.,,.f-"ir," f ' ,, ' . One Hzmd'red lf'f1Ql'ly ll X , I K fl 'I 1 I Ml int M2 KH i. I 1 nfl l is 1 K i , V P is ri 1 '. 1 X ai' lx S aft ,4 'x XX! H w I i , XX KA 1 1 ' , . 1 1 A X XX L, 1 ,gi ' x x uk ,, 1 X mxyx 1,1 Q X 1 1 - -N-.. x '1 ' K ' 1 ,.-' ' 1' - 1 1 1 11.1 1 1 1 . ill 'V. QI 1 . -1 1,1 1 1 1 7. 1 1 111 Q. 1 1 1 1 ,1 1 -4 31- 'ijkilfffi mf: 1511! 141,11 14.21 We ,111 .1 11, '1 Xry if Z 11 ,1 , 1 1 1 '11 1 'L 1 I '1 ,11 L . R 1X1 V 11 11 1 1 11 VM- ,, N,, 1 X 1 1' gm 1 1 1 f1QJ'K1! 1 ljxfgg 1121 f V 1 f 1? 11 1 1171, Rm. QV ' 121 YM 1 11411 Q11 111511 I Xp! A1 Wfl 4 1 1111 1 1151 ,UQ Q11 1 1 V5 ! 111 P1431 Y 111 9,1 1 M , 151 11 1f 1 1 f 1 111 ' QA i W1 1 A 1 X, F' X ' f1 1 ,X lf: X 15 X!!! 1 111 ' 1 X511 31 1 - 71 if f1 1 1 1 1 ' 1 , 5 1 Q1 11 111 1 1: 1 , , N 111 11 f 1 1 One Hundred F ifty-one .1j Q 1 Wm lf We can, lose 1f we must, but good sports always. -Coach Miller A 5 i 1 '4' 1.'44-wg 4444 44 4,-X4 4,4,-41.4-4,,,, H 44. 44 A L44 X.4,,4 4 4, .444 ,444 14,44 4 4 4 4 444.4444WXWl3W44W44mMtflmxsaQHHWMHWWWJ1Y4HN4'MW'eWNWUW4UH!l434N5HNlUH4W3Vi?W4l4I1WF'iYfili4llllliHHlHl!HHIHHSHUNLV, X 4 4. ,..., 4. 4 " - ' '-'.- ,- r 4 'K X ,Q Y 4 'Y Y K, 4121, 44'g 4 ggi V '4. X41 1 4 , Q N' . 1 , N Q' ' ':xS1' M Q X9 V xi! .X ' 41 -4 U' J 'L ,ff 'ff' 'V X xl xx .K lsx xxx A X M X X K., Q Y 4 X -X QK If -, xsxl 1 54 .1-, .4 fi?-f' ,Q I7 Y, jk!! -yy, 'iff 4 , X ' f- XX xx XX XXV' 4 1, X X XXX 5 - . X4 ? ' il ,I X fl n 1' K !J'I f KW47 fl 71 0 4 ' X X4 -4. . X . ,I4 ,AQ VX'-N 4 X ' - ' ' 4- .1 L' if, 2 I . xx X, Y? - kk , T 4 4 xx l R -, Q, X .x '- gli? X ff! 4 L, -X4 4 E4 X' .wx 'Y 4 f- ' ' 'X ' K Xix ' 'xxx I 5 A' R -. 7 ""14fQ' --f- -- ffl! ff J " I 'V XX Q 5 X5 xx , 'mx X x W I X xx- 44.11 Y- -, . K gi ,f,,Y4,,Qf"""-- '40 if ' 71 XX K 4 X X- ' 'X 5 ' WRX, N., Qxgz. 4 4 I fi x1...::f 'N J V' ' 4 A , , - " .UQ,Mq4,flf'-J ffxxx V6 fy F11 ' 41 4 'V X 4.4 - 4 ' '1 , , f QR 4 Q.- 2 X " 'R-'43-A--'K-L -- 4 - 4 4 4 .,,,!.! '. J, ,g,L,LU.,L,LLlf.l.'.L5lff4,LLLUL i.f..:,f L'f'JlMlliU-UflU.L5 f 5 E LU! 4 iull-fl-Lli"Xv 'Will LK! Z7 IC- . NA . X-M 4 S 4. f' ' R I Alf '- X 1 7 "' "-f ' 4 4 jv' X-N X ,ji ,. 4 -V. nn , X 4 1 4 1 N 4 l i '? YJ Q 'gf . 4:4 45.3 F 2 Q fi . 251 --'X' 4 --fx S24 ? 4 ....,.,i N- f , we AN., x A ,4-q 4 4 i 4 J ...I 4 ,I I E Ii 44 -i fl 4! 1 w ,.'f 1: 4 -if FX X44 t 'g Nu "L, 4 4 Hfffit' 44 :J .. 4 4, yi 44' 44' ' - 4459 My Y 4 fy 6 IX, K4 Q44 I V HJ 44 . ...4 I, 4 . X I x x 4 If 4 4 4 4 I I3-'21 4 5 4 4 I I I 4 4 4 1 4 4 X - 1 45 xii xxx 14... 1:13 K I C' 'ff .Y 353 15 T4 -if 3 4 4 54 gl 4 11'+?:M 444 '15 'M JP X1!,.4x XV! I ..4 it-K gy 4 2 kiy M' L- x75 QL- ' X 125 .-2. 444341 42 ,4 4 4. G : Q. Af K :lm t' l? V" 1341! in Pirlige, ff :N 411 44 5 34 ,4 ff!! L: X G Y I? 4-K ,Lf ,Q 54, ' 2 KK Q4 f 4 4:4 fi if V X lj 53445 5345 41" " f! - ' 4543 L 4 X it N- Ji X ' V 'X if' 'rix 4: is 14 Ei? fyf? 45 42 4 4 I l 44 :A Z., 4 QE li 74 'f w 47,43 ' .E 44 EUVX 4 4 rp-5 Uv ,J LL F gil 4 42 Aa 2 22.1 Al 4: AF 54 xg gy 4 U5 4 'fi 'QQ Q!- X I 4-1 EE'-EY 4 F: J f' Eg H15 ' ,il Q' A , EQ J! 14- .ml PQI y., f Q 1 1:4 A 'fl 4 .wfgjlsu.uu4.f1UlY15LL1Ul4JJ-U-UIJlUJl0-U-LU-Ui'J-P!U-H41114'-'Que-Q4',QAQ3AL!L'-lL44,iQ4lQ!2235933LLQQ4-QLQQIE4YiUi!3:ML'Q!!Jfill-LLB? V .4 'Q .5 E3 FIX P+ X ' GR-fXff5Rf"'?,55H if f f- 3' EQ fl E '...4 4 45- ' ffx 1.-- fx Xf X X Q 4 24 QgUlM'l'g4LEl'l-VKIIF'HWY17'YYLWLWYIW.H 1 UTUAI-YKIVUJQUVi'S'XAl'Tl'!Hi'iUfll'V!'l UW'l! f3'?!7 5'?VWKVZ WiA5 ff'EiA?5'!?f5 i.53PiikillnilA9glk !lU'l'Ufl I UIWIYULLUI 7 J ' ' 4 El 4, 4 5? 5 4 Q E 4 CTX 4:- E' 'U I 4 ' 4 E 4 f 54 4".g A X., 4 fl -X,!'7g. 4 X f 4 5 L xi XX 5 ,J W ' 4 4 xi 1' ' Lu , .Ml 4 I, EE 4 E! 'fl N, 'Q' 454-51 4454 45 N 4 3' fr' Hifi 4 F F! - R - 6532 5f?73J3,Ln,U14i.u,4J4L4J,J.U4-lJuhlllifiUVUJQMLU-'llillillil!!UiUEQJJU-'LU-'lil'-QLLLLLF-lL'fgggf!4i'-E-43'!gUJi4E-Ui'-ULU1-Wblilllll'-UU-'El .5 EZ' "M""7'4AmWm, , 4.--fxx, ' 4 - 4 4, ffs 4 4 M !E4g' X f F4 A, K piggy 44 XM ' ka ff X 'N 'VM inf!! Q? NR 3 x5fg.J XY-ffl CF -' I ' I: X-flku Q ' '-N wb Xf, Gfx g , ' V Y f V V f4l1'5ffjjf fffggmfjg ' 5 A 4 ' 4 ' g4'g g 4'g ' E'B'5 wl"l4E1B'8Ml'UHmi mile' 4' 4 FbM X EE WKfEMAi'P4B'U4 4 4'4'4'm m"m W H QAEAf i f5AkF 4 LAh 4'h'A't ew 4A4'414'4'4 5 EN ', 1'5't5H n'f4'n'4'4'rf4A4'4'm4'4m4'UaArUQmT44'4DJJ'4'4A ' ' 'Y' TFT" IJ 33 2 , 'ff 'ax Ii. ,-xi. g , i 1. f-T aria' -1- vac. me are,n5 deff ,M R... A A, , cc- ,C i. l-i1 M-X X' Board of Coaches With new coaches, new facilities, and new material the University is beginning to "perk" up athletically. ,A revival of spirit is beginning and, with more of the incentive given by the success of the teams in basketball, track, and cross country, along with our infant sports-wrestling and tennis-we should come along fast. Our coaching staff is high class and of the type that can be relied upon to get the men's utmost. Coaches Heers and Seidlin are both of pleasing personality and in addition have a fine knowledge of the sports they lead. Lampman, in charge of cross country, has fproven that lhe is a worthy successor and student of "Doc,' Ferguson by the results .obtained this year. A State Conference Title and a Middle Atlantic Championship are conclusive proofs that he is successful. As more material aids in athletics we have the newly-graded and surfaced Merrill Field with its ine equipment. A bit more of conditioning, and the track and Held will be in tiptop shape. Davis Gym is still but a potentiality, in a measure. The basketball court and indoor track are but a small part of the fine plant soon to be constructed. A complete athletic structure with dressing rooms, showers, girls' basketball court, trophy room, and offices for the athletic department is the dream to be realized in the near future. It is planned to have the laying of the corner stone during the coming Commencement Week. x i iq 'V Y' ' ' "ff if iff ii' K if i --an Y -V Yl,Y lgigfc .,1, V41-Q .4 744 'J-Q' :Ac f A, ir One H und-red F ifty-five 2 --- , - 242- fear 1 v 4 -we Jaffe -. .,,- .fe,-2. ,.a.l ,,,- .f-Xe.. .f ffi.e I I, Q f - - A1 1 1 N ' ' -9 3 . -f s tv I I NM? 4? 2 A gcaa 1 "Thr-fig? P ?Ww, 'W r ac l l at 9 fl , .ff iw-. A7107 4.92 . :- , 'Lk -ff ff - 1 0 :- I., .g..,q,,ff..,f 5 ,vf af Q --at 1 .., - "Mf2?4' . 41'f " ,,i2,f' -'S ?2fi3'?S if-ff 1 wrffs HOLLIS HERRICK Alfred's Greatest,Harrier Records Created by Hollis Herrick 1 CAre Words needed to show his greatness 1924 Syracuse course record Maine course record . . 1925 "'Van Cortland Park course record .A tMiddle Atlantic States record . Colgate course record . . Alfred University mile run . 1926 Middle Atlantic States mile run . Middle Atlantic'States two-mile run State Conference mile run . . State Conference half-mile run . . . 30.31 26.37 31.29 31.29 25.42 4.26.8 4.26.8 10.13.8 4.36 2.00 Also in the Indoor A. A. U. 2000-meter run at Buffalo, he created a record of X 5.13 and nearly lapped Johnny Bell of the 1924 Olympic Team. M 'Records broken in later races . y AQ. .X-r ix-cgifR:1,,TcXQg'f-cg 'fa -xxx y .f4.e .,2Qi5WNEf- fLuafarda.A,ff.fa1y- . sefr .,4rQ?221giiQCQIEQEEQZEKTLQE5mxrjgl One Hundred Fifty-sin: ,A N 'N 'WN A ,-, ,ig ,T - g , tn. A 5 gi A., 2 . xtkv , A X 39- MW' I fp x aim We 'R WSW' M S ak? ca A . Q i W 22. X ,G Aw we Q 'ws Ei V-1 5 7' 1 X 2,4 tif " -5 " 51. fs , 1 ,,,,, - , J! f2."g1-' j. . ' V ,. RAYMOND C. FULMER Captain of Football A Football SEASON OF 1926 In the light of games won and lost, the season of 1926 would seem of rather a disastrous nature. With but one victory and two ties, there was little cause for jubi- lation. However, other things must be considered. The team held its opponents to the lowest aggregate score made against Alfred in years. Coach Heers has begun a process of upbuildingg the boys have been taught a new system of play, and need but polish and experience to show good results. With a squad composed almost entirely of Sophomores playing their first season of Varsity football, there was evidence of strength in the group and, with the improvement to be gained with experience, they should make a fine team the coming fall. The team could not be said to contain any particular stars, for every man as he was called upon gave a creditable performance. Of course, some were brighter lights than others. . We lose men this year and they will be missed, but other good men will be work- ing to ill their places and will undoubtedly make a good job of it. It is to be hoped that with the added experience of a season's play, and with the good men to be gained from the Frosh, next year's team will not falter and lose confidence when in scoring position, they will have the necessary spark of power needed. , 44' i a r fa r . O One Hundred F iffy-seven , - - uf.. ' Cf., El, - ' ' ' 7: ' " .. ' ., -K , . 1 A , - W , - - ' A G YY -1 A . I f ' 4- ' ' 1' ' Q T . 1 U A ' U . 1 Y - Y ' V .' V lg ' -' .4-,f f - ki ' ' ' V - A x ' " 7' E. LEBOHNER Manager The Games CLARKSON TECH 6 ALFRED 0 Playing on a slow, wet Held that made good football impossible, the Purple warriors lost their Hrst gridiron tilt of the season by the mar- gin of two field goals. Clarkson outweighed Alfred and kept the ball in offensive territory most of the time throughout the game. O'Hare, Clarkson,s quarterback, drop-kicked a "pretty one" in the second quarter and repeated this on the last play of the game. Haskell, of the visi- tors, gave a wonderful exhibition of how punts should be run back. ROCHESTER 6 ALFRED 0 Although Alfred outplayed the Yellow-clad men the major portion of the game, they lacked the final punch that scores. Alfred presented a stonewall defense on running plays but were un- able to stop Rochester's aerial attack. Davies' team scored after recovering afumble on Alfred's five-yard line. After failing to gain on two line plays, they completed a pass for the score. This loss was especially disappointing in that it was to a markedly inferior team. One H unchecl Fifty-eight . g fri N or-fgp-V as A A 5X,a A I f' f N A g in gr, g gg r c ,ffm ,g- JUNIATA 7 ALFRED 7 Once again the Purple and Gold gridsters demonstrated their superior ability, but once again they lacked the Winning spirit, and once again they succumbed to a fine aerial attack. Alfred scored early in the first quarter when Fredericks recovered a fumble on the ive-yard line and on the second play carried it over. Fer- ris kicked the goal. In the fourth quarter, the Juniata boys opened up and showed one of the finest passing attacks seen during the season. The net result Was: Alfred, 7 3 Juniata, 7. BONAVENTURE 22 ALFRED 0 Againsther oldest rival,Alfred's eleven played its poorest game of the season. The "Saints,' drove through the line, skirted the ends, and completed passes almost at Will. The Alfred of- fense Was pitifully Weak and the defense not up to standard. Bonaventure scored a field goal in the firstperiod and Alfred Wilted. The Purple was saved from a more overwhelming defeat by the penalties inflicted upon the BI'0WI1 and White men for rule infractions. -fif- V. be if -f . f. it-. -43 '- J 'H '5agMy'i,gi ..: -YVV W 9 --,3j"'f: in 7. One H undred Fifty-dine Fiyf, '--v-"--w-. 4 . , ,I . ' 4' 5- , - K Y3r,v .,5 .ry - iv' X. -.V ti H L .A 1 1 2 1 ff, . f Qu' ,-.,,,v'-'S-.N 'H'---..,4 ,, A' , ,ff:'saMjjQ,,-r-- , f. '- ' , ' i ' ,...,,,.f4f'gYQ Nl." A - . - Um' IIIIIIIIIYVI Sfmly BUFFALO 0 ALFRED 6 The score gives no indication of how the Purple outclassed the Bison City lads. The game was played almost entirely in Buffalo territory, but it was not until the final quarter that Alfred gained enough drive to carry the ball over the line. Alfred had no trouble in breaking up the Buffalo attack. Gains were made for the most part through the line with Fredericks and Gard- ner carrying the ball. NIAGARA 0 ALFRED 0 The dope was upsct completely in the Falls game. as Niagara had takcu Buffalo by a 60-0 count. and wcrc ratctl thc lrcst tcam in the Cou- fcrcucc. '.l'lic boys in Purple wcrc lucky iu hav- ing a wct liclml. as tlic fast and sllifty Niagara backs could not gct startctl. .Xlfrctl playcd one of tlic ln-st clcfcusiyc QIIIIIUS of thc season and took :ulvautagc of cw-ry lu-calc. 'l'l1c supcriority of Niagara was apparcut. but thc hard tight put up liy tlu- .Xlfrctl tt-am prcwutctl a scorc. N-XA ' v . I y. .. ,, A . in it it 4 .. ' ' f Vli f i J 5T" '. ' f,.. 1 - ef c A s- at I Y A ee HOBART 18 ALFRED 0 The score of this fracas should have been re- versed, as the Alfredians outplayed their old rivals throughout, but the veteran squad from Geneva had the "breaks" Three times in the first half the Purple drove down Within scoring distance, only to be held for downs. The triple reverse of Hobart was the strong offensive weap- on and Was used with telling effect. Fredericks made a few pretty runs for Alfred, While both he and Lanphere played strong defensive games. PROVIDENCE 14 ALFRED 10 This Was by far the best game Alfred played during the season. Playing mediocre football throughout the first half, they trailed the Domi- nicans 14-0. After receiving the kickoff at the beginning of the third period, they marched the length of the field for a touchdown. Providence kicked to Alfred again, and for the second time a march was begun. Providence held on the twenty-yard line and Ferris booted a drop-kick from the thirty-yard mark. No further chance to score presented itself and the remainder of the game Was played in Alfred territory. For the first. time in three sea- sons, Alfred scored after being scored upon. l l l ff 'lew flii f f. , - Q 4 is 1 '43 V 'fgka M? , Y aa Q. f .W xy ff ..-.3 . 5 ,I . . 24 .X-as ev aw. ,N ff, .gi N .-. A' -.Qty l wr r f' x X K 4 . .. . ko 2, xx in M ' , 1 , Q t . ms Z l N, ,qs T ' S 5 , K Y- 4' 7 if Y , A ic' , fc., 'X Q , , x , Y QQ A li V One Hundred Sirvty-one C f Xbfanfnen-Gem -:es-we i f Q1 4 f' no S 5 l 4 r 'x 1 1 v 11- Q l ,xg 1 l P f f r fi liar ll QQ cl 1 i ,.,1 -mf ,,f1 ' ,A - ..f ,.,. .. M, 3, L Q -'rw' ,- , s'.. ,T Q. Q . rw,vv,.wu:"1i9' 2' 'fr P,.v!-f'.- QM . iff 1 1 , ffc 0 , yr 1 L' , lf! f , af N , f af ff T2 'V i 4 c ff ff A .gy f-f A 6 " ' 292'-v : - - .-K, 9... ..,fw-31.73 f 1 . v . .if LZ. " -- 5- -gg 'f 4 -Q K ' 11 ,. 2 - . .,ja...a' Zefmsi-Q,-"j ix ,Pg---1 - Q , 7',j:,,lqf fig, "if ' N., 'NM-xgf --Mn 4,,--A-, ,ya .Y , , "'-g.- KT"""'r-.. "--1----. q ff N. ff- yif X qvf' 7 9.--H Jw , 41. e'J",f-fe . f "1 . . Nady ,ww , M,,..,-V. 1 0710 Ilumlirml S1'.1'ly-luv, fm-2 Z f f ,-.,-,-,:f ,, , , ...,,f, ,fr ., . ,, ,, ,Y Av. ,Y - .72 1,-gy ,. ,Inf SUSQUEHANNA 12 ALFRED 0 If the game the previous Week was the Pur- ple's best showing, the Susquehanna tilt was directly the opposite. Part of the blame can be chalked up to the fact that the trip took twelve hours of continuous riding in a bus. YVhatever the reason, the team had no pep and showed no semblance of the snap a real team should have. Susquehanna presented a light, peppy team that gave evidence of knowing football. They scored in the second and third quarters on runs of sixty-five and seventy yards, respectively. 1 I 1 , , 'ff f N A... -X W, .. . N r l A JJ Mavis ---4-1-Zi. .E-fSff'ifQ.f.fi" - 1' 1 t X f o , ,.A, in , . ,, ,,..,.... Q - .W. .......i .. A Ji- as 1 fl. lvl I ll 1, 5 li 1 f 1, J ,l gl .lf M214 ill M N Ml lx f ll al l 4 My My 1 lj ul fl A . n 1926 Football Squad fl A SEASON 'S RECORD . 1 l Clarkson Tech 6 A. U. fl 1 Rochester 6 A. U. fl Juniata 7 A. U. l' if Bonaventure 22 A. U. A V Buffalo 0 A. U. fl Niagara 0 A. U. qllw Hobart 18 A. U. A 1' Providence 14 A. U. A Susquehanna 12 A. U. l, 1 l will 1 lp -l lbw ' X-1-7 T-Q' 'Xc.xC Xc,xq'x,'xQ -' -lglt jr TQ. ,,,.a,.2sz2g-- if 11,4 One H zmdrecl Sixty-thfree 1 , W , A f'--H- ..? -- ri - - M-1 -jj'-,. D ab ggi: Q4,,,,i ,ig W., -ff-N -.M--PM MW. -wmg -W.-5. q.---. ' W A iw V' , F 1 Q , 1 ,V g N K ,fi 3, W N fx- 1, 2" 5 , 1 1Ll wi X N A 1 i ' s N y . X f r 1 'A lb , 1 ws!! , .t I lx XI X lx QQ M J . ' 1 4 33 :J Y '5 N ,7 MQ X 1 'N f H VF7. 5 Z H 11 f' 1 I I W iw J r X4 ,J I 1 ' My XN9 in 1 5? I Mg fi Ujjr li. P5 UU , a! 2 ,QQ ,JV AN S fir 1 . , A, Q my . X 'X S LVM fg ,A 'gffjx t " ff Vw e Um: llflvmlfnvl HI..I'f'lj'.flIIlI' 1 I -L 5 V 1 .. -X.. NN5-. tfiffi .A" 'lffflit if f' 51, 'J"T,.5.L.. an 5571, Saw.. 'P' ry V ' r K A 5 3' 515 W fi A' M r K F . Q A ' f A 3' I EIA M YSL .r 5. XY! Fr IW ,ia ri i b Q A W rs A . 5 1' . ' 15, Q! N 72' 'ft r 'rr . V 1 ' 5. N f I I N Y wi ,. 1 4 1 fr w A r . 3 4 1926 Cross Country Squad tt .X XA A r SUNINIARY OF SEASON M Y Low Score Wins A A , . + 1. Hobart 40 A. U. 15 jk 4 Q. Rochester 38 A. U. 17 A, ll' 3. Bonaventure 26 A. U. 29 A A 4. Bonaventure Q2 A. U. 33 . A 5. Colgate 35 A. U. 20 'N A 6. N. Y. S. C. C.A.A. A. U. Q0 f A V Capiain elect r A' t 1 or A W W v at K! ' "W 7 ' Y f ' xc if - X: ' 1-t i '-C , if Y U 5 v -S, f ,gi , ,,,-QL" ,f-L' 4 ' 5 - V One Hundred Sixty-five jf. A WARN Rex- X,flv,x Y. 'rg ,., .27 ..f , --- .im-f , .- -.f -- Y 1 g 1 Ono Ilmulwzd S'!.Ilff?j-81.117 315. A I ?1fss5u'2:ffLf' rfeL53Tf1+e.-isle ' . ' ' 'INF' 1 yi HOBART RACE final The Alfred Harriers showed that they were the 1926 cham- 2 i pions of the M. A. S. C. A. A. in their first race of the year when hly i 1 at Geneva they turned in a perfect score over Hobart-15-40. . li Running on a fast and strange course, the team gave promise of A possibilities which they later proved when four Alfred men- el Keefe, Boulton, Ladd, and Getz-finished in a tie for first. P' Captain McGraw and Coe appeared next, running at a pace too li i fast for Meyers, the Hobart ace, to gain on them. Meyers was . hard pressed by Witter and Reynolds who tied for fourth. . Beckwith and Rockefeller were given fifth and sixth places, respectively, and finished the Alfred team. The time of 28 min- Q 1 I1 l utes, 10 seconds for the four-and-a-half-mile course was as fast ' g il as could be expected in the first race and over a flat, strange 1 AI C0l1I'SC . L or ROCHESTER RACE 'L 1 The race with Rochester was the first time the team showed p y il its real balance and strength. Brown, Boulton, and Ladd tied l i for first with Page of Rochester some distance back of them. Getz and Voorhies then scored in a tie for third. Captain McGraw, closely pressed by Browne of Rochester, finished in seventh place. Reynolds and Coe were the next men to appear and were chalked up for ninth and tenth places. Rochester had ' i r i a team of unknown quality, for this was their first cross-coun- it It try team in years, so Alfred went out to run a fast race with a 1 result that sent their less-experienced rivals home with a 17-38 l defeat. . A BONAYENTURE RACE AT ALFRED fl St. Bonaventure, with three stars and some runners. are l credited with the honor of being the first victors of the Alfred A 1' ,ll quintette on the home course. The race was at grueling run, lasting 39. minutes and 10 sec- i onds. Boulton led the pack for the first two miles and then bfi ' Ladd and Getz moved up front with Bell and Gregorie close on 4 N I is their heels. Moore managed to strengthen Bonaventure's scor- 'li l I ing power by keeping well up front. For the last two miles. the 4 - F1 Alfred Harriers did their utmost, to overtake their opponents, .qi 5 but it was of no avail. Mueh eredit is given to Ladd for his ip ,ll valient attempt to on-rfukf' the Bonaventure trio. as he passed Moore and pushed Bell and Gregorie to a elose finish. ii The St. Bonaventure team was made u i of some of the best X l l 3 , opposition that Alfred has ever eneountered. lt was eomposed of John Bell. State two-mile champion: Louis tiregorie. NR- if 1 .it tional three-mile ehampiong Gus Moore. National sehoolboy 12 miler: Brennermau, t'hautauqua County eross-eountry eham- ip A piong and Frank tYt'onnor, St. .loseph prep. tlash. ,li .EN Q A ,E 0 uni? . 2 f 4 if 1 l V. I 4 l I 'lfifl BONAVENTURE RACE AT BONAVENTURE N The Alfred Harriers forced the St. Bonaventure runners to l tl. jg run the course in the fastest time that had ever been made on ,xx if that course-27.1-cutting almost three minutes from all pre- il, 1,45 vious records. I l l Tl1e first lap of the race was run about evenly, but at the l ', B start of the second lap the Bona. trio took the lead and, in spite l of the opposition given by Brown, Boulton, and Ladd, man- l' 'i V aged to hold the lead. .p Boulton led Alfred's scoring power for fourth, fifth, and sixth ' V l places, supported by Ladd and Brown, then Getz, Hghting hard to take over O'Connor and leading Fitzgerald, Enished eight. H The new record equals an average speed for the five-and-one- half-mile course of a mile in 4 minutes and 48 seconds, a speed of nearly thirteen miles an hour, which is relatively equal to the 4 i Alfred track record for the mile-4 minutes and 26 seconds. A L 1 n COLGATE RACE , 4 On Home Coming Day, the Alfred Harriers defeated Colgate 4 with a 20-35 score. Clarke of Colgate, a former interscholastic H l star, was the first man home from the cold and snowy course. Q He covered the five and a half miles in 33 minutes and 40 sec- A A onds, which is fast time for such a cold day. Boulton, Brown, and Getz tied for second place, and from all appearances the A "Three Horsemen" could have taken first but saved their ll strength for the N. Y. S. A. A. meet at Hobart the next day. H Running in a bunch, Coe, Voorhies, Ladd, Captain McGraw, Beckwith, and'Reynolds gave the crowd an idea of the team's l wonderful balance, when these six' men all tied for third place. 1 Every man on the team was apparently fresh after this race, for they all were holding back for the championship race the 9 I next day. This race was considered by the team to be just a l fairly-fast "work-out", and it proved to be all of that, for Col- lw i gate had a stronger team than last year. , NEW YORK STATE CONFERENCE MEET 'Q On November sixth, the Alfred Hill and Dale men showed l their heels to the Harriers of Rochester, Hobart, and Hamilton f Q A over the Hobart five-and-one-half-mile course. Ladd of the 4 Purple and Gold aggregation took individual honors, winning l the race in the fast time of 27 minutes, 10 seconds. Boulton, l l Brown, Getz, and Voorhies, in third, fourth, Efth, and seventh f places, respectively, completed the scoring power for Alfred. l The team finished as follows: l Alfred 20 y l University of Rochester 53 + Hamilton 76 , Q Hobart 30 l l - 1 .1 L - . l " -rf' 1 f '-C xr, Yf"f ' ,x':'f if 'ff-4 'C 54' XC .' ' v s . 4 f' .ae A4 ,4 f J. A A? One Hundred Sixty-seven 1 ' t t V J l 4 Tl I t t 4 1 l 1 l l 1 l t I 1 l I f t t f .1 .- 'L t yt I . t I, 'I ,. t it t 4 I, a P t t 1 ffx X77 Ns-'TX if is . . .1-sa., ,,:,i,9,,,,.,-1---...,iM11A+ .141 f:""'-s !- sxxxfe if---ffrigl-V-':i:iQ"'i Ynffliiir it s5ff' i'-ffl X I!!! K nf-fs-f 2 . t t Q . ' A t t , yf r fi t ' V l' 4 If i F , ti V t 1 Q 1 'it l . A. . oint W mners The Middle Atlantic States Cross-Cotmtry Championship at Van Cortland Park, November 13, 1926 Once again the Cross Country team has brought great honor to Alfred by winning the hliddle Atlantic States Cross-Country Run. ln this race Alfred again demonstrated its wonderful team spirit and ability to come through under almost unsurmountable obstacles. The team pulled to the fore at the one-mile mark with Ladd and Getz running stride for stride. Edwards of N. Y. U. was a pace behind and was closely pressed by Boulton and Brown. Boulton then took the lead with the rest of the team bunehed at his heels. At the three-and-one-half-mile mark he was "clocked" in the remarkable time of 17 minutes and 11 seconds. Edwards, the Heights' colored ace. seriously threatened to take the lead several times. After that eventful second lap, in which the team gained a great lead over the possible individual winners, they ra.n fast and cautiously, fearing a trick from the Union team. Gwinn of Johns Hopkins passed through thc team in the final lap and sprinted to a. glorious finish, hard pressed by Boulton. Getz and Edwards furnished the spectators with many thrills when sprint after sprint was attempted by both runners to determine third place, with lfldwards finally taking the "Dutch" boy over. Brown followed Getz with a pretty sprint in which he drew away from Sames of Lehigh and Johnson of Union. Ladd, considered by most sport. eritics as a likely individual winner. came home ninth after showing his heels on the home stretch to 'l'otten and Meliel illen who were also favored to win the race. McGraw, running his final raee for his Alma Mater, erossed the line ahead of hladeau of linion. Although four of his team mates had finished ahead of him. it was npon the fifth man that the scoring power depended, and Mae certainly displayed his "old fight" in eompleting the team's seore and closing his career a runner. Coe and Voorhies. Mfretl's sixth and seventh men, were handieapped hy lack of experience ln big races, but both hid fair to be strong eontenders for ilu- team next year. 'llheir positions CZLH glVC H0 ClllC to the running powers they possess, and we walt-tt with interest their development. One Ilfzmrfwfrl Sfzfrzrly-wiglal l Q 4 F -1 ., it i'--x sl' 56-I . X , 151: Q " Q sb' S' .' , f 1. 4 C' N l J Q-V l - ' V' 1 V KENNETH NICHOLS Captainof Basketball 1 T bl f R 1 A a e o esu ts Opponent Alfred Rochester 63 16 Susquehanna 020 . 28 St. Thomas 42 22 Muhlenburg 21 , 24 - 4 y Dickinson 34 32 ' 1,1 , Niagara 29 26 2 n Hobart- 39 33 fg4'ff"' St. Bonaventure 28 19 'B 4 Niagara 30 24 - ' Canisius 47 11 Buffalo 41 10 Q, 4 Rochester 40 3 27 f l Q Clarkson 30 44 l Canisius 23 22 t Syracuse 56 23 l Hamilton 32 38 I Q Albany Teacher'slCollege 29 23 , ' Clarkson 24 31 1 Q St. Lawrence 31 25 , if ' " ' ' St. Bonaventure 27 20 gi' Hobart 60 50 3.. 5' 6 3 4 4 H he - Ne 5. Y 3 One Hundred Szxty nzne ff f em 1245 lfllj M 4 ke 5, eil K 5 I ft x - f ., f f - "A -. -4 yi, ' .1 I , QQ -e ,Q--C 'Lf'-fag Y 117 Vij- - L 1. 'gym rz,-. 2?-W 3:-' rs.,-r - Q - , V- vwffl- - -W 1 A, 7 l 1 . are ,Z v e"t:....:X .Q 1 ' ' i' ggi- f at . .Q , .lc . Wwwmwax X Q, at ,- hyat 3 ,, X -, A V., M , 339 64221 Y' 12.12 A ., 1 1, f l ' y..Q ri...-.WNK ,-,,.,---...X md..-es.X -M 'art'-f--.QT --"fry Q' --9---rj' -- i,,.-ff..---flL"2:.i51.1w"TZ--' ,J--" 1' N---1-eff?------x"--4 if g.. --' One H undrccl Seventy Captain Ken Nichols was the same old imper- turbable, calm, 3-:agle-eyed player with whom we've become acquainted in the past four years. He has scored one half of the total points this season as well' as acting as a steadying influence when the going got hot. We may get better players but we are 'hardly likely to get one with a keener shooting eye. Fenner, playing his first year on the Varsity, made good from the start. He was the hardest worker on the squad and is an example of what can be gained by perseverance. He was a tower on the defense and a continual threat on the offense. He was the pivot man in the offensive work and could be relied upon to be in the right place at the right time. As Don is but a Sopho- more, we can expect two years more service fromhim. ' As a fit running mate, we find Lee Cottrell, the Brooklyn strong boy. He came out for bas- ketball at the start of the season and seemed to take up where he left off in football. His aggres- siveness on the football Held was displayed on the court, and while he wasn't heralded as a coming star he proceeded to show that he has the stuif that makes athletes, and landed a place as regular guard. Lee was not outstanding, but whenever the game was at its height he was found at his best. More will be hear of him next year. . F oti, the lone Junior on the squad, lent his experience to the team and acted toward balanc- ing the outfit. He was a fighter and kept the boys passing as they should. It was, however, by his guarding that he helped most. It took a fast and clever man to get by him for a score. 'f+-. .-V-1 ----N. .,...---, ,,.. .. , -M -,.- -. .- --X .. f - , - . , -: , h J -. , -- X, up a --, . - -y - . .., V i M -M r , , .N RR ,.fN,-fffwtx 1 f Q 'Xffxx It 'S' 4 'fi ' ' ' T2 K, if, "nw e -'-"' ' "N, --'r' "'f .V -'4'-'X,."'i,f"'7, ' fx "MX . A X, , , x X . ,Y ,V 4 nn,-. Q. b, X, L gkfjxxx , ,-. Y cg- . A xx' WXQZ X XXX Qi! xXfx:xD!,yXA::,L'.:5q 'xt sq ,X N if Larson is the kind of player that comes with- out advance notice but shows by his own work the kind of man he is. He isn't of the flashy type but plays a consistent game with constant im- provement. At the start of the season, he saw but little service and showed his game late in the year. He has a keen eye for long shots and with more experience should be a great asset to next year's team. Hulse, the diminutive forward, was of the flash type. Once the ball was in his possession, action could be expected. The fastest man on the squad, he was an adept at dribbling and de- lighted the crowds with his footwork and basket- shooting. His speed more than made up for his physical lack, and he could in a pinch be used as a guard. Walt captained the '29 Frosh team and was not an unknown quantity when he reported to "Dutch" Heers last fall. There was but one man on the squad who had not played the year before-McMahon. His activity during his Hrst year was confined to intramural competition, and as a result he got a late start in Varsity play. He was lost in his first few games but gained theneeded seasoning and clinched the center position toward the close of the year. He has worlds of speed but as yet has not acquired the knack of applying it. If next year sees as steady improvement, watch for Mac's name in the paper. I 1. w - l A' p si. l l lk l 2 li l ,N . ff. f, , . , I '1 i ' 'gfpisi ga, gf b if . 'Y 'ff 24i? 2n -.,,,,,.': , A l 4- , a -5 X . 4 r . 4 .- g. - I ff '-Q' X1 xc I ex Y 4? ,- ,iw Y , -,- X , f if , Qu if W ig ,-r Ac ,-- ,, ,,, ,s ,2:bf2'X J H e are c Y I ji V Z-Z ,cw Jaw ,- W . . One H undred Seventy-one l ,Iv ji X n is I", I , , , . V . L 'VJ V M , 2 il af- . 4 -W V 3, ----1 fx Y. f--6.7--e't' f'46i ,QQ If, Qjlii,-2'j1.1'r+1v:?l'f'jf?7' ' Ars. ffawf' ns ' a 1 r .,p lx 1 if , M it lf he i tll i L, Ep . rl l 3 i M li "i 1 ll rl tl i i T ir ., ll ' W , W i My . la by . V V A Y lil A , i BASKETBALL SQUAD i I ' Prospects for Next Year Our greatest possibility for showing greater strength next year seems to be in l V p . f basketball. Like the Cross-Country team, our court outfit was composed this past p V i bl season mainly of Sophomores. They could put a complete Varsity team on the floor l and have two additional men as substitutes. Both regular guards were second-year pf , , men and played every game. With Hulse and Larson to help on the forward wall, ' A y little can be wished for. McMahon will give any man a stiff fight for the center rl l position next year and is almost a certainty for a. regular job. Ki, r Q . . . , W is tl In addition to this we shall have the group of six footers from the Frosh team. A ,ffl 34 These boys are clever as well as big and play a fine brand of ball. They snapped the j Jil 5 undefeated records of both Westfield and Greigsville high schools and denionstrated +A lx Qi clearly that they are more than ordinarily good. There will be an exciting tight. for 5651, gl places on the squad next year when these bo s trv to win berths awav from the older tl Nfl lp' ' y ' ' l 'V il, players. ., H ll ft . 'l N Ili l With all these men, the coach will be in a, position to demand more honest and ft greater efforts from his teams. They are a steady crowd as regards training. and as if Ri yl they are almost without exception fine students there is litt.le danger of losing any Mfrs because of scholastic difficulties. The schools 'that have made a. habit of winning will XX X ,gl be due for a surprise next year if we are al all good at reading signs. T il . .".,l - ",ts , 'gym ,.1V fgnjiglezifiaf '-.w h iljilfifr ,.Yl - w-I. qi. iv. M. 'VCX One Hufr1,rl7'c1l Scmmly-hoo . i 'N X1 'A . V -5-A . . ln 1 I f J"""""""---J"-"---X ,,.-.,., M , ' - V w. I .. -1 ,K ,flfly-,,,n gf"LGj' ez!-psfwifu-Xaty--eg , . ' r ' 'f ' ,Ng-M--w',.e...a..-H-j.,d' ' L: wo-f yfu4""' - if", 'f , rf 1 3, -..-,.i,fgA,,,..f'-ee Ah... . ,V Ya 'I'-"' ' 'N l ,X A V- E 4 flu 'tax - I li f . xp 2 si E Q w ft l, 5 p r I W N xl'S 4 E I nl xr N ii l X l lf IX' r A ppl r' ll ' ll 1926 TRACK TEAM r lf il v ' 'V la 1- . l 1 c rl A Chester P. Lyon l .W AV V pl, In Lyon, Alfred lost one of the most outstanding l 1 men that the University ever possessed. Here was Wi A l lp one man Who had the time or ability-Whichever A it is-to excel in every form of college activity. As if: a student, he kept an unbroken string of A'sg as a r 5 lr gl pole-vaulter, he established one of the best records f l We haveg asf an office-holder, he was extremely ' l R . it it . ' activeg and as a gentleman, he was exceedingly l if li A A popular. We miss Chet, but We have already dis- l .i lr , covered that through his sincere loyalty outside, hx A A CHESTER Ly Oh other good men have been persuaded to turn their r i, 5 Captam 1926 T rack A A steps toWard.Alfred, one of Whom may ill the place A I lb li WALTER GIBBS 'YJ It Captain 1927 Track that he left. f 2 A All . , .5 ! t ,-KffgwNC-qf1q"mmq jk!-gw 'iyxaqffr'-to - Rf' 52X Yi .x'f. 4 q f . ' fy 'N' ' ' One Hundred Seventy-three Cie, .1-.g WJ- 1 - fa..- , - Q' Q, 'Y' A-G ff fffr 'jg' fe 4 1 'V ALFRED-ST. BONAVENTURE DUAL MEET 100-yard dash 120-yard high hurdles D 1. Summerlee CSt. BD 10.3 sec. 1. Gibbs CAD 17 sec. ' ' 2. McMahon CAD 2. Fredericks CAD V, 3. Coffee CSt. BD 3. Kenneally CSt. BD disqualified 220-yard dash 220-yard low hurdles M 1. Surnmerlee CSt. BD 23.4 sec. 1. Gibbs CAD 28.1 sec. 2. Coffee CSt. BD 2. Barr CSt. BD 3. McMahon CAD 3. Fredericks CAD .MO-yard dash Discus 1. Lovey CSt. BD 54.1 sec. 1. Tate CAD 109 ft. 4 in. 2. Lampman CAD 2. Gavagen CSt. BD V 3. Coffee CSt. BD 3. Klinger CAD Half mile Shot 1. Herrick CAD 2 min. 13 sec. 1. Bodosky CSt. BD 37 ft. 11 in. D 2. Brown.-CAD 2. Gavagen CSt. BD 3. Mifcevic CSt. BD 3. Lamphere CAD X 1 Mile Javelin 1 D 1. Getz CAD 4 min. 47 sec. 1. Kenneally CSt. BD 141 ft. 4 in. SX Herrick CAD 2. Kelley CAD 3. 'Brown CAD 3. O'Neil CSt. BD 1 ll Two mile High jump D 1 1. Bell qsr. BD 10 min. 29.8 sec. 1. Gibbs my 5f1.sin. D' 2. Ladd CAD 2. McCabe CSt. BD 1 3. Boulton CAD 3. Lyon CAD Broad jump Pole vault 1. Stuart CAD 21 ft. 2M in. - 1. Tie between Lyon CAD: Kelley 2. Surnmerlee CSt. BD CAD, Nellis CAD and Klinger 3. Kelley CAD CAD 10 ft. 6 in. . I A ALFRED-COLGATE DUAL MEET I - I ' 100-yard dash ' Two mile 1 'l 1. Charles CCD 10 sec. 1. Rosa CCD 10 min. 12.6 sec. ' 2. Fink CCD 2. Boulton CAD ' 3. McMahon CAD 3. Ladd CAD 220-yard dash 120-yard high hurdles I 1. Charles CCD 22.2 sec. 1. Long CCD 16.4 sec. 2. Fink CCD 2. Gibbs CAD 3. Rimmer CCD 8. Granney CCD 4.40-yard dash 220-yard low hurdles 1. Van Horn CCD 51.8 sec. 1. Granney CCD 27 sec. ' 2. Lampman CAD 2. Long CCD 3. Simmons CCD 3. Fraiser CCD lf Half mile Shot put 1 1. Granner CCD 57 sec. new Col- 1. Short CCD S9 ft. 1 in. 'X gate record 2. Tyron CCD 2. Herrick CAD 58 sec. new Alfred 8. Hedeman CCD record I No third A Mile Discus l . 1. Kreahl CCD 4 min. 36 sec. 1. Short CCD 129 ft. V Q. Miller CCD 2. Tyron CCD 3. Getz CAD A 3. Tate CAD ,f Javelin High jump C 1. Hedeman CCD 148 ft. 2 in. 1. Staiier CCD 5 ft. 9 in. Q 4 2. Kelley CAD 2. Gibbs CAD L 3. Conners CCD S. Fredericks CAD fi A Pole vault Broad jump ,f 1. Tie between Lyon CAD and Nel- 1. Stuart CAD 21 ft. 1 in. ,iD lis CAD 11 ft. A D 2. Hammer QCD 3 3. Tie between Kelley CAD and S. Fredericks CAD ,l N ki Wesney CCD ' 'Q Lyon jumped 11 ft. 11 in. for gl ' new Colgate record It ,gl 1 '1'o'rALs D D Colgate 8716 points Alfred 3715 points 1: fl Ml rl DI? ...cdr 1 -1 - - il Yrffii 7-128 :TQ-5 --xl f---Q -N-E Y A One Humlred Seventy-four , v" 3 f XV NX W 1 I . WS- 47155 ' 1 4.2 A be :.'f'.11w-1 1:z'2Iiff1f11fr:i1i: -fM' Q, 1- 'A D A.- H1 e .. ,Ab , 51 1 ,, ,lj ' "Y ' --f ' '--' - gf-4 - H- 'j Y ll 1 .l l Y . YD 1 C gl Ir CJ . 1 fl . . - ,J 1 2 lr 'H vnu! A 1 l !N V" NEW YORK STATE CONFERENCE ll DN 100-yard dash Mile A J A V 1- Keller ist- LD 10 SGC- 1. Herrick CAD 4 min. 86.4 sec. M1 1 2. Kinlock CHD 2. Fitzgerald CSt. BD R l A 8. Summer1eeCSt. BD 8. Getz CAD ' , 1 4. Mcuahon CAD 4. Billingham CRD ' 1 1 1 5. Bookhout CHD 5. Laplantny CSt. LD 4 220-yard dash Two mile l X' ,Q 1 1. Keller CSt. LD 22.8 sec. 1. Bell CSt. BD 10 min. 56.1 sec A I li A 3. si113mc?15eDqst.BD Q. Page CRD D . 1 . ' ' 3. L dd AD l 1 4. Mclgahon CAD 4. Bgultcln CAD C . 1 5. Coffey CSt. BD 5. Menna. CSt. LawrenceD 1 H0-yard dash 120-yard high hurdles A ' 1 l 1 1. Suttle CRD 51.9 see. 1. Tie between Gibbs CAD and 2. Lovey CSt. BD Cutter CHD 16.5 sec. ' S. Gramkee CRD 3. Jenks CRD C V 4. Hayes CND 4. Kennealley CSt. BD ' 5. Lampman CAD 5. Madden CRD 1 Half mile 220-yard low hurdles , D l 1. Herrick CAD 2 min. 3 sec., 1. Jenks CRD 27.7 sec. 1 2. Brown CAD 2. Gibbs CAD ' 3. Pickard CSt. LD 3. Clrtter CHD D , 4. Oates CHD 4. Lexch CHD X l 5. Aherner CHD 5. Smlth CHD 1 All Broad jump - Discus ' A 1. Stuart CAD .21 ft. M in. 1. Brockway CHD 114 ft. 1 in . 2. Taylor CRD 2. Van Fleet CHD C N 3. Holley CHD 3. Trembley CND y 1 4. Summerlee CSt. BD 4. Warnoch CRD 1 l 5. Fredericks CAD 5. Tate CAD High jump Javelin . 1 1. -Tie between Gibbs CAD .and 1. Desormo CHD 150 ft. 6M 1n. 'N Wgredericks CAD 5 ft. 7 M 1n. 1gIIted?escf5lD , , . ee e V Z. Vz:rfBly1g1CSt. LD 4. Tie between Bilas 451.113 and 1 1 1 5. Kelley CAD 3110116 CHD A Pole vault Mile Vela!! N100 . 1 , 1, Tie between Lyon CAD, Nellis, 1. Rochester 3 min. 30.3 sec. N l 4 T CAD a?1gfl,JKelley CAD 10 ft. 9 1n. gioaagenture . a r - ll 3 5. Tig l,Jfle,twleeE1StHIf3lCy CHD and gkigwfence 1 1 as ec . - F Shot put V . ts . f . 1 ' . Alf d 67 Poln 1 le. lliii1l'.l'iet S9141 t 1 'D Hefriilwn wi poem 1 S C D t s. Meeretb CND Rochester 46 P04125 1 4, Tate QA, gonaveniure S3235 . awrenc , 5. Trembley CND Niagara 9 pomts 1 'I .11 D l D 1 1, . C- lg 1 li e , --if H '-ce ' ' - T be fe ee-fe X' ff rf:-C324 ' 1 1 - !,-Q .fc f ,Q f 1 -rx ' S. , gn,-cf, .241-,fC -'X-'fa "W ' ' 'Y ' " ' " " -M - 2, --if f' fliil K' , fz-13:1-1ii4-.'r' f..:ff':ffyl:1'lik--ii"'f'Q2L4--Q-M ww.,- l li + i l w l l l l WRl'IS'l'l.ING SQK.-XID l R fl restling ,p l 1 From a humble beginning in the "wrestling morn" ut old .M-:ulvxxxy llzdl in 1923. the wat:-hful cane of iy . , l J Coach Seidlin has developed il squad wi-ll uhh- lu hold ith own :again-1 strung Uplklblllg' lvxms. lil' The opening match of the 1927 svlu-mlulv nt Vurllnml. X. Y. gain- :n x-ir-tory ln l'ortl:xnd Normal ons 14-1 score by what was justly felt to low llllhZlll5f!H'lnl'j' ullivinting. .X lmnu- nu-vt follmwd in which lhc ,i ' 1 Springfield College CMu.ws.j strong im-ll, im-nliom-d :ix X. lf. lxitvrvullvgizih- l'lmxnpiuns. worstod the fa' Alfredians in :L liotly-contest:-al lmlllv resulting in in 'M' 3-'U 3 won- .Xfh-r :i ,hurl lin-:illiing ,pac-v. 1-vents 1 came thick and fast wlu-n thi- .Xlfn-cl lm-:im umlrrloulc za slr--nnmns lin--llny tour. mm-ling St. l,:1xvn-1101. Syracuse, Springfic-lil, :ind llmwn. r The St. Lnwrem-e muh-ln ri-sullm-cl in u alixzippuinling lim- ul If' ,--lil uh--n llnmlx-l irvgulur HJ- 4' All pounder for Alfrwll injure-al his nrm during un 1-xlrn pf-ri-id :md forf--its-d .3 puiutx. .Xlthuugh llmnlx-l's mlSfOI'lUIlC C1l.llSCll Alfrml lu lam' 5 Illlllllfi :ll vuvli yqlliwqlm-nl mi-vi nn ilu- lrip, llu- in-:mi did ils lhvsl Wnrli if A in losing to Syracuse :md Springlim-ld. 'l'lu- rl-sp 4-1' lixa' '-1'uh'S ul 2-2-5 :md lil S. lu--xwwr. 1-:mnol ti-ll the llxxf Story ofthe l,.f1lHl1'lll'SS2lllllhlllllllllfllhlllfll with xx hivh lhv ,Xlfn-d I--:nn f-vuglut. Xt l'r-ix iili-im-. the bruised. 1 buttered, and soinvwlml spa-nl grnpph-ra mu-lv the-ir ln-1 plui-L5 -hm-l. :md lmswd lwfun- llrmuik undo- featefl team to tha- tuna- nf lil-H. Shortly nflvr, llu- muluu-u won :i d 1'1' ixin- x-i--t-'rx im-r ilu- g..m.-mlm!-l-M vxpvih-mx--l St. lhmuvvn- lx 'll tum mum 'llAllf'111lIU'- l"ll5'l'U1H Ulllll of Ill! puinh in lullw :iigiuml ll.-imxvxuhm-X .'- point-. il-S I lfnvllllruzclsi- W1-rvnu-nliunvd. il should lw -.HM qlmq ilu- up.-gil.-r-. mmgld 115111185 mxn1p1'llll0ll1lllHl lx w len they wa-nl iluwn. ilu-5' wvnl dmxn ligglilinpg. und thu! when lh. x u--in Ilny xx--n -'li-:ml5 lx C 'ho fiir us llu- :-ze-nsun hm prnigrf--.M,.,l' HH' 'mm' umm ,N fu, Ufrwg any , :lmmn y,,,.,,,,, QQ Xllfsfllk X ,N liMy.HA lm'l""' ll """' f"f-3-'N 'WH-I-'H lil mir- ll' limi.. u ri nu in. i, ix.-ii.-5 1.'-iis,-....n.11.wS- 'X JJ, Stearns I0 H75-llm, und S1-rw-ulim ll , 1,,,,i,,m,,,1 ,UNI Nl N. 'mn mM,,i,,., ,Hgh xkirlland il Norlnul und SI, lluiisiwmurli H' Mfrml Hr.. ,JIU HH gl In 'lm' i A i ix N , X W. ,Ik 0711? llIIIlflI'I'll Srrrnlue .vzfr i r ,ff . ,N ,,...x 5 ,,....g.,.qb ,,,...gwW,,,,.,..u,v imma W0,.,,,x mwah 4 ,f . L X, W . .V A -H R, . ' Y .,,,.,,- V, :Lf-"4 in -f,,,f""' 'sy' r' ' .- v x a . , '-K, .- . f--sf . -x.f ..-..-...,., ,I f' y i x ..x,,,gi15,i-,kNg1,hQqhQk V, 1 pg ,fi Wy U v V I ,, ..-- ...A Y, Y Wg W . " Q i ' -.-by u.. g ,, , ' F N V- - V, , V ,V Y M aWm....s......... g..r1-safae . - . . ra-.. -.. ,y nga.,-,M A W- V, f ,. .- Y M g a . fi C C ii W ill , i , A T F M ,V S 1 m -.i . 1926 TENNIS SQUAD T Tennis In the first season of competition the Varsity racquet-wielders gave good account of themselves. VVith a Well-balanced squad of men who performed brilliantly in the singles matches, and who teamed up to good advantage in the doubles, Coach Heers Was successful in turning out a team which trimmed Bonaventure twice and lost only to the strong Corning City Club. The team loses but one man, Wu Cits captainj, and should be stronger next year. There are several very likely-looking Freshmen who may give the older boys a stiff battle for places. The school should show more interest in tennis and get more men out. As it is, the boys playing tennis are also engaged in other activities and are able to give only a part of their time to the game. ' -. f -Q-af f-r if ing T -Q - 'fr - 'c- xg TW .IC i TC' Y X' 'A - '4'-977 H -. . , -.M - S, ' Y - ' K - - V - Y g v 1 - -JC ' wr K Vx In V - ,4 li ng-C H f ', JC -'- 1 K ' One H und red S evenzfy-seven 'I I V I Il I, I I I I I I I I I I I i II I I' I I I I I I I I I I I I, I 'I ll I ,I I I I I I "r-.,,,-V I ,, I 'I II I X v 5 I J . I. fue, X ., L ,flfhr--q,,,,.II1:111'eL,,g' " PIA 'ff' dl,,.,f . .Li he , H .QI 4.7 .---I- .-A-L. ,vegan-,:f'J"'vff ff I' I NI' ' ' ,f ,V LI- ,fe-f f,sf,,.v ,gif-:g,, ,,,,,,,., ,,f,-fraffnp-ll'""k'3w2fi"" ' 'fj9f.,,q,, Yk",..,-few:-P' ,ffl W',', '31, "I I ,7',,.-, Y- ,.-f' ,iz-e ' -'Z ,ff fe ,YY ,ff ,fi ff K. V :LI.,.,.-1-SI fn,- 2 ,, of-ve .ff .1,,,,:f 1-'fee-1'-' ,-few-'-4 .ff nf' ,f-Q 'fl' I I I ,-' 4' ' 'P' -'f ,f ff--f ff' JW-fff-'J'-'I' 1"f'r""'7iff . f-J" A - ff- I4 f-Hs., , , f 2 , I x .. ,gy-'J N, IX 'aff' -' ,.:f7-- ,.,:I- I, 1 ,:' - ,f 1., .. ,af-4 X--- e , - ,- I A ,I -I , -.., I ,V ----fi ,If .fy A, ,V --f........f"" ---...,,..v"" ,f-,,..i- ' I. ,-:fN4- ff'-we re-4.4'fi:fK'iYf 7 ,T--- RQQQQL-e 'Nix-Lit' Yigpf xii' X K! X' X' --' iy"""""'W NAV!! NM' I ,f -e -an N. -Katy, , -.-., X-M-Hex--X ,pak , , -, - - M 1 J X '3,.g.,.,,,V,.,-.Q.V ..o. ,,f,.,m., ,..,,. ML, Mes., X ,I g '55 A 4 R, v , I I I J"""""' FROSH FOOTBALL SQUAD rosh ootball SUMMARY OF SEAS! IX , The Freshman season was not over-snec-essfnl in games won lint served its purpose in bringing to light and developing new and promising lnaterial. Several backs and a few linemen gave evidence of becoming good Varsity men during the next year or two. Coach Goble has given the boys the fundamentals of the systein used hy the "Ing lmysf' and with another season they should develop into worthy wearers of the Purple and Gold. They had a light line and suffered as a result. Rochester and llobart l"rosli both had heavy tennis and won Ivy sniall scores. Only by the abundance of aggressiveness did our yearlings gain the sneeess whieh did etnne their way- An evidence of their strength can lie seen hy their slmwing in the l'll'KlYll"SllI'll ganna lllaying against a team composed entirely of Varsity nien they were defeated hy the niai-gin I-I one teiit-lnlnnii whieh resulted from a 4-0-yarcl run aftei' :I l'nnIlIle. Ga,lcl,on 0 l"rIIslI tl cI0l'll2lll1l Norinal IHS lflrnsli tl llolmrl, ldrusli l-l l'lI'Uxll II Wellsville lligh U l"I'I-slu li fieneseu Il l"I'IINlI I5 lluelleslel' lfrusli T l"I'IIslI ti lloliwli' .Mn l.I-IIIIIII ll l.',.l,,I, IL Um' IIIIIIIIIYYI S1'l'I'llfllj--Vlifjllf ,I f Iii! 7 1' I - II ,,. IIA gift' :JI I E I I I w I I ii I L I II I 'I ft If I I I J If A . IIA ,I II IF I I I II II II II III II If I II I II fI I' ' Ii I II ' I III III IIE, IIIQ I ". ' It . , fa, Ir Il II I I,I II II 'A If It 'K I iz, III tilt if II It QI Wt, INK I I 'Ifx K t it X X I N. X X. Uk 'XI 'JJ' PRX'-1. ,X , ...AX 1. v X.--Q.,-f ,, M. - - ,-"'PZZT?i"4fiX'i',f-X ll'3l WK! X, ucv- f- de --1.3 ef -ee -A---A s...s......,e A .eo H '57 fi' 4 . A l 4 yt f ,fr lla v ff .3 ,ri W4 l Fl is 'Q' A E 1 I A Ui ' i - f l I l x l, , ii g Ill li ,fin l -A fi X 'yy ji vii 1 il di . p i I ll l A .F l 1 W' Xb ,A , , 5 X ,' J . 'X X 1 i Y W I y l l RUSSELL S. FERGUSON IN TRAMURAL , CROSS-COUNTRY PLAQUE BASKETBALL CUP y if i i l fl - ntramural Sports , . V p . I, V ' . . ll Under the direction of Coach Heers, and at his suggestion, a new department and phase in Alfred's if" y i athletics was opened this year-intramural competition. The hope is that interest in sports will be aroused A f and serve as a means of uncovering and developing Varsity material. It will serve to keep the physical l condition of the students on a much higher plane. No restriction save that of being an Alfred student is 1 p placed upon those wishing to compete. A further incentive is offered in the form of fine trophies to be l i awarded the winners. V ' A The intramural leagues are composed of the various fraternities. boarding. and rooming clubs. The A eligibility list of each club entrant is set at a very reasonable limit. The expense incurred in conducting ly , y the tournaments is paid by the money collected as entrance fees from each participating club. 7 t The plan is still in an early stage of development, but it is hoped that its scope will extend to fields A p not now covered. Thus far, contests in basketball and cross country a.re the only sports included on the fi list. Perhaps next year, tennis, baseball, and possible wrestling, will make their appearance. 'N l Basketball was the first sport to be contested in the newly-formed league, and the first championship . if ' series was somewhat experimental in form. Two leagues of six teams each played ten-game schedules with 'K Il l the winners of the leagues meeting in a play-off. The season was divided into halves, and the winners of AV ff y each half met in a final game to decide the winner of the silver loving cup that was offered as a prize. A 'll y The tournament was hotly contested and the Hnal game between the Wandering Greeks and Delta i l if l Sig was a scorcher. What was lacking in skill was more than made up by the spirit of the teams. Delta R Sig was the final winner and took possession of the cup for a year. pf if l The 1926 season saw the Hrst annual race for the Dr. Russell S. Ferguson Cross-Country Trophy, a lg f il mahogany plaque with the medallion showing a group of harriers. The University is indebted to Sanford y A S. Cole, '23, captain of Alfred's Hrst cross-country team, for this fine plaque which Ettingly commemorates ip "Doc" Ferguson's four years of successful coaching. A ' . . l Klan Alpine with five men tied for second place won team honors and gained possession of the trophy p for the year. Kappa Psi Upsilon, the only other team competing, gained first place through Voorheis. A 9' As Voorheis was to run a Varsity race the following day, he was conceded thc race and allowed to conserve p if his strength. . or 5 f Y FA Sc ic 5,51 ,' we ' ,xwrl xii' -,C t - Y -g XC Kcgf f N - f,L4l" Y , ' W4-Q IQY4-Q' -.gg ' 1' - X X . f .AQ , One Himclred S evenfy-nine i i i r T l I ,' vlizwfx LAWRENCE C. LOBAUGH Manager Qf I Ilf8I'SC'IZ0lUSfl-C' A ss1'sfa11 is F. R. HUTCHINGS D. G. KLINGER A. H. Yoonrmzs interscholastic ' For the second successive year we were blessed with good weather for the Interscholastic' Track Meet. May 12th dawned bright and clear-an ideal day for track. The boys were loosened by the warmth and turned in some wonderful per- formances. Jardine of Buffalo Tech again broke the shot-put. record. Austin of Coudersport broke the high-jump record. and in so doing humbled Golden-1925 champion and record-holder. Seeley of Ithaca broke the javelin record, winning the only event having an Ithaca entry. Buffalo Tech won the team title. and the indi- vidual high-score title was shared by Jardine of Tech and Austin of Condersport. The Fourth Annual Interscholastie Cross-Country Run was held in conjunction with the Homecoming Day Program of Nov. 5. 1926. Erie Academy. Rochester West High, and Tonawanda sent teams for the first time. Masten Park of Buffalo repeated as winners, closely followed by ltoehester NYest lligh and Erie Academy. Almond Was Winner of the sectional championship and ran in the State Meet at Troy. Each year the meet grows and it is rapidly-becoming more ditlienlt to handle. In the near future it seems probable that the schools will be divided into elasses. according to size, and compete for the class titles. "t"'e-f:,'.':T5,'g-ffjfigeQ4-i':Lgge-f'T':b'--.Q-M '-e' -sf- M.:f15?f3e::.:2i2?f.5efiifla-3:4-ff as-giliffff-,tgiit51 ' 1. is 'rests-:angles L' N. Uwe lI7I.7I1I'I'IttI ,lflifjlzfly WM 'iii it ' U 3,2 K 'I J-X M-X -..- 'S X iff? -K K fx. ie NRL ,,g'1,'5-iffw-l -in -.Q. LR f-A--.,,,,M.,M , ..,.MX, 1 ,Q ,M.,.Q, , , , A A Q ,...., I .,mx ,W J I--Q Vuef -.N A,,1 M W, J , A N ,,,1-M. J-- ,qt ww. i,,,.,N. fa ,, 41 X5bsbIKQ:..:kx.5541xXggf? " X "f,'7:NL-1 'W-X wg-,D v-fx-.,,.......,-H--X....Kv.,x.,,,-5LFjx,--'72, ""'j,,Nf-: " fx.,." J' ' "fi f-' ,,-1,y.--f"ff,JgC.11-jg-"ff--22'i'.,-C--flc ,,,ii..,,E1"'Q.,.c.L,- "Mari , W, JV, -k - wx--1 E, N.,,,..w- Y. may-X. ,-..,.1N.N..,,,.ffx- 4-.R ,fi A A R X! , RSO, wk 'n ,V WIT -A 'X A it ,fx 3 ' HX 2? E ig QP' T f gy! ml X I Xif W 3 JV ji' .yy - rg-. P '5 w , I 1 1 1, ,Q . N xf My W? M, W 7 A f f. wif' Ff X 1-A M A F' K V ff 5 , I K , . A F ,f 5 + A K M A I I 1 N F + 4 ' v ' Y fx' Yyibfiy 'fff f V 1' V 11 F- li ! fi ix i E f T 1 P Q ir, 2911 1 f fl' A 1' T I' X ,C-PX K 'i H ' ' Y ,fi QQ :C Y Y Y, 7 ., ' .4 Y - One Hznzdrcfl Eiglzzfy-ovze The cresf and crowning of all good, Life's final star, is Brotherhood." -Edwin Ma rkharm 1 l L 11 1, 1.51 1-J! 1 1 , Qu , 1 1 1 1 1 51 1 1 1 1. 1 1 111 1 1 11111 1 111,111 11111W111'1 1'1'11 11 1 1 13 i ! 11 i f11i 1 11111'111 1 11111 1 1 1 UIVIQ 1 11 1.1 1 1 11171 1 1 x 1 41 X , .1 A -1,1 1 ,jfs 1,,. q4f::23f'fF5E115jefjfigg:-fr:'ff' 'ff x.xgi"..X-:AX -. ,, -1 1. .L. 1. -J J 'iw' xl Qryprlix x,SXj'i1xi:flif in Q 'xi 'kj 1,1 11 S 51? I rf I, 1 NX Ax S - V mfziefib ,ff 'EKEX-..g:L,.f71k y "" -EJ J X! , ' jx 11 If T Li. --4 "1Il'-'P' A 'Q i1 1 1 1 1 '..1 1' 1 -..f1 1 1 1 -211121111111111111g111111u,1111111111u 111n11'g111E1 11 1 wwf X ,1,, f ", 1 1 '1 T fwx -Q. 1 .. 1 1 ,1 H, 1 5 11, ' A 415- V 5f"'1"H41'. U 'N All u... nrllqqjrge! q..1 'V 1, 1111 IFE .11 11 113. 11 111 111-1111 EJ, gl' 'O' 'Owl' 'OWWO' 2 E . . . ' ' ' ' . , , , , , 2. Q QQQQQQQ if E o o 0 o 0 o o o o 0 0 0 fs gg ' Z111111111lS5111111Zl11n111l111i31111111u111111111111111111111111111111111111111111111111111 A i ,, A I 'tix 11111 15 31 11 W 1 IMIIIIHHIHIHI11IUIIHHIIIIHUIIIHUIIIIHIIUUIIIIHIIIIJIIHIIIIJI1HIIIHillIIIIIIHIIHIIIIIIIIIIIIIIIIWMI!! H1 N214 3 .l.l1l1II1l1II1HI1IIMHIIHIHIHIIIIHIHUMIIIHllHIlIIlIiHHI1lIIIUH1IHIIUlIIllIll1U1IIIlHIUZ7MW W .1 111 1 E11 11-1 X' W Ei A 'N X ii :Q 11 V 1 1- 1 sw- Q W ' 31 Q1 1 1'3"-'5'ia'1?1:f'-if 'X'-""3:fiQ Q 124 1-1 Q 1? 1: 1 12 1 '51 ' 'H---1 XX 21 ff 11 1 1 F M Ri , S f f 1 H111 1 "1 1 E E1 'Q NI 11111111111111111111111111111111111111111111111111111111111111111111W1111111111111111111111111111111,..1111113W'-- X X Tj? 5 W 1 Q" 1 11, 1 N QIIHIIIUIIIIIIIllMIINlIIUIIIIIIIHMIIIIIIIIl1IIIIlllM1UIlII!IIIIIHHIIIIIIHIHIIIIIIIUIIIIIIIIIIIHIHHIHH 'E E5 3 M D 3-"Q F330 o'o'o'o'oW 0 , i W, gff f 'X 1, 1, .... 11 X 1,11 ' fiT TUITT 'ff 'QITQHELUUIHMMM UU1lUJLQQf f.,QQff 1 Q 7 '1 1 1h fl Q M fQQQQf,1QQ M . f,fQQ,Q.f,.f.f 1 1 V, f. 1 1 -- 'T'Q1f""' 'L--C2 H-1-"'-'gf ,-F 'smfifc -f-11"-bw',+f3Q Jf:"""'fJ' R W 2 5 ff-.f" Rf- ' Maw' A. - Y Y R , T' gh Ru ii i! , Ra . I ' 31 11 .... A W .... I H1 A AA- I 1 f A1 f- 1. .1 1 I A I A A 1 'Q . 1. A X 1 Q f A 1 11 115' 1 A- : 1 -YE 11 ! 11 ,1 1 11 H1 11' 1 , 'UR AA 'i l 1 W! 'Q 1 1 A 1 I 11 A A :R '1 11 1 11 N1 A X . 1' 1 '11 'F , 11 1 ' 11 . QQ A A 1 S' I ' A 6' , A De ta IQIHH 11 1 X 1 , 1 l ' 1 ! .ALPHA ZILTA CHAPTER v E.9fGbl'1'S,I6d 1920 gf 1 OFFICERS Q ' 1 LAWRENCE C. LOBAUC-H . . . Prcgdsrzf , 11 A. RICHARD S. CLAIRE . . 1 ICC-P VC-Sldf'711' 4, Q1 1 KENNETH R. NICHOLS . . . bvvrfidrgl V ' FRANK E. TATE . . . Trfflrwrff I A 1 4 PAUL G. KELLEY , Svrgmlzf-at---lrnzs I11 GEORGE VV, BLISS l'nr1-mporzdilzg Sfvrffqry A 141 15 1 VVILLIAM G. COLLINS . ,.... . . . H 1.SfOl'If112 1 1 5 ' I-IONORARY MICMBI-IR Z' .1 1 I ORN.-X S. Rom-:las A V FRATRES IN FAl'l'l,'l'A'l'I-I 4 A V1 CHARLES F. BINNS llOO'1'111c C IXXYIS J. NELQOX: NURNYUOD H fm A ARCHIE E. CHAMPLIN 3111.1-:s IC. D1c.1141-: C1.11'FO1aD Nl. POTTER 1 V1 1 FII.-X'lxll.lCS IN i'0l,l.l-Kill! 1. 111-27 5 11 A LYLE BURDICK C-11,111-:1c'1' ll. J1':1-'1-'ln-21' l.11O 'l'. Sv111.Oss1tR L RICHARD S. CLAIR1-2 PA111. G. K1-11.1.1-11' AM P. S1'11.1.x1.xN ' 1. JOHN L- GRADY l.A11'1c14:N1'1-1 V. l,O1x,xu:11 Fruvg F. 'l'A1'1-1 A 5 in if RICHARD LIAMILTON K1-:NNI-:'r11 li. N1v11O1.s FRANK I.. 1:01111-T ki! N1 l,A'I'lHl'li ID. I'1':1umx11 Ixij W, 1 111-:H X ' 1h 1 GEORGE VSZ. Bimss lh1:m111x11 IQ. l,l1jX'l'I"l' I-'nw11s H. llmwn-111m:e 2 A MH VVILUAM fr. f.OLL1Ns l'1lDNIl'Nll lDO1f1:1111:n'1'1' U11 111 Ii'l' IR. S1111 l.'l's QV! CLARENCE V- ffIUI'I'H .'Ali'l'lll'll ll. llrxx N1-mux S. S1101 'rl-i X ' 1 .'AH'l'lll'Il I.. l"O'1'1 , . 1:1-211 IIAIIOLD l:.1f,A1u'1f:N'1-1111 WA1.'1'11:1c 'l'. ll111.r+1-: I 11-1 11 NX. lmcwx 15 1f1 HAROLD 5- II-'UNfHll'0N IMNII-11. H. li1.1xu1-11 X1 1 111 1- J. N 1111111111 A 1, F11 Nl NI 1 O1 . 11.11. . .u11'l111l11 sf 1 WV' QA ft .X M1 1 ' '1 Q I A 1 F A 1525 - f I A 1 1115 . ,J VY ., f . A Xxku U11 1' Il ll uffzwl l','1'yl1ly-fm11- 'R , . l 1 , I r L.. Y-i, ' . i , 5 , i . Q if ' '?"F.: 'ii' ,: i. ' K. f YJ : x ri- . 'H' . it E . rg I' va I I 1 . l,fg,,,f1ff,,:'A 1. 'J ,-9 ,., Mir 'il . . , 4 I . sea "SERS Q." 2: Q Q1 i, -,T - - - - - - -J .ir V' Y-i,4-g 4' 4.-fir lfqe I .fc , iggb y .- , W Q f l A Delta Sigma Phi y Founded at the College of the City of New York, 1899 ffm A k :Qi - - E 1: , mi ' , tml. ',,. U . ROLL or CHAPTERS X' ' " Boston University Comnghted Georgia School of Technology University of North Carolina Duke University Alfred University Ohio Northern University University of lllichigan Ohio State University University of VVisconsin James Millikin University University of Virginia Oglethorpe University McGill University Michigan State College University of Colorado University of llaryland Albion College Kansas State Agricultural College University of Southern California John B. Stetson University University of Washington College of the City of New York New York University Pennsylvania State College University of Texas Cornell University University of Pennsylvania Alabama Polytechnic Institute Southern, Methodist University University of Chicago Waynesburg College North Carolina State College Thiel College Hillsdale College University of California Franklin and Marshall St. Louis University Tulane University Wofford College University of Pittsburgh University of Illinois University of Nebraska - Ames Iowa In 1901, the Ku Klux Klan Fraternity was founded at Alfred Ifniversity by two Kentuckians who were students in Alfred and whose grandparents were mem- bers of the original Ku Klux Klan. So far as is known this was Alfred's first local fraternity: others that may have been older had died so long before that they were long since forgotten. Note that this local fraternity had no affiliation with the present Ku Klux Klan organization. This local fraternity enjoyed a line reputation and as a result continued to grow and prosper until largely through the efforts of brother Frank Lobaugh on February 7, 1990, the Ku Klux Klan Fraternity became Alpha Zeta chapter of the Delta Sigma Phi F raternity-the first national fraternity at Alfred University. M K I W if ,Y ' ,- i i f f , 3 4 , Y .ac Y F , I . I in l I One H unflrecl Eighty-five I A I i WV 4' x -2,x!,ffyL.,..,V-YN. ,xx- f-RW-+..,vf-f:.':g,.ffW'1:-yff.-..1Tv'i?if'f163175, ff , 1. Qs, ,ji 1. jf Nei , I AA14...4wR..-'---'w..L.,, Mf.A.,,,.,fR...L, ,f N- 1. X x,.'fvX f'R.. .i,A ,Aff 1-2--ff-.RSL-.MASQ-if-Y -QM-wf 'ff-A-W' 1.1 I A J? E If-f 'f 1' A, A wir A Fi I I A If 3 W R ' 1 , I7 il 5. W I I N , , I A V ' I -N V I I I 1 ' J I ii ' , rf. A I .A i 5 ' Al' heta I appa u Q AE BEW YORK BETA CHAPTER it 4. Established 1925 W I I "IX I OFFICERS , ,A RAYMOND C. FULMER . . . . President gl. EUGENE W. FULMER . Secretary N ., Li E. EVANS CARR . . . TIrea.s'z1rer I DONALD E. STEARNS . Fapfazn Of the Guard ii IIQ FRANCIS J. WILLIAMS , . H zstorzan f' 4 LEONARD M. HUNTING . . . . Chaplazn ,I A A If FRATRES IN FACI'LTATE I JI . . Piggy FRITJOI' HILDEBIIIKNID L I..xRENc'E NN. BIERRITT I V NL' il X V fjixw ERATRES IN COLLEQIIO I Oli!! I If li 1927 If If . . ., , , . DONALD E. STEARNS E. EVANS CARR NEAL L . NN Emu RAYMOND C. FULMER FRANOIS D. MONERNI-:Y CLIFFORD H. BENTLEY FRANK J. FORD I fi '1- Wzf g H 'I I IQQS sy!! 5 WENDELL M. QROZIEIR CLII1'1f'Olm l.. 'l'.xx'LOR l.EOx,xRD Nl. IIVNTINI. I '-- f 'R O , w x A Q51 RAYMOND E. I1RANc,Is RAYMOND IC. C-.Imnmfzlx l'.1,nON R. 5.XNl-'ORD .., Nl- 1 , , . EUGENE W. PULMTGR III-:lmlcwr li. lluzms l'n.xxv1s J. NN11.1.1,ms jgjg! ROSS W- ROBBINS NY11.1.ux1 W wsm: , 5 ff lwzsm 2 jg ARNOLD BFIMIII 1 llAlu,If:s l.. 5'l'l'lDWlCl.l, N I-:nm-1 l'. blssox I9 HAROLD lE0UI"""N NN Ammo IC. NYIGIAWI NN'll,l.l.XNl 'l'1:1-EDI-fxxu lx YR,!'Ft JOHN L- CQU' i7Il,xlu.1+:s GILIH-TIC lTOx,x1,n ll. NYllll'x'0'Ml1 5 DEAN If. lfRElll'IllIl'KH lNlili.Xll.XM lllfm'11l:lcxA U1-tOm:1c I.. Wn,1,I.ms fi W.xx'u..xN1m ll. l,lw:lmO1uA 1 aj' ,. 2 It ' 'X Un 1: II'lI'lIIll'l'1I l',7I':Y1!v'f'Jj-.S'I.,V l . t. X i 4 V P 1 g Q 55 ,-.,f...-- Q.,-- I 1 .... r I r-- I I-.- t gf ' . 'ti 1 ' ww X, w ' W wh : if 4 2-.Q ,V I . . ' . ,N l A' -. r d xl 'N f f ,l . Y V 1 Q Theta Kappa Nu , 5 N3 his i f 1 . Founded at Drrurry College in Springfield, M issouri, 1924 'iq 'ff 1 'RJV i K wtf X sw if 1 C py 'ght Theta Kappa. Nu Fraternity, 1925 w T ROLL or CHAPTERS ' Howard College University of Michigan Blrmlngham-Southern . University of Minnesota 1 Alabama Polytechnic Institute Q Millsaps College University of Arkansas Drury College Rollins College Westminster College University of Florida Culan-Stockton Oglethorpe University Brooklyn Polytechnic Institute Eureka College ' Alfred University University of Ilhnois North Carolina State College p Hanover College I Wake Forest College p De Pauw University University of North Carolina 1 Rose Polytechnic Marietta College l Franklin College Baldwin-Wallace I . Iowa Wesleyan College Oklahoma City University 1 A Simpson College Gettysburg College l Q Baker University Thiel College I Louisiana State Washington and Jederson Centenary College Wofford College 5 I W, Louisiana Polytechnic Institute Randolph-Macon ' y Clark University Hampden-Sidney ft l In the ear 1908 The White Owls' Club was formed in President 4illen's old li l 1 Y s , - home at the easter11 extremity of the campus near the Steinhelm. Three years later, ll U Professor Cummings and Professor Lake, with the aid of the club, drew up a charter I li ll for Alfred's first Greek letter fraternity and her second fraternal organization. This i 4 fraternity was called the Eta Phi Gamma. In 1913, a new home was acquired in the I I fl I old Stillman place on South NIain Street. Then 5 g the war came, and fifteen active members p ri I ' T answered the call to the colors. In 1921, a group N ' sadly demoralized by the war, but determined y" p v to go on, bought the present home of the frater- ,l fl nit from Doctor Binns The nest vear the il 1101216 was partially burned and was rebuilt. By :yn I 192-L, the fraternity had acquired a prestige ' which resulted in its becoming nationalized as A 1 I the New York Beta chapter of the Theta Kappa 1 pl , Nu Fraternity. 1 l y u x f , l il- A WAI- ,f',-:tTi-fi? 'xc xc' 'X-za. X-I' mcg if 1 -f -f . A Y at A W tifsafxfr- f--iA AeeAfA f A1411 One Hundred E ighfy-seven 9 n wily.- 'x W. w 1 A L-. Oh A- V! fi". L .Z Q.-. J... S . -1 S A f- . -A D'e-.ffm-S-f-igipfi' hfu-if Q f'-X4 if we-Mlqlggi. Six R f'fi.T-.,..7E31L- 2 - R i'i W-L.f R -1'J""'-A -ff """" - -' "P" -f-2-1" -- V E , f fi' " f 433 4 k W . 954 .W A y. Ti 45? 'L I f Ax I5 4! .AX M 1 P Yr 4 . . , l W a A I V N 1 T, A U P . S 1' 1 OFFICERS 91 HAROLD E. ALSWORTH . . . . . President A VVALTER I.. M. GIBBS . . V1'c'e-Presidenif 1 EDWARD K. LEROHNER . Secretary , V CHARLES R. AMEERG . . Treasurer HAROLD F. MCGRAW' . . . Historian .Q RIEVERE H. SAUNDERS . ...... Sergeanz'-az'---lrms ' f' A FRATRES IN FACVLTATE X, . 1 I . PROFESSOR I. A. C,-ONROE PROFESSOR PAUL R.ITSBX' PROFESSOR A. H. IQADASCH '. PROFESSOR JOSEPH SEIDLIN PROFESSOR PAUL C. SAUNDERS PROFESSOR W. A. TITSXVORTH X11 V FR.-XTRES IN COLLEGIO A 19Q'7 ,. ., CHARLES R. AMBERG EDXVIN W. TURNER EDWARD K. LEROHNER W Q WALTER L. M. GIBBS lf. JWIARYIN INGOLDSBY 'HAROLD F. NICGRAH' H PIAROLD E. ALSNVORTH 1,0NALD T. PREN'r1c'1f: WARREN C. COLEMAN A mes Ki: LEONARD ADAMS IDONALD F. PRUDICN KENNI-f'1'll I.. MANSON 5, ' EMERSON G. CHAMBERLAIN RAYMOND B. NYI'l'Tl'IR JUSEPII E. K'LAx'EL1.E 2 A EUGENE IE1lEYNfJIJIIS REVERE Il. SAUND1-:RS HRRREH1' S. POE Ky 4 .ICIIARD . ,'AF'r IA-U.: qjxm- Q 2 4 01 2 . . 1 W X Y XLLJ NX KENNI',l'lI G. MIl,IJEli lXICNNE'l'll lu. bmrrn DANHC1. P. llm1H.EY Y X 1 WILIJAIE4 VX'EL'l'S J. ICNFIELD IJCAVII NYHERI-TN W. RUURI-fl"lCl.l.l-fl X JOHN VN. I URNER Vlxlll-ZUDUN 1-1 X. .-XNIHQHSON Hs, N .xx gs 4x RX . Xi ar + . "' P , A' N L-, g E, I ' U I xr- Unr' ll ll nrlrrrl l','I.fjlIf'lj-1'l.fjlIf ' 1 A A Hi -Z, 1 - fe.- Q' Gt "ek ,fav 0 '-Q' l , l I ,I I4 1 . 'X 9 NQQI' MWA . , 1, - N-Av. . ,Q 4 .. l , ,VA ., .11 3,3 I u yu, .1 A . A, -- .- .- . Ola., . ,I .enfi rg -' .' I I . A - .- ,-.'- I . si.. 13, , lg- 0 . x - ' gee . , .' . . .4-' -' - .-1.'!.:,:, f5 I I I,.l .'-"Fif--f , . , - ,P . .mn 125-Fl . - A . A ...-4,- A Klan Alpine 66 ' I LOCATED AT ALFRED UNIVERSITY AAAA ark 4 ESSE Klan Alpine Fraternity had its origin in Burdick Hall about twenty-four years ago. A small group of men, bound together by common ideals of manhood, com- radeship, and scholarship, wishing to give outward expression to the ties which they felt and at the same time to bind those 'ties more closely about them, formed a boarding club under the historically-suggestive name of Clan Alpine. During the World War, the Clan became scattered in the ranks overseas or engulfed in the Students' Army Training Corps at The Brick. Upon leaving The Brick at the end of the war, the remaining Clansmen drew up a constitution in 1919 embodying the ideals of the first Clan Alpine, rented a house, and established Klan Alpine Fraternity, From this little group of twelve charter members the Klan has grown to over thirty active members and seventy-five Alumnae. In 1920. the frater- nity bought the E. P. Saunders house on Main Street as a permanent home. To Mrs. Nlargaret King, for twenty years our matron, the record of whose unselfish efforts is written so large in the history of Klan Alpine, we gratefully pay the highest tribute in the heart of a man-our Klan Mother. A A Y -- if One H 'll7ld'7'8Cl Eiglzfy-nine KIT? 5, .:.-Q....,W,,,..,.....,, Q, ,W -A.7:,mv,-4.-L.TL,.x -:MN 4,5 A .N Y-,.....g7 ,- "A, xyfkxk If -ixgq LAMAR-,,5 ,,QANQ,1,,,,Lf . L..,.N4,,,,..2.,,,C,,..,.. nw., ff, ,LZ-ff' 54- ?""fg- "f,f7 ' -,Af-nJ.1.f JF jf:-A -4 A4-'fr-S-v ,,-jk., A 3.1 It fl-x -' ,514 -7 I Jfwqftt, N-.:'i'1--Jefxfxff-If-gxt '-qj'2"S'+-.Qwl-AE., Y X ' .Q-45...-, Q4-Q12--1 f Yin yy: .ffQXff::,.2Q:g1 51.2.-Riff-ff.g.QfQ7 1b.:f:J2:f:-A352-ffm LJ AfE:4fi:NAmL?wmWAFfMMuwMkm,MwQmwwfmAmwNwgfNM'X'fNmfx,Wd1ggQw:RmAAA,,MfLM.:6w.E14Qf',A AA ROBERT LADAMS, JR. DANIEL W. LUKS CHARLES H. FIELD ANDREW F. GIARELLI DANIEL CARUSO . ROBERT ADAMS, JR. GERMAIN C. CROSSMON WESLEY A. DAILEY MAURICE W. HALL IIOWARD ADAMS IJIGIITON G. BURDIOK Una ll u mlrml N in My appa Psi Upsilon OFFICERS FRATRES IN FACULTATE GILBERT W. CAMPBELL RIAY W. IYINGATE FRATRES IN COLLEGIO 1927 DANIEL CARUSO I9QS R.OBER'I' IIUGIIES WILLIAM H. IIOUGIIIIICAD 1929 CII A RIIIGS II. FI ELDS ANDREW F. GIARIGLLI II.0llI'IR'l' H. IIINTON . . Presfident . Vice-Presvident . Secretary . Treasurer . Chaplain ANDREW W. SPAULDING DANIEL W. LUKS CLAUDE II. YOORHEIS JACK NYEAFER II ONVAR D H OXYBRIDG E JOSEIIII G. MEIIIIK A i 5 1 - y fy Q 6 4. y . l il!!! 1 it ' Kappa PS1 UpSllOH A A . ' ZIIQUI llllll' J A , LOCATED AT ALFRED UNIVERSITY , ,N l , mn - . Founded, 1922 "WEE Q his PA Psy UPSIL W V A I A u l 1 l t 1 u p The Kappa Psi Upsilon Fraternity yvas founded December 12, 1922, by mem- T bers of the classes of 1923, 1924, and 1925, and Doctor Russell S. Ferguson. A The fraternity became recognized by the students and Faculty and was heartily 1' . supported by these sources. 1 1 1 The internal organization was made possible through the earnest and untiring . efforts of Doctor Ferguson. His directions caused a unification which has continued 1 i to the present time. Four yearsihave passed in the life of Kappa Psi Upsilon. It has found itself i p up among its brother fraternities because of that spirit of fraternal co-operation A y which has prevailed at Alfred. . ,1 W A . A' . , ,Q t 1 4 X 1 2 Al . 4 i l n , . 4 it p l 41 1 1 'I .1 . p 1 f -cl" - f fm WC XY! Xt' .Y xf it W 'L K 3' V i , Y f' A V Y , Y i, , - ,J L v One -Hundrcfd .Yzfnezfy-one 1 II I I I I .I 1 I I I I I I I I '1 I 'I ,I I II I I I I I 1 I I I I 1 I I I I I I1 1 I 1 I L, ,.-.-L ,..-..-.,,, - TM, -OV V, 1, f, 'YN In ....., 7,51 11g-wif' 1 Iv..- -, - , W- -I ,L --"--T "'-N 'WWA . 1-A.,-VIR I "., " fr 5 L, " 1, Af 1 ' - A-fl -1 I E I A 1115 .,, 5- I V- ,' uw- 'ff-PN.-- j:L1...-,,,.,,.as--..,,..-f-f-ai?-' V NW' 1 I 11"""'I ,X If I IWW IIII W AJ 1 5 119 , I I . QI 1' I I 1 I I I 1 I I , I I AI JI 2 . V . I '.. I 1 Q I I I I X I I I , 'Tl' l N1 A 4 g 1Ct11 111111114 I I A V I fyflllllllfl fyllllllfff f'f.v!11i111'sI11'11' If4..'f' I , I 'I , I O1-'1-'11'1-211s ' - ROBERT F. BENNETT . I I :i'i'iI.'I.'i'U, I , III HAROLD F. OSTRANDER. H" 'IQ "W" "I v1"rI11f'1,' - WILLIAM S. HOUG11 RAYMOND L. QUA11.1-:Y I 7 "1'1l,N'l: "1:'? I 1 II N f l"Il,X'lIlIl-IS ITN I-'Xl IIl.'l'X'I'I-' I , . , PRO11.GEO11O1':S. llO111x511x I'11111x Il1111.u11 I .'N1I'IlI P11111 I11-111W Iw111v-'N I I I1 1-'11.1'1'111-if IX 1 x111c11-111111x III R.x1'x1ON11 I.. Q1 111.1-.1 V111 I INV I I 'Iv '1 NN I I' 1-'11 X'l'lII-'S IX 1111 1 1 1.111 N I . 15.431 IIIIII R,0lll'1li'l' I". II1f:xx1:'1"1' NX Il 1 11111 S, II-11111 I111 -1 II RUN I4 1 f ORVILLIC H. VH.XNIl,Xl,I. II 111111 ll I" H-I-'111mN1 ll II 111-II XX XX xN IWII N1111-Ix NI I'1111111 ,I-XII IIX71 If7'."1 'l'11OM,11Hll. II.x1111.11 III-I111 X III Ii x X1 -. A HIX1 HA11111' M. III-.Nm-1111 V11 1 I I.,,.11 NI. 1 li li -X-A I In KENN1-1'r11 Nl. II1-mv-,11 1 1 I. .1 XX NN 11.- MII EIL! IIOIK4' IIHII 'I,..I:v, 1"' I.: III II U f'lll' H11111I1'111l ,X1111l11 111.1 l T . to . . s r . - , Y, W, we s . 3 Q I I xexsx I ,ty xggrsj vi' i, . - Theta Gamma l ROLL or CHAPTERS li Founded in 1912 at St. Lawrence University l T Alpha .... . St. Lawrence University Beta . . . lVIorrisville Gllmm-Ll . Alfred University Delta . . . Delhi Epsilon . Cobleskill Zeta . . . . . . . . . Farmingdale On March 17, 1920, a Chapter of Theta Gamma Fraternity The leader of this band C t . . was onte Searles. The task which lay before them was a laborious one, but the faith in Theta Gamma with which they were inspired, urged them to carry on the good work, and their perseverance has been well rewarded. band of seventeen men met and founded the Gamma The history of the Fraternity during the six years following its founding bears w1tness to a most prosperous growth. In studies as well as in athletics,Tl1eta Gamma men have set a worthy example for those who follow. X High ideals and brotherly love have been strongly promoted during the growth of Theta Gamma. The motto of the organization is to strive to keep alive the spirit of the Fraternity and to leave behind noble thoughts of inspiration. 1 4 l I X eq Vxtlq Y , sf' -Q ' g-gli! One H 'unclrecl .Yirzety-tltree -F 4 13 J, V P! I I I I I I I , I I I I I I I 'I I II ,,,,,,T.-,K.,, - --..J-v I P . I I i I I I I! I F I i.. VI. IL , NM V V, 4, V ..,. -. ., L V Mum-N ,, , ,ALWN .JLP---.,, If--'-H"-+f,Z"' -1' ' . J ..-.,,, -Q"'5.v"""""ss A-ff?-IE-f'T..I -If , -f,.2f-- - W I f I I X.-jf:-f,.,,,f .Lf W-.ff V f I ' ,,.,, HI ,, --.W-Q N XL, I NLM., '-V. ' - kia' 1, , A- " -W-f-'mf' --,....:-1" n ' rr M Y,-LBf'ffTE-.. mflfxm ---VX'-Qwf-'fxw'---1 ' 'J Ii'Q1:-'DN .1 ,N A fd I E! I it 'III L 'I 92 4 IA I I I I III I I 15, I I 'I I 1, I QPI' V I I V I 4 I I I f lx , I , I . , I I I 1 N fl In IE , J K NIU, 'I , I I Ii I I? 'I In 'I 6359 FW ny, Km fp IE ..F V, SW MW GI I: I . I II MII' ,LI .E ,., fin ':. , , I MM l- IIE I: H NUI NULL In fl .4 ' N I IW I If ,, ,. A 'gifh 'W vJ"""x Xia! v,+-"1',XI- 14:41 -NNY! 'FN' ' C 'l R I I ,I I V I RUTH BULL . HELEN BRUNDIGE JANE WALDO . RUTH CLAIRE . ELIZABETH TUERS MRS. F. S. PLACE CLARA K. NELSON RUTI-I BULL VIOLA BUIIIIMASTEII ALTANA CLAIRE JEANNE CLARKE LOUISE COTTIIELL IIELEN BIIUNIIIIIIIJ ILUTII CLAIIIE MAIIIIIIGLI, .IIIIINSIIN RIITII IIYUNS Un 1' ll II IIIIIYYI ,N'I'IIwl.I11f'mI r Ieta qlCt3 'WII UFI'xIl'l'fliS 1,fI'Sillvl'71f I ' I'vr-IV'rr.vI't1'nI1' HI mrII'I'IIg Srrrrfary . Trm.wIrrr f I""1AA1M'!1IiZ'715l Sc'1"I't'fC!!'y IIUXURARY NIICMIHQIKS Mus. l-'. II. l':l.l.I!i XIIIIIII lhxxs IC Im A I I I-:Iv I 'III' NIIINI III-'Ifns M"lxlYlC XII-IMI!!-IHS 1927 f'IIAIII.wI"I'I-: lmlilil-IN XI II I SxII'I'II GIIAII: llI"I'I'IIIxsIIx .II xx 'l'I:IIwIIIIIIu:Ii lx.x'I'IIIII'N KI-:I.I.I:II VI l.'Rll!'AIll l'I I-'IIE lII4:I.I-:x I'm'xII ' IIUIIIIAIIII MIIIVII IiI"I'II li xxIIIII,I-II xkl I I XI NI-Ix III-3:4 lhIIIwIIIIx llIII.I.xxII .lux NN um- , N l.IIIs HIIIII-,Iss IIIIII limrxxxx lflffl NIAIII IKIIIII IIN I I v.I.I l'II.IxIxN NlIIIIIIIIxxSxIxIIIIIN IKIIII XXIII.-III- Rllullx Sll xnxx X 'fXT.Pf?e we an Y, a , , evi, t in t r A i if ' "M n ' 1 X 'u ly i 5 T 'ss .f T r r j 4 ,I .Ib -KV' Q Q l i' X25 y Spay i i Theta Theta Chi Located at Alfred University Founded, 1921 M , The arrival of a new organization to the Fraternal life of the University was li announced on the 20th of January, 1921, when Theta Theta Chi became the first women's Fraternity on the Alfred campus. Its enrollment, originally consisting of - seven charter members, has graduall ' ' ' ' ' l T y increased, with its sixth year reachmg a total membership of ninety. 1 l l A f XC xx' v . - 5 ' 4 Y : Y , L a c c 5 One H Zlllfifdfl Ninetyitive T V- ls' i I 'n F1 :Msg 1 f! I1 -I fs 1 i 1 3 4 P. 12 l 1 i W M I w rf. x 1 w 'N Y I ' w 'M A 1L R A A Rx?-R-5 f- f-- " R R' Y ' A f ., A A i.xQf- AKA A .ai A A A +A A ,A A f if qw " R N Mi . A-1 I! 'V' 4 I! Y R 1 N W ,1 A L 'N N A 'A Pi Alphi i OI"l"lC,'l'IRS KATHERINE D. DIENEMANN . . . I'ff.v11ier1t ' ' DOROTHY E. IJTTRICH . Fffffffltv 4 MARY Q. NEWCOMB . I'rm.vun'r Y pp GEORGEOLA VVHIPPLE .' Illmw I'rf-sffirvzt 'bf AQ MARGARET A. Voomims 11.114,-f I'rm.wrf-r wt ' .A A X uuxomm' maxim-:ns MRS- B- C- DAVIS MHA. lm. K. lm,-1.2.-A Mm Nl mm 1.. Fkwuxcx . 15 MRS- W. P. BAHHOWS Ninas l"x,sn-: Bmw Klux. l,. V. lhwvl-1 fl 4 A fi MRS' G' VY' Cf-4Ml'Bl-ELI. Mus, ,X. lf. Vu KNll'l.lN Vins. U. Pri-'R R 3 MRS R. lf. R1-:YNox,ns NIM, H, xx.lXx.K M"I'lX'l-I XII-INIIH-IRS IA A R: Nj In-27 ,Q KA'I'Ul'1lUNI'iDA: UIHNI-:M,xNN un' li. H1 x rm: N1 1 a ar l. NN mm x w4f:"7M"2 DORO'1'UY1.f1Ils:-50N 4Xl.lc'l-: IlllIl.I.lIlI-,H ln.-u..1.'n x NN rm r-1 1, V rl! if 7 In-as twig g31'1A'f'1crlr:lfzllS.' Cm,x-:MAN Nl un Q. Num. .mn Ill 1 1 x XI Nui Xlil W kifN""' I T"Uff"3N ln.num1ru XXRSI-'llxllllx l,UIiUlHX I' l :um u N II',N,If4R?'P IGMP' xllllH'.XllH.5I,.l1lll'x Nl nf.. xml X X mm N luLluN X. UUGAN X' UH! XX U Nr N c fi' '1 '1' ml IUJW MJIX , 5' flyigfj, :'iS:HHmNIYl'I!l'Wm"'5MAN l'XI,llHI.X1I Nl. I'-fl ll ua linnxe-1 Nl Num 1 K3 luI,l'.N . nm I Hmm X I Mum Q V! F 2 1 , Um' IlllHlll'I'Il .Yfrfwlq .Af IJ Y -' " Q ge 5 4.5, ' 5, D , i i Pi Alpha Pi Located at Alfred University Founded, 1923 D Pi Alpha Pi formally announced its organization on February 12, 1923. Before this step could be taken, however, there was Work that had to be done. The first formal meeting had been held on December 14, 1922, and the following officers -had been elected: EVELYN A. TENNYSON, '24 . . President CATHERINE N EUWIESINGER, '24 . . Secretary GENEVIEVE KILBURY, '24 . . . . Treasurer Miss MARION L. FosD1cK . . . ' . . Honorary President X With this start, it was only a matter of time and further organizing procedure 'until the group felt itself ready, as a sororit f ' f ' ' ' ' y, or actne participation in campus affairs. On February 7, 1923, the name of Pi Alpha Pi was determined upon. The colors, Silver Gray and Violet, were chosen on February 19th. lVIarch 15, 9123, was the date of the Hrst formal initiation, identifying with Pi Alpha Pi, members of the Classes of 1924 and 1925. The Fall of 1923 saw the sorority established in its present home. Pi Alpha Pi is now in its fourth year, and the members are striving to grow in those ideals set for the sorority by its founders, It is their desire to stand for those principles that make for the betterl t f Alf nen o red and to take their part in those activities that promote her general progress. 0716TH zmdred Niriety-seeerz if fu.,-S--.., W,-S --'--'M f K ' "ii ' ,,.Y.,,' , ,,-,f ,Q,m,f, nf ,,j""'-X' " N' - f S, ff' 4"-SN," fx -SJ fx '1' ff M, ' IM.. fu gk -.....:., ,:.--NfS...,.,4g..-:k N----..,..,. LT NS-"1':.-mfr,-ml--NA ,, S....S...., .- -,,- - .Ak-L,,, f ir WWA? ff, I K K V K! ., .' f f C ,r f ld ,X , .f uf' .V f' 1' M--fer' --- iff W I ff X f - f - ,,-1'---H vb---S.,-1... , rv K m...... fb.-. X, 7- ,WV 1 A .,,-v- - ,,,,,,.. BEATRICE SCHROEDER . RUTH LUNN . . THEDA JOHNSON . . MARGUERITE BARMOR1-1 HAZEL BRIGHT . . MRS. BEULAIAI N. Emns MRS. MAIQJORIE RUSRY MRS, D. BURDICIC Sigma Chi 1 u OI-'I-'ICI-IRS IIUNURARY NIICNIIHCIIS . P 7'c'S1.dt'7lf . Svvrrfary . Trmsurer lf1m1'r1f'.vs Jlumzgrr ml n 1' l 'U?'7'r'S.1Nl7lfiL'7If Miss Ill-:Ll-:N .X. 'l'x'rSwum'u Musa Yun x if Svm'1.x.r:R Mus. Alu li. Sl-:1m,lx Nlxss 1.1-1l.l,K 'lR'r1'r:n Miss EVA Foam Klux V. R. lluvsux ll W1 Illl Mus. I" - s AVI IXI Nll'Nll!l'li S IENT lil-:A'l'lcIr,'l1: Sl'llHUl"Ill"ll I IIAZIQI, l 3mun'r NIAHHl!I'IlH'I'I'I llmcrxlmuc GIIAVIG IDASSANMQ lJrnm'l'llY llAwl,mv Um' ll'1nul1'1'1l Nfnr'ly -wiglfl lhlsx' I-'xlmlmn Imp-X I mx A lin 'rn I l.llllXX llmmx Xu: l,r-ul I. ISHS .l NN ISN!! I NIS 1 K Il Nl lxxxl I nl-1.1 x. 1 Pam nr ICN "All N 'NIH ll xlill um X um Q A1f""1e5 ,r TW if M Y llflfi V 'Val ,N 1 M f ,R W Eff? 3 R eff' EE 5 Q51 , 1 We ".. Wx xv 227.1 L J f R W Q0 :W ' R ff U7 x I , K W K 'f by R L, Ml I 53,5 K Rf l W' R f ggi xl l rf 5, A AN, Ni H A ,IN I: 5 'f QM QS I 1 v. I. u X E ,R R N R. E ,RL , 1-3 Rx b X N Ai gx9r2 NX ,VKX ffffr i I A 3 Sigma Chi Nu p Located, at' Alfred University Founded, 1924 The history of Sigma Chi Nu, measured in years, dates from 1924, but as the memb l k ' ers oo at It the Way has been long and full of experiences. The sorority has brought to them something of lasting friendship, a closer communion with one another, and a deeper and broader regard for their fellow men. It has meant for them an opportunity to develop in all ways-mentally, socially, and spiritually. Recognizing the shortcomings of their past, and glorying in the possibilities of the future, they are striving to maintain and extend a spirit of loyalty to one another and of good will toward other campus organizations, while seeking always toward the betterment of Alfred' University. ii 'l i ff ei iv ' f if Y sc ' iq T iq, iq SQ, Qifffjx g V x f g 7 ,Q ,jg 7,4-,fig m ix One Hundred Ninety-nfzfne if fi 5? A 4?.xxx?Q5xLk -'ifii' "'A 'fxfw ff? X ,. , ,A .LAW ,W--1. ff',f'1f' -1 K' -ff'-gif-ef-:.f,"--ff1'::ii -f'gtLI'fq-iq:-N-f --f,.1--A-A-6 'L - "MAH 'L .""'11 if 4-zvff eff? 1+-'11 5' QA' -Fi -if-' A .ff ' A -- 1 'J-if s1J11 21,-1 . , lx' - 1 1 1 ' 1 11 1- . ' in -V 11 yn . 11 ' 11 1 1 1 1 .1 4' 1 1' 1 1 11 1 1' '1 1 11 ' '1 .' ,,1 1 11 1 . 11 11 , I, 1 1 1 1 1 1 1 1 1 , - 1 1 1 ' X A 11 1 1 11 1 11 111 P51 Qlnega -11 11 1 , L 111 1 1 UFFIUERS 1 DONALD E. STEARNS, 'Q7 . PfFSI.d671f 1 f ALLEN A. NELLIS, 'Q7 . . I'1'1'-1--Prm1'd1-rzt 11 V RAYBIOND C. FULME11, 'QT' . . . -S1'1'l'1'f1If'.If-TI'C'C1NZlI'6'I' 11 -A1 41, W. FRANK IAMPMAN. 'QS l',11'1. Ci. KI-Il.l.Y. '-27 131-3s1111x11 1-I. 15111-1111 'QS N111 N ? ,X 1 111 In nineteen 1111111111-11 111'1-1111-1'11111'. 1111 111111111':11'1 s111-11-11 11111111 111-11' 11111'1111s1-111111111 1 A 1'11 .1 its appea,1'11nee 1111 1111- 1f111111111s. This 111-g11111z111i1111. 1111- V111 Psi l1lIl1'g'll. 1111s 1111lx11K1lxK1 1 11 to unite fI'Zl'1CI'll2l11.V 11111s1- 1111-11 111' 1111- 111-11 1111111-1' 1-111sf1-A xXk11K1 511l1111l1 s111111-11-11111 1I g prove their 111y111ly 111 1111-11' .X111111 xlIl14'I'. X11-111111-1's11i11 111 1111- 111'g111111f11111111 is 111-1-11' XL iC2L1Le11 11111111 s1-1111111s111- 111-1111-1'1-1111-111, 1-xl1'11 1'1l1'l'11'll1il1' ll1'11Y11j'. 111111 l111151l111K1111g J IJCTSONZI1 1-11111'111rl1-1'. 'l1111- 211111 111' 1111- 1'1I'il1l'l'Il11'X' is 111 f.11'l1I1lx1':111x 111 1111- 111111111111111g111 A111011 1111111-1'si1y 111111 111 1-111-11111'11g1- 1llI111'I'1'1ilNN 111151111 111111 11-1-1111-v 111 1111- k'U11l1QKx. 1:-X , 1111111 111'g11111z11l11111 11115 111-1'1-111111-11 ll 111-1111111-1.1"1-1111511'111'111'1- 111'11g1':1111 111111-11 11 T1 1111! ff4U'l'lf'S 0111 f'2lf'1l ,V1-:11'. 11 11ss111111-s 1-1-s111111N1l111111 1111- 1111- 111-1-N1-11111111111 111' 11111 1.1-111111 1V1e11111,1'111'1111-11111111111-11111111-,X111111:111'111111111-111-1-1111-111 1511111-1-.1111111'111'1-1-111111111111111-s W 01 1110 W0l'11H 111 1111- 11111-1's1-11111:1s111- 11ll1'1'll1l. 11 5fx1111N 11111 1'11'1-111:11-N 111 111'1-N111-1-1111 A s1,11111:111s 111 1111- 1-11111-141-, 111111 11218 1111-1-11111 1-1111l11i1l,,1,1 ,111-1111111 111-11-111 111111111111 1111- vi 1- 1 ' I I - . . I , 11 1 sl111111-111 1111- 111 ,X1l1'1-11 l1lllX'1'l'hI1X'. L M11 . 1 11 111 11 1gfE"11 , 111-11 , 11111 ' 1' Vt, XX ,N1 711110 llllllrlfwl 1 R PX 1 ,I X . as . -- ,.. Nwwfmw-I' f N--4-0-"'NQ.,,,,.,-4 .xx - W r , -c Q .. 1 -L ' ,xxx ,X - X--, -.-N we f--' --R, LL--.. -- -,I I f A?5E53tr. . - ! ,Qi l D. p . l W! W! I r M I Phi Sigma Gamma . OFFICERS i KATHERINE' D. DIENEMANN ..., . . President I JEAN C. TROWBRIDGE . 1 . Secretary- Treasurer ALICE PHILLIBER . . . . H isforian MEMBERS W 1927 RUTH D. BULL KATHERINE D. DIENEMANN HELEN E. POUND JEANNE A. CLARK ALICE PHILLIBER J EAN C. TROWBRIDGE I 1928 ifl DOROTHY E. HOLLAND ELIZABETH YV. SELKIRK ' l' 4 With the twofold intent of creating among the women on this campus an incen- tive toward service to Alfred, and to recognize those women who have rendered A servise to their Alma Mater, Phi Sigma Gamma was formed as an Honorarv Fraternity in the Spring of 1925. llleinbership is limited to upperclass women and ll is restricted to tWV6I1ty-DVC per cent of their number. l I I It 1S the purpose of Phi Sigma Gannna to be a positive factor in Alfredis growth: to uphold true Alfred ideals: and to express these ideals in service fl l toward Alfred. As a group, and as individuals, it possesses a definite progressive . attitude toward campus activities. A ,f i i f .i f . e xiscfi A H W ,Q f 5 . - . 4 I .A Y -X Tim Hunrlrerl One A .,, LR ,,,.E.-,, ww- .fflfff f"'Xfif'M'f--f'BjfT"'Q-fR-i"'-L-ffu'iT'ih-Q-Afwig'L,r"1f'Q"f"R--ff'1"" Q-af-f,'--fail-H4-fQ-, f fn- 'if' 7 .fn-w. ".Pf-H-R-,7J"f f'-Q7 14,711-A-1' 4fYf.Zf" ' YY fllf' 7"'H-xffffm' ,---fri' 'CET CET? 54' ' Nfjy fjQj..f.f'f1?Q:i:gIj--iffly, V45-A ra. ' A 1 V X My W fx L. WQ"f R.:-x..L .pw-Cljyx-Q' J xjx. A-fx, mf-W-J' -- -V -- R... f4,...- .--Eff--.., f--A A -bww? -Q-M QA, A R, -,J - 5, If i i CHARLES AMBERG RUTH RANDOLPH HERMAN WILCOX WARREN COLEMAN RICHARD CLAIRE FRANK TATE JANET DECIKEIC Ti-IEKLA GROSSMAN IiUTII LUNN ta u lpha Esfablislzed, 1952.5 OFFICERS MEMBERS 1927 I'IAliRIlC'1' S.wNni-:ns linwix VIXITHNI-IR 1925 AN NA Mmoi-'ii' llmmrm' l"l"l'Rll'Il . President . Vice'-Preszlierzf Svf'rf'fary- Treaszzrvr K.X1'llLIliINl-I lhizxmi.-xxx K.-YFIIRYN iilil.Ll-IR B1-:.xTR1v1: Svunuizmzu Niklkl-Il. Wxuxrzix .hxi-2 W.xi.1m i'xR.XNk'IS NYll.l.l.XNlS E In the Spring of 1924-, Ellis-lJi':i,lu', willl lin- iivlp of five' olllcr nivmlwrs of iill' Vlnss nf"2.3. i.0l'iil1giil0 'R L wif! need of an Honorary bcliolnrslnp Fl'llil'I'lliij', org:mizm-ml lhv l'Il:n Mu Alpina. 'l'l1vy pmvvmimi to :lvtiwly 3 W ii VAX! Promote Sffllolwlliif and L0 'WIP in lin- ali-vviulnnvlil nl' lin' l'lliilll'Ili :mai illi0iiK'k'ill2li iifv of lhv insiitutiou, 1 :H Cwr. A' thus carrying out i,il0iI'1l-illl of i'llI'iilK'l'ilIf.f lvmli-rsliip :mal lumnr. :mil of mimi-lupiiig :1 ilig1'ilt'I' l'il2lI'lll'i0I' of 3 citizcnship. B0licvingl,l1:LL Alfri-al :ippl'o:u-lws ilu-sv iilvxils, llw lCl:n Mu .Xlplm mlils :n pulxlivuiinn whim-il L brings to 0Li1ci'stl1cs0:1.1lv:n.nl:lgf-sof lin- inslil uliun. i iz mf - X. 2 W: ,wg-2 x A , r .fig :fl ,li Two ll umlrwl Tu-U X I 1 l l fqx , 1' , ,- fan .,.. '- ' 5 qlfkj ' '24 iii lf 4 'fi X l g Y ,K W 7 iss 5 ' ' l 1' lil vs. all 'Nl' .l ,T 7 Nfl: la l . N 4 . 1 ' f klf, 'ffl l f , l " X ' ',- xiii j ,A l XE i J fl . , K . .P 'l Q. ' il , 1 l f ' l it l il A 'lf i L Fl 1 ' l if ', l i 4' I ' J A , an tl 1 A ' ,R he Spiked Shoe ' . .B 2 yi p A ' 1 l' OFFICERS l , J M VVALTER L. M. GIBBS, '27 . , , U pres,-dent ll .L , N p up fp MEMBERS 'L T llc KENNETH R. NICHOLS, '27 PAUL: G. KELLY, '27 TYALTER L. M. Gnms, '27 p ily WV. FRANK LAMPMAN, '28 ALLEN A. NELLIS, '27 FRANK E. TATE, '27 . I A The Spiked Shoe, an Honorary National Track Fraternity, was founded at Columbia University in T 4 1923. The organization rapidly spread through the country until now the chapter roll includes forty of the Ai 3 f leading universities. 4 I L i Under the tutelage of "Doc" Ferguson, coach of track and cross country during the years '21-'25, fl l l Alfred University petitioned for a chapter. The charter was granted and Alfred secured a chapter of The , A QV. Spiked Shoe in 1925. 1 l 1 Of the charter members, two-Hollis Herrick and Chester Lyon-graduated in June, 1925. Herrick, A , F' ,fl holder of the Middle Atlantic States Athletic Association Cross-Country Title in '23 and Captain of fn ,ig Cross Country and Track in his college career, has done much to build Alfred University in track athletics. l "ip fl, Lyon, Captain of Track in '25 and leader of the squad that won the New York State Athletic Association , Title in '25, is a man Worthy of such honor as The Spiked Shoe bestows. . Q illg The remaining charter members-Nichols, Kelly, Gibbs, Lampman, Nellis, and Tate-are still in 'fl fl school and are members of this year's Track Squad. Membership in the organization is limited to upper- l ' 1 ll' . . , 1 1 class men who have made a letter in Track and are striving to advance the name of Alfred in Track and yi, Cross Country. 7 3 W H . il il ""' Y TXT Y xi! 'NXT' "' Y Sf' W Y 'N' ' 'xffl -i 9' ' Z"5?'es1?i'2'7',.1"ili'SS""'- X W- ,we A , 1 A r X - xypf - X A A A f-fe-R 1,9 Two Hundred T lrree .. .c .c Burdick Hall " FRANK L. GOBLE . - Director During the Summer of 1845. three new buildings were begun on Pine Hill and were finished during the ensuing year of 1846. One of these buildings was a. gentle- i 1 'V men's dormitory called North Hall which was placed in charge of Professor and filq . . . . . . V ' Mrs. Pickett. It was thirty-five feet by fifty feet in size and three stories high above 3 All the basement.. It was located about where the Steinheiin now stands. wi 1 i. .5 Pine Hill, and put in condition for use as :1 public school. It was subsequently 8 l In the year 1868, this building was sold to the village authorities. moved down .xl purchased by lVIr. Wlilliaxn C. Burdick and fitted up for :1 hotel. il,lllGI'. it was re- stored to the University by Mrs. ikllltllltlil ill. llurdick and Miss Susan ll. lfurdicli. iff:-1 widow and Cl2'lllg.fl1tCI' of lVilli:un F. liurdiclc. llurdick llnll is named after lliilliaun C. Burdick. It is now used as an mcn's dormitory. and iiouscs :1 hoarding club. l A llil to 1 i - Yi ri li . K at ix. i Dx l l " rf"""' 'ft' 'ff' " 4' 1 , '1"' .r 'S ' ff vt" 'T' WN -Ai., A Mi.. H ,. . Two lllmrlrwrl l"m1r V The Brick OFFICERS MRS. EVA B. MIDDAUGH , . . U Avatron MARION RooNEY . . , 1 u presidemg RUTH PARKER Vice-Presiclenzf-Secretary ALICE HOLBERT . . . . ,,,, Treasure, In the year 1858, the need for a dormitory was satisfied by the construction of The Brick. It Was used for housing both men and women of the school, the men occupying one floor and the Women occupying the other floor of the building until 1896. After this date, it Was given over for the use of the Women students alone. In the year 1899, the sleeping porches were added, thus making it possible to accommo- date more students. During the year 1900, gas was piped into the building and, twenty-four years later, electricity was put in. During t.he Summer of 1925, the small frame storehouse back of The Brick was torn down and a concrete storage room erected. During the years 1918-1919, The Brick was turned over to tl1e S. A. T. C., to be used as barracks. The Women students then used Burdick Hall and two private residences rented for the purpose of dormitories. During the flu epidemic, the third floor of The Brick was used as a hospital ward. At present, the building is devoted to the use of the Women students not living in sorority houses, it accommodates about eighty people. ' if ."',A'fS-C "rf ,f X-r, ' W -- . , - R 'K V Sq Sq ' Y 4A 'V --gr -Q7 iz? Y LQ ,,,Q 11 ,,-Q ' ,gf V I Z IC T100 Hundred F ive r r t xr ll r r t rv -- V.. f, . .f-":fft'- fu, Xffff -QDGJX K' 'r l r ,...a,,,..s, ff'm'ef',ffefLrKf,f7j""1fff'ijZiQ7ff4'f'f,f. EQ il1, '1?-esmllqhqfl-.f ,T -eff'-f'f+ FQ:-s.'i1-3+ ,.A-Q-7411-ewf',fffF: r' -,ff r f- H Sfg-N if was 'W f .gy-r rUf""L, Y t' l r N ltliifi F l att t 3 m' tx, W ff 't Wt x t V' ftktl X 'K all tl FNK' y 'Q r ' ll Q earl to 'lj 'V l I t rl A F x F A ,l ix ,, ,, U r l N rr t p: , t l lr t -4. O z J l l l r N y rl j, t l I j r lr l ll p, rpg r r Ai! 1 N T , , vt l 2 iiiiiiij i . A p ' tl t . sp . 1 , '. lp . tg . h ip: I e Student Senate ,t 7 W 7 ll V tl OFFICERS I ' I li 1, jx r 3 DONALD E. STEARNS, '27 . Preszdent l t ' h lt HELEN E. POUND, ,27 . . Vzee-Preszdeni ', y , 3' w A ADELAIDE P. YORES, ,29 Secretary- Treasurer l f l ' l . , y . ' l r MEMBERS 5 ,Fl t Af? RUTH D. BULL, ,27 ROBERT ADAMS, JR., '27 Ross W. ROBBINS, QS c! t -t 'V ,fa is W. FRANK LAMPMAN, '28 LEE ARMSTRONG. 30 tt N' at h tt Q. . 1 " r tt ' -' ' W o . . - . Y, , 1' Mtg The Student Senate IS a natural outgrowth of a rxslng sentnnent for student government 111 Alfred :TX tx t H - - , . . . S . . tt , 3 tl thu Unlverslty. In May, 1900, a plan ot OI'.fl,'1ltIllZll.ll0l1 was adopted: three l501110I'S, two Jlll11OI'S, a.nd one asso- gtk- gl " - ' . , J Y- Q f it elate member from each of the two lower elasses were chosen to s1t on tl1e so-ea.lled Senate. The purpose of r N ,H l' ' - . . . . . N it , . M thls body was to fllI'I1lSl1 an 0I'gtII1lZ2l-lltlll that should represent the erystalhzed feehng of the Student Body Qtr l T lilly In ltS I'ClZll,1OI1S wrth the Faculty and deahngs w1tl1 lts own l!llllVlllllll.l lllClNlTOI'S. Its 11111111 objeet was to aet lp QaTgr,S as a mediator between the students and the llfaeulty, whereby eaeh should come to appreeiate the view- 'jk F polnt ofthe Other, and thus prevent misunderstandiug. 'l'he Student Senate was lo he also a eourt of last ny? v V . . . , N . , , N, ' qi in resort IH dCC'lLllI'lg' elass eontests, lt, was to suggest new eampus rules to the htudent l2t'YlS10l1 C0lllllllll00. p A tv F and to oversee and to operate those laws in existenee. lleeently. there has been bestowed upon it the "ftp E 1 tfjsf l'Xt'f'l1t1VC and judieial power ol' controlling and operating the honor system. lx' Kp There has been some ernlrr-asm of the poht-res adopted hy the orgaruzatton rn the past. and there wlll l!r'!,ff lNiCI'll,lClHll'1lI'l the future, hut. the organization has made itself an indispensable help in eantpus lite. and Q fx up ll will f'0Illlllllt' to he one ol the Ing tat-tors ru deleruunxng the lustory of the st-hool. 1 's Two II ll nflrnl .S'1'.r 'E fm . , ,, ,, , H, X. ' I' - ' if M it A l 1 I ILA? , 4 as-I , wi? gl- lqirj 5' pw lx' ' Vg 5 W iy',' lfjgg ii iff' iii ,pa W A Il ,fl I I fl! I I tn Fw 7 A ll The W Omen s Student Government il N A OFFICERS A RUTH BULL . . . . . President lx tl HELEN BRUNDIGE I . If'1'Ce-President V HAZEL BRIGHT , Secretary jf BEATRICE COLEMAN , Treagw-er IA, MEMBERS ff: RUTH BULL HELEN BRUNDIGE HAZEL BRIGHT 74 BEATRICE COLEMAN FRANCIS GREENE FRANCES ROGERS fl ALICE HOLBERT MQAY MILLER MLABEL XVAGNER yt, , ' l JANET DECKER BIARIOIN ROONE1 wx , , . . . . . . l The Women of Alfred University, realizing that a voice m their government was fl , a necessary factor, founded the Alpha Sigma Gamma organization. A few years ago, A the name of this organization was changed to The lVomen's Student Government. Ny' I The functions of this Organization are to guide the principles of social relation- A fl ship, to take charge of all questions that pertain to the conduct of its members, and 1, to act as a general supervising body. ft . I fl g""'--f-4""""ti,f""'hN.ff""""""R'i":f'xN-"" 'Z "Ff"""'Nt , xi Xi Ck" xf- xr -NX,,+ ' g my l l Taro Hundred Seven l N, , ,,,--17-..,.,,f---in -3+-.TX-qw L I '-- . a '- L Q' 'Q' - L' N ,Pk T ' QS " ' -, -f , , Ki- dx ,L S-2, QS, 2-1:.1f+f+.g4f ffffwf L L ' L 4 . . - L l ' A - - .. A fm' l,I' Xifl f.. I l ll l F l l l lf U4 V Al xl lxl 7 u ' 1 ' lx 1 'X 1 t ' l Men 5 I1t.LI'fI'2llLI'Ill X ollllfl xi ' r ll ' - . . . . l, ' lll'l'll lullb , A 1,.v. ':. 1 ROBERT ADAMS, Jn., 2. I ' 'Id 'I N - it ,F-.Q-1. 5 '. WILLIAM G. COLLINS, QS I "' I Umm if E EVANS CARR '27 . Nf'f"'f7l1'51' 7'f'f'l-"f""' gl X A 1 N11-:mm-:us K VERNE SISSON I-linux Sun .nan li.. ,ixlilx !lxX1IiTQ'mX ll .l ALFRED Voommcw 4'u.uu.z-ps lfu 1 ll 'll Wm U 'mmllnln xHERBEIiT Com 'I-fwnnw I.: u u Q.. HX1 .ax 1 H"""'llN lv fl HX The idea Ofilllllll.1'l'l-I'lll.C1'Illlj' lfmlm-il luul I.-np: ln-vu in lln-- mimi .-f l'r.wu.l.Qnl llgu .-, Y-ul ll mmf :vll 'lx until tllc your 1922 lllzlt any zurliun wus lulu-n upon ilu- malt!--r 'l'lxr..mrln ln- .-ll.-rh, ilu' mlzml vuuxwx took form. A rulllvl' lllllllbll Ctlllillllllllill was lirsl Qlmun up. lull it luv Nils.. lu-H1 "Nl'4ll"l"'l l" 'ff'l'r lx nearly Cvcry plmsv of lllc' rvlzlllolxs ln-lm-4-xl .Xlfrml frule-rlxiliuw lt ix mm ----xnp-N--l --l1lu-.-.-.l.-,.-g..:v-lr-U11 M A eachof thi!IIl0IllllCI'fI'1ll1'I'Illlll'S. :xml in :lim ix lu pr..m.'l.- :ul-l l-- l--xl. r .l -pu ll .-f ml- rff'-All VYUU ff'f""'l'llll' upon the cmnpus. Q 'fllI'I'lf'i'll0fSUllll'SUl'l.llllpl1'llg,flllg1l'l',1jlll:lll11llNNnkfvlll!4uHlllu'lll'Rl. ln l1"fl..l -x xlvm up - X -lwwl X. yvhcrcby l'1'c-slum-11 slnoulml not ln- plwllfm-ul until Ill.-5 l1...l 4.11. 1..l.-.l Xllr.-.l l..r Ql I.. rl.-.l .-1 um. uv. l.- plivv .R 1r1tl1f:yc:n',lln-tum:wum-xl.-ml.-.I lunfllll:-1-llnwl.-r,'l'l.ikl.I,m11.x..l...l.-.-nw.l.1.xlvl. :.l.l.m: :MH ll X -l' N tllc tlllll! ol llli'Sl'lIll'Hll'l'l'X1llllllliIllUllx, mul ...N gl..-ll.-f..,'.. ..l.4,. . g,..,,,.l.l. l...A.ll .. ll.. llI'xN1lll NN -1. nl H ax X :uloplz-fl XVlllf'lI lH'UYl4l1'illllIl :ull ple-mlpingg slmll I..-.1..l..l.I..l..l l..f..1. ll.. 1 l.1..:xl.,.N N...,f1f.-H U- MUN . -.X llll"l'l.Vll'l5'5"'1ll'.illll2I!lH:lN:l1l1rl1l1'1l ulli.-lllw.-xi.l..l llml lll'n'll-'III 1l1:l1l1 ll l' U- - lx' "l ll-'flllllll X Sllfilllll.l'lllf'l'll2llll Iwo lIll'llllll'I'S from :nnullu-r lfml.-rmlx .ll .lmnnn Xl:l...... D. l'1U lla. .l 'f'-l U ' ' 1,-l1I,llllsl:1sllr'l:lx'ur:un:l ll lilll'llXllllfIl pulmll f5..1.,, ,,, ql,, l,,,,,,,,.1,,,,, Vg l .-,. - - l W' ' lll'Jll1'l'lllll1'S :ul .Xll'l'e-ll. Nflrlllc' AH"lbf4w1'lllJlllXl - ul' lXl,glg XIPHU- IIII' 'lull U' I , X, X f:0Illlf'lllH'1'IllIi4'lll'lll1'l1'l.ll-.llllllllu l'.,.z.,,,,1. ,,, ,lmh 'N .ll . . H I, llllru Hlllnfrwf fffqflf X i . . . . sf ' - X , 1 ..s-.:f'H""-s-,4--'--.,..- - - ,, H Lffwr. nj-K ,J -. wg-e-..,,Y ' T L . V' E ' - it V , , A .1-.-, -,.,L.,.,,-B ,M Q .. , X . X. fx ' P xi l 1 l 1 ,Xi X ip ig p jlx:,V iq il 1 iw? l llv al w. ,Q ill? F 4 1 ,l J H A . , , i 1 1 i T if l i r it A WOnien's lnterfraternity Council T OFFICERS if fl y , 1 V HELEN POUND . . . . President ,I RUTH :HEWVITT . . . Secretary-Treasurer , T iw il ' 1 NIEMBERS T P HELEN POUND RUTH HEWITT DOROTHY GIBSON pi lk, l BEATRICE COLEMAN HELEN BRUNDIGE DOROTHY IIAXVLEY I l l ' l The YVOmen's Interfraternity Council was formed as a recognition of the need ip for an organization to promote harmony and mutual understanding among the 1 Tk I W'omen's Fraternities on the campus. Prior to 1925, the council worked without a p A U Constitution, making temporary rules as they were deemed necessary. During 1995, i ll , the council, which is composed of two members from each F raternity, SLEQIDS UP0f1 y ' lx jf the request of the member Organizations, drew up.a'Const1tut1on.. Smcent is Clonstl- F ' tution hae been accepted, it has done much to m1t1gate the friction which arises. Y ' ll , R, if l llilal 1 . A y 541 i ma L E O E , . T l?iPfEQY1fft'ffm4S25gaeygggggiigiigiisifbf 'P QL? .331 -: -to - O If T If as -H E -E - Two H undfred Nme l I A... ,. . . ,,,, L x, 'If' I, , 1, I If I f fff f H 4, i V A .WU . . L- Y .,,,L .Y A Y,,, ,N .. . Q ,,..L.-,M -1-,,..,,...L Q6,,,.., ,ps,q A ,, . K , ,.-,Ma ,V,,,.,... I f, 99:-:Ah-.... Y, ,nf-"A W"-, " ' f 4 I ' 1' , ,nf W, , , . - - . -W ' . A-f' 1' -.3--A ,,. 1 ' fp-V' . ., W -A'-N--.. 1-W ' A F -:ff-z:..' :rf..m...f:f ..,. A-.A-f.. .5 .I -'U I .ff -' . f -M f 'A f' ,Z Y . :4 .,-- .:, RfOT:,0 ff jf.: - 1. gin .,- dvi, I frnilk --.Vf sgk, X1-Af ., 41 -.1 IX A ,Q f 7, , i L f ' W1 ,H,.ff' .wwf '4,g,,,...7i -,..... k - . NW fm, F I f fxxgsfy-X -x-Lf V-.?.jSiw5fX,f 'Li-LAQYAOX w.,.LL.VL,A 1 .x V, ,X .qi f M. - ,,-.fr J, - ,,,,kid.j,,--.N,Y .wh ,JM mt ,NMS-,e,,,--'fa-v W- - X. N. X ' ,X ff 'W I Hy, -.,.ff' --in '--f I , K., AI- . ..,f-- -- m-- - -- -U 4 I If I W' fav-341-fj3,,jiii:.-..- .- -ML ---I 'K'-2---J Nf- X f, 41 'E W I"' M J W Wg H I 'A Z4 I . IE fffjvf .MIM 5 Y gf. fi I f .ff ,J fl? WV It Fi 1 I M fi iii!! fe? I 'V W kiwi: I 15 .E V Mfr , ,I Klyfgg I In f IH IL- Xa, ftk'CFf N' 13' . AI f I' Yif xg! 3 It lug HIILW1 I. IJ! XE? I rfvf ,II i1y"I .fi If Wg I If 'YY I . QW! - Il . Ag 1 :I I E! I, 'LWQ P" I KU! II IIA 'ir 'Xjf V EI f' :I f .Xi 'I 3 I' air A' 1 'INV- r "I Xu! ? if !' , , . , hy f . JY 7 MNA 5 -. I 5? 4 4 V A '14 5 I Staff Of 19- an .Ik.1dL .I I5 I .x N ' fgxg ' W , . . . ' 'Y' Vig RAYMOND E. FRANCIS I',!i1fUf'I71-Chifzf 1 , V 1, . ,L 1 Ross W. ROBBINS Bm-nz.-ss jlmzagrr 5, -.X I V f - . 'H A ,F ELIZABETH SELKIRK . . wifi hd1!0f gy-.M F ,Tr AL' If I NORMAN H. STOLTE I IW 4 h lk IW. . I I ram rrs Ll YA REVERE SAUNDERS I A H' 'D Q VI I I . A Y EK!! .X Q' 'jf WILLIAM COLLINS . . A-N'.N'ISfll7If lzflzfor IDONAIJI l'IcI'm-:N Agrzruffzm' IH I DOROTHY UTTIIICIII . . .'1N.S'I..N'ftlllf .-ir! Ifflifur NI-:www Nl. l'IIII,1.II-A .-151. Ifzmmss .Vmzagrr XY JOSEPH CLAVELLE .'1.v.w1'.vlf1r1I lgII.N'I-IIVSS jlllllllflff LUYIN A MIIILISII fir? Imisfnr 'XL If RICIIAIQIJ ,FAFT .... llxflvlllf-If :XIII-Il.l.lf Y u un xw .4 LI. I'f:nmg'.zgwrsr' "3-. LEONARD M. I'IUN'I'lNCi .-Ilumm' lh-In-im III xxr-I1-T .-im-.-:'.:!.' hfzfn- 51 IW! KATI'IIiYN kIeI,LI':n , , SI-ninr xx-ll.l I ua lllll Ian lu.-. 116. Lrzmr iff' JAMES IDOUVAILIO Nr'lII'UI' llflbflhl' I'-NKN1 IN Nl. HI Tk'HIXI.N .lSFq.'f!.'.f I'I:'::.I' wb Ifgk JANE WALIIO . .lunmr llnfwmvxn I-f. lin ITI' 1'qI.:':5t.:f:'.vrz.x vs'-jf JAMES CO1-3 . 1712 xl: mm: lsxlvulcl l.l IB I :,fl'Pkz-5. X J. luNIvIf:II,II III-:Arn Nnplffmffm .I Ixvr UI I m IQ 7'--.I.F:':'mf: 02,25 l'2x1lI.Zf--II:-Ihxnn, ':iu, l'.If-1.-.-rm! HW x7",'q wx SUI'llHNlUlH-f XSSlS'l'XX'l'- I ' ' I aI lIAm"fU ln- f'Alu'l':N'l'l-in l,NNlll lx: lx-.I li HI Lv.: Nun I: I MAIill'1l,ANfiI.l'lH'll'Z l,l..H. NN IAINA 1'nIIs,IexN, NUI If l'AlIl,fIAlu1Nl-:lc Xxnmxx xlllllli NI :xx XNm:r.-Im I IJANIIILI,fInIln,l-:I Iuxxn In l'uu.I,ux-- ll XX In vu. NN wr NIXHN lic'-11+ 'l'lu-slnll' Ivislu-N I1r:l1'lIlluIIlI-Ilyr ilu- xllfllnlul ,,,,.l,,, ,g.,,,, ,I l',,,1, I . yx X, L, U5 hw ll1'lHll'llII4'lll illilu-plwnlllm-limnuflll.-5.11 u,.,lx .,,,.Q,,flI,.,g,., X,,,,. XX Wg, I. I I .I U. I ,Iraq III. Ufl'l1'S'lUl4'llfHWIUYXXIl1lll1lI4'lla'llu'1llnlvlmlm-IIIIKIIIIIIII w..Iq..5 I IW, hvxu I IIA Tim ll nmlrrfl 'lln '4 cl J-X 'I fi il l I n jflssx S TW S T T ff! ,px ff-X ' 'YA xff sf " Q Y "f -fy fr ,A-2. gi, A ai, if X The Kanakadea , ' I ll , i y l The first Year Book of Alfred University, published in nineteen hundred one, ' was a carefully-prepared volume, full of spirit and Alfred tradition. It was pre- A, U I sented as a part of the University's participation in the One-Thousandth Anniver- ,T 2 p sary of the Birth of King Alfred of England. Three years after this initial attempt at jg f bookmaking, a student publication, known as the "Alfred Bookf' made its debut. X, A f The next year, owing evidently to some Hnancial difficulty, the book was not edited. ,M l But, in nineteen hundred six, the first volume of the KANAKADEA-"a new book with ' a new purpose"-made its "initial bow to the students and Alumni of Alfred, thus , l 1 4 ' 4 l .,i 4 l setting the precedent for a Junior Annualf' For twenty-one years, succeeding Junior classes have accepted the challenge and responsibility conferred by the class of nine- teen hundred seven, and each in its turn has vied to produce the best Annual in the history of Alfred University. Twenty-five years ago, the Hrst Year Book of Alfred University was published in honor of the University's founders and of Alfred the Great. This twenty-second volume of the KANAKADEA is named The KANAKADEA of Tradition, because we believe that the time is again ripe for retrospection and significant comparison. It seems fitting, indeed, to emphasize the dedicatory ties which shall ever perpetuate the memory of King Alfred in the only institution of higher learning which bears his name, and to accomplish this purpose, we have chosen his life and period as the inspiration for our art-motif. The page borders and the borders of the sectional title pages in this book are taken directly from copies of similar designs found in the old Anglo-Saxon manuscripts, many of which King Alfred himself translated and tran- scribed. The sectional designs are "expressions of life," typical of the activities of the royal educator's reign. The Faculty title page portrays him in the role of adminis- trator at the signing of the Danish Treaty. The Alumni find his great battle with the Danes symbolic of their struggle in the life of the world. Successively, we find him entering Rome to be instructed as a boy, chasing the wild boar on a hunt, translating into English the Latin manuscripts, shooting the long bow, and kneeling at the shrine -a great leader, an administrator, a scholar, and a Godly man. We see his shepherds at their flocks, symbolic of pastoral prosperity and, finally, we are confronted with l li King Alfred's jeweled scepter which is emblematic of his legendary lineage, pursuits, I and aspirations. The art design of this book is intended to bring to you the reason ht why the Anglo-Saxon founders of this University chose King Alfred for their patron. 1 if l It is because of King Alfred's indomitable spirit that our University is proud to il if T bear his name. It is his personality-the symbol of the Dream Alfred-which has ' Ji kindled the zeal of the builders of this institution. lYe pause to meditate upon the ties which unite the past and the present and which enable us to hope for a greater l T 1 ri Alfred. f V-lisp i lift li'i-Bl... A, an, - .-rosa,-Q Xqf'-C a :sie XC Xf' if it ws' . it L Two Hundred Eleven 1, , ,E W E E .Q l i i l 2 A ,E mf E 1 . 'ffl 52? l ly Ill, V Par? lu: My xl i' El ii l Dsl li ft'-i. l l' ,I E K -i ' ill il -N i-l i 1 will 'il li L i' 1 ,Q ill!! K lil , il if il J, Nl! l f j li ll ,i if .ul 5 ll ll V ll i 1 ll il , li l ,ll ll I 'Q l 'i A ' l i 1 E l. l , I i 1 '- t L ' D ie 161 ux ii D s'1',xF1f 1 HAROLD E. ALSWORTH, 'Q7 . Editor-z'n-C11 iqf A 4 FREDERICK P. BEcKw1T1i. 'QT . .llmmging Editor l 'gil l LEONARD P. IXILXMS, 'QU . 1J11.vz'rzr.x-.Q Jlmznaer ' lj Il ' ll w w x r x w N r x y - A ' A5501 I.X l lu lulll llllxh gf l if Al l f v y n A 4' A l Q JEAN C. ilROXYlSliIIJGl'I. '37 l-.mvix NN. l riixi-iii, -3. -J' A i JANET P. I,l'1C'KI'1l!. 'QS Dux xiii F. Pm Di-ix. 'QS All i, Q N , . , . X ,. , A ll lzMIc1csoN C-. C lI.VXN1lKl-ZRIAIN. X26 lsxmmi-t l.i-ii-ix. 'Zh if 0 U :3 ll E A mmillily lllilflllllllv. piililisliml li-v llu' slmlviilx :mil lmmixi :is "lllic .Xllrcd l ii li Mio11tl'ily,"clcvulml lzirgvly lu lilviuiry ix'm'l4 willi ai spriiilxliiig ull in-ii N. was lliv vzirli- klj 3 CSL pi'cfl0c-vssm' ul' lliv Fifi! l,u.1'. 'l'liif lllllgfilllllt' mix lirwl wlilml iii ISHN 'lllic i-lmugo 'i from Llic iiizilgziziiu' lu lliv ww-lilgv iu-iwp:ipvi- 1-:iiiiv :iflvr 1-iiiixiilvixilwlv Nluilviil ugiiai- is My limi lizul vslzililisliwl lln- in-ml fur il. ll il 'll i - - . , . , , l' 'Ilicwm-lilypiililu-zilmiiul lliv.Xlli'1-ilNiulviil llw-lx iiqixlii'-l :vm-iliii ltllilaixlliv llix "Alll'04l lV4'1'lil.V. lllv iiivziiix ul 1-Dilip.-liliuii, llu- iiaiim-, l..i:' .Hliiiiiiiml liy' QV lhllllllll fllnrli, 'I-lf. was l'llUsl'll lui' llu- pailwr, him-v lliqil limv. lliv li Im lizis lldil l'Vl'l'l'l"'l"l "f'll"l9"'l.V- 5'l""'f'lll"?l lliirl-x' iwili'N:i.Na':il':i1iil:iillu'iil1:1i lumix -iii' :mil lhriii. 11 l l. lllll,V2lI'ylllQlIlIlllllllN'l'4bl'lhilgllwlil'uH1 l'4llIl'l1iq-Us-ll' llll,-41111 qlli lllp ixq my ls lu ln' fl ix lvl' - . l l f lllvflllllll Ilirmigli iiliivli llu- :ivllillla-X .il ilu- xlllqlq-Hlx .Qin I.,- 5.1-.-..-ill.-.l ,mul pix qi ffl f'UlIll1'4'lllIg.fllIllx lu-Iii.-N, ll,,.,.,,11,.,.,. :Hui ilu. Xi,mm, '-is 'l'u'n ll llll1ll'I'll 'l'n'rfw QW' :xx ' "-s. 'MPN l J..- .. W. fri?-PRN x N -X X. Jaxx C , -N., V Q f+""r"-5.-bf-' -.b f"J..'p:"l,. 4' K X L 4' -1 . ,-.-.- ,ss E-.. s, l 3 - niversity Press Club PROFESSOR I. A. CONROE ...... M anaqer Some seven years ago, as college years extend in length. there was organized on the campus '1 grou f . .. p o students to be known as the Alfred Press Club. The purpose of the club was to promote the welfare of Alfred University as far as possible through the medium of the press. Dr. Paul E. Titsworth, then Pro- fessor of English and Head of the English Department, was General Manager and Faculty Adviser. During the early months of organization, this group of students forwarded to small papers in lVestern New York, and to various newspapers of Pennsylvania authentic accounts of hap enin s a d , p g n events at Alfred. This material was presented to editorial offices as part of the regular classwork of the students in Journalism. Naturally, the newspapers were glad to secure gratis all such material. In the years that have intervened since the organization of the first Press Club, the problems con f . . . rontlng such a group of students have been gradually solved untll with the organization of this res t , r L p CTI yea.r's Press Club, the organization is one of the strongest factors of publicitv the Universitv has known. Daily and weekly, a digest of news and accounts of important events are released to the pre's Th A . s . e . sso- ciated Press handles much material and distributes it throughout the State and through neighboring States. Buffalo, Rochester, Elmira, Hornell. and other cities are represented bv Press Club b , , mem ers, and special articles are dispatched to newspapers in various sections of the country, as those publica- tions request them. The University Press Club of today consists of a fairlv representative group of students who have had or are getting practical experience in newspaper work in all its fields. Under the direction of Professor I. A. Conroe, who has handled the work since the resignation of Dr. Titsworth the Alfred Press Club is doing much toward keeping the public 'lt large informed concernin li . . . g t e ac- tivities of and at Alfred University. if if ff Axqrixi "axes, pf 'XX i X17 xf 1 xc X.c.AJ Y ir , -L44 i,g, f 1 Y T wo Hundred T hirzfeen 4 p ' 1 N. if X 79: 2311 fsg rr X "rU1vf,:fj,gj?-f,:f r l 1 - ff iw. Y 7 1 ' .l,f',4.,f"'i-17- 'V .?,q-5:--vf',,,,-1-ff'j1 A -hi . xx is f.,'M.f5 .- " M i' fi - F I Air, .LV 'W .-Nyia lx esaffmfyisiiagapfi-P-Lffrfseifffmrie 'fi-A-:rf kr ft Us pn 1j""" 'S' 1 l, it 1 , . t tt t it I i l li Fax to i ' t .ii . xg, t iz f ll i ff 4 rl l l f i i I li , g ,, it y ffl is i ' 4 i 'X i i 'l it . . . ltr Department of Campus 4 dIHlHlStI'HtlOIl r it EDWVARD K. LEBOHNER . -4dnzz'm'.straIor Witt I I p Ass1s'12xNTs ' l 'p I t JOSEPH E. CLAVELLE Drzsxioxn E. DEX'ITT tl ii , . lL th The campus work done by the Freslnnen until the year 1925-Q6 was assigned K tx A Yi in a, rather haphazard manner. It. lmeezune necessary with the increase in the number ll' 'lt of Freshmen and the amount of work to be done. to know the Class schedules of the is X tit' men and to assign work definitely. in order to insure fairness to the worker and sr il eompietion of the work. For this purpose the Depiirtnient of Caunpus .Xdniinistra- 'X tion was created. , The department is headed by an Senior known as the t':unpus .Xdniinistraton ti i ,tl all He is aided by two Junior assistants. lts duties :ire to assign detinitely :ind inipair- if tially the campus work and to determine if that work is done. 'lllie Student Senate fl acts as a cheek upon the orgauiizzition lay lmving ilnniedinte jnrisdietion over :ill xi? i actions of 'ttlle department. ., i l 'lllie estialmlisliing ol' llie l7ep:u't :nent ol' t 'zunpus .Xdniinistrution is one ot' tlie twig steps forward tllnit .Xlfred luis inside in tlie Inst few years. lt is nn :idx :nu-enieut toward l,ll2l,l.. time when llie delnunds ol' st udent opinion will lie an-know ledgeil :ind snuetioned. lm and whit-li will lend to an wider trust :ind eontidenee in student adniinistrzition. 'r li .f 'l 'l'1l'0 Il umlrml l"mn'lf'r'n 5 it tvfg wt li ti viii li Q y" , ,f fir' X 2 mx Mp- X53 R X-'x,.. .ffv':"Z'jgf",0."'m'3,a-X-'--X, T-iff?-,-N4 g ff J' Y,-X nf -mb! ,-cgpffd KF X Xb i Vg-X116 :Q-:Xqifji Maj- sf A. 7, ,ii-it The Varsity HA" Club OFFICERS LAWRENCE C. LOBAUGH, '27 . . . , Prgsidgmf GEORGE W. BLISS, '28 . . Vz'ce-President KENNETH R. NICHOLS, '27 . Secretary PATRICK D. PERRONE, ,27 .... . . T reasu-rer In 1923, T. J. Ahern, President of the Athletic Association, working with former coaches Wesbecher and Ferguson, founded the organization called the Varsity "A" Club, in the interest of bigger and bet.ter athletics and promotion of true fellowship among the letter men of Alfred. The club publishes the various athletic programs for the different sports, adver- tises Alfred to the high-school students through an interscholastic track and field meet and a cross-country meet each year, and maintains an information bureau which attempts to solve the problems of the high-school athlete by personal inter- view or through various publications of athletic importance. The aim of the club is to promote interest among the Ah11nni in University athletics, to foster all worthy movements in the interest of Alfred Cespecially those which Will assist in clean, vigorous sportsl. and to assist worthy students desirous of entering the University. Ref Ye-fr -fe 'IYXC A-I ,Jk1'f?1,-+:,QY :AQ f,,,f'i' DQ' 1-A JCLFX , Y -,f-f Q ,c J T zro Hundred F zffeen Kali, bg., ,f ,fix N, ,vw ffff-:f"fff'xffT:'N'x'vff'IPM-2 -A Aw A I -, I wa- -.. 4--' -X W Y 4 -.94 " "' XJ is-Vx-X., K 'mm N.iZ,...,a 'Xa'-Lc:i...,,K",,Y,Q?.:...-,x.'1' ,4,--- F ,QF-X Q."'4f.q,.-Q, LN, fiqyt, '44 ki ,.y,,,-,-TQ,-,,... V,.-:YFSN rj-f' It XXL If If K . 2 ,. 7, , - .5 .Qt X .N . . ., j ks!!! .,,,4"-,,1'::...f-.I,+,L.9 -.A-V--f'Q'-'-if f S:- ...LWW by xxx! i, 1 f ' I 5 b 1,3---A55 -03,-,gn-ev k 4"""'-v..H,63"4' vb' ' v' l 'Iv JS f-1 - "N "' ,fi f-:-.,y",,.....,,ff1'-TZ,'I1-f- fidls-"' . I .ff 'I ,K I -, ,Q-S-I-. ...Wy I ,-,f ,If 4,-1 - J ,A -.,,,f"' 9.4 N, -I N., I f . .4 ,9- .I 0 -.., .xp xv .. I, Ify-I ,If -.,, " Am LAI- "--173' Af-MASQ-XL wb-44,5 I - lf' f-lkwkumr Yk:,'1A-- 1.115-af ---A "'f+-W. 'D-4-f.,c,,p' "N-.f--ff " ' ' ' "J" ' IIKII I II I I xt I II III ,I I' II I- 'I I I 'Il IQ WI I AE IVY, V I e Oung Menls hristian Association OFFICERS E. VV. TURNER, '27 . . . . Prcszdcn! WILLIAM G. COLLINS, '28 . - l IPF-Pffsldmf S. F, LESTER I U E.rc'cuIiz'c Sccrdary DANIEL CARUSO, '27 . I Nffffafll LEONARD P. ADAMS, '28 I TTPGWTPV V.-XllINlC'l' LEONARD IIUNTING, '28 llI:uMAN l'IAsI'I-:uI.Y .-'II.rIaI:D Yoounlrzs: '-39 DESMOND DPIVITT, '28 llI-:um-:u'r VIII-3. 'QS brzxl-2 lh:x'NOI.Ds. -Zh. RAYMOND FRANCIS, '28 ANIIIII-:w NIll.l.l-III. '-29 l'RElIElilk'K l1AxxI:1I. -29 . JAMES VVAITE, '28 l-II.IuIN SANI-IOIIII. '-28 ICMI-zusox I II.mIII:III.AIN. '25 I II AI, . M Il A ll II It I II IJ I I Il I I I' . ,, I, I I l I" A I II1 I ,I .. I , ,l LI ,V II I II KICNNI-I'l'll Nl,IxsIIx. 'QS I " II 'I Tlu: ffllI'lSIl2lll Assoc-I:IIuIIIs w1'I'I'uI'g:IIIIzIul III .'XlI'I'I-Il I IIIVIII-ally IlllI'Ij'-IUIII' 51-:Ira IIQU. .IX OIIIIIIIIIIIOI. Il II W3.SiLPIl0lllIl'4lI0lU0lilIlIOIlll'IlIlYlSillIlllIj'UIlUI'I1illll7.llIg1IllQ'xvlillllgl XII-nk :uul Ymuxg WIIIIII-IIE klllrisiixlll IA ASSfJCfl1LIlllIlH1l,l,ZIISIINIOIIINQ IJl'ilj'4'l' lll1'l'IlllI.!. Sllllililj' 1'X'1'llllII1. .Xpril IIII. ISSIII, lxl'l'Nlll1llll .XI'IllIll' lf. Nlillll NI III If the Univvrsily w:IsI'l1:IiI'IIuIII III' IlIisI-OIIIIIIIIII-I-. 'l'lu- I'IIIIsIiIIIliIIn IOI' IluI Y. Nl. If X. mu Ilrsi IlI':IwI1 UH nhl tllc '7I,lI of lVl:I,y, 1893. l,lll'lllI.I Ilu' IlUllllll1'll1'I'llll'llI WI-I-II III ISSIII, llIuIIlu- If llux IN. xxlu- uw :II Ilml UIIIIIC. INR, I pnslor of Ilu- SI-vvnlln llny llupllsl IllIlll'I'll. III-lin-I'Iul Ilu' l'llIwI .xllllllill SI-rIIuIII lu-IIII'v ilu- KllIl'lSIlilll Assor-iullolls. III :Ill lIIl.VlllI.fUl'I.:IIlllZ1'1l in Ilu- spirit III pI':I.I'I-I' mul Ilu- lunu-NI Ilvxin- III I-:II'Iu-NI IIuXII III lllillxx' Illll'lSIIIIll IIIVA' lllIllIl?l'll'USlglllIll'IIlll UllIIIUVZIIIIIIIIS.Illt'lll'I1IllllYllIltIlllllINl'X'l'l'NlIl1'1' I-II III IIIIII-Il IIN :uvllx III. III'IIII:IIAIl5 IIIIII IIAII Ilu' I-mplnnsis on Ilu- 1lI'X'l'llIlllIlI'III III I-lI:II':u'II-r, I'I'llmINlIIII, Jlllll I:IIllI III III-II :IN I4xI'IIIIIlIIu'Il I-I lllIl'lNI Ilul l Suviur. MI illlflfll . I I ' I, It XII ' Tim llullflrwl Sl..I'll'I'lI LE. I I IIJJI II A I II II I I I I I ll VIR I f ,I V. I III? UI A I! III I II ,H ,,l If I III I I I I I, I M IIS? III I I I I I 53 3: I If 'I , I I X' i I1 .MQ .I I . X XI II? III I ,xx X. l View 'I 'IN X14 I If II-.. VIL A V0.3 sl IN. .wa Nl AQ, A N O5 A W. wha . . N ' - - --Q 5. 7' -' 'wax .ef 'K'---. f' f' f .xb.,,N- NX'-xnxx -.Xxx QNX- kv 1 . 5...-, ,af N i 4 M .s-..fM4:.i,::b:'gz.:-as, QL - ff: safes --ff Q I tx, N lm ,v 54, I l I A l rl it .p A li if fi up r. ref it l ra A k fy V' ig A "T lx ! r T if W I A Tj , 1 0 . . ' The Young W Omen s Christian Association X OFFICERS lax il ALICE PHILLIBER . . . . President ki i DOROTHY GIBSON . . Vice-President f DOROTHY :HAXVLEY . . Secretary l RUTH E- FOX .... Treasurer l fp RUTH LUNN . . Chairman. Finance Committee A CLARICE THOMAS . Clzairman Program C0rnmz'z'lee . T J: . . . l . THEKLA GROSSRIAN . . . . Clzazrman Soczal Commzifee It , V 1' Thirty-four years ago, the Young lVomen's Christian Association was organized l i at Alfred University. President Arthur E. Blain of the University headed a. com- T mittee to look into the advisability of such an organization for Alfred. This com- 1 mittee was a result of the action of a group of students at a prayer meeting, Sunday A l evening, April 30, 1893. The Constitution for the organization was drawn on the . A 7th,Of May, 1893. The commencement program that spring included for the first r time the First Annual Sermon before the Christian Associations. The trustees of the A school gave the Y. YV. C. A. the use of a room in The Brick for a meeting place. The g organization has flourished in the school and has done much to help the students. j One of its most recent activities is the "Big Sister" program. It i i l ...Y L-. A i 'jY111',f",, T "C , if x-To Sq? K-fx T S17 T,-gif f Y" T wo H 'Zl7ZIIl'8CZ Seventeen . 1 W4 fl v '--. 1, X 1 X v , .K f Q, X. , !,fj..,f1f . fm ,W ...W-,,,,...L .W--:QWH-'-www-A fif fffki'-.fR"',7A L -"- Wx W -Allikyiw : O-MM af 71,5572 -rfii.. ,,, jj, iT.f:5LT:---if-fx-...Tim fi, fx X. n f . .-E, 4- lg , I bf, A L fnfl, 4' ,. X1, f . is N K, -1 r. - ,val-4....im--iikhv m,,,x..,,,,q3-n,,.' 'u..L-.Q.--'-1..:J,,-:-f--281:42-4-' "Q-LA,-ff' -.-.,fA 'V -I X -f--f' ' --:iff M'--V' H" Q L, ! sv PMN" N V . 1. if A 3 uf. all F ill! ul lllxl lj ,ll ll lgrll 'l lf' Al fill l ll' fl l 'N 'il my lp! 'l Q-x 3 1: ll llfl Nl l' 5.3 il V1 vl ll 5 ffl l fl lp E p jill il Y S, J ll l .ep ,lll if ll All lgff I V .K , ll, ll f ,M fm gl l ll 2 M ,ly I l id . I Mlm: ll ll W 5 l lg V ll fl 's fill 'A' ll! l l ,lv lll ll ll 1 'i N l , l l lil N ll ' ll l my . 'Q I lf l ll , l DL- lm WL f K Iixy, I l l gl, I. l . lil ll F tl ht C1 b e oo lg u QW ll l X 'lg p OFFICER: gg' , . l Qs? pq ALLEN A. NELLIS. . . . Preszdent r l vu I A DONALD T. PRENTICE . . I ICF-PT6LS'1d6"Ilf gifxk-1 , ' fl xl p KATHRYN B. KELLER . A - Sfffwfflfy l gl Nl DESMQND E, DEVV1-T , BIlS1.7l6S-9 Zlfanager 5 all ll ' ,ll , 1 . 5' M hMl3l1,Rh - Q. f X. 'l Q' is 'X l9-.1 la 'Mllil KATHERINE D. DIENEMANN K.fK1'llIiX'N li. KEl,l.l-.l. P.xl'l. KELLY PX p . , , :N . llfjlg EDWARD K. LEBOHNER ALLEN A. Nl-:l.l.ls IVOXALD T. Pmzxrlch fl fix ll Tl mes m A " 'I Il y x 1 W' ll? 1' JOSEPH E. CLAVELLIC IDICSMUNII lf.. Dl':x'l1'l' Dolmllllx lf.. llU1.l..AXND lily Kill DAVID L. I-IYLAND l,l-:slr-:lc li. Rl-:x'Xol.Ds Els .. K' Twvnty-ollv yvzlrs ago, :l l'lC04l was fl-ll fur :l llralllullia' ol'g:uliz:ltioll lo unify tllv lllstrlolllc :lltvlllpls Q.. Wx' that llzul llcc-ll lllilfli' lll'0lll limv lo lllllv 011 lllc .fXlfrvel1':llllp1ls. Un l,l't'l'IlllN'I' Hi, 1905. "l'llllvr Two Flags A li was IJl'4V?S0lll.0ll all l'lll'l'llNlIl.S llzlll. 'lllll' l'ilSl. of lllis play 1'UlIIlDOSl'tl lllv vll:ll'ivr lllvlllllvrs of lllc l"ooillglli lkk lg Club. IL IS lIll,0l'l'Sllllg lo null- lllzll llvilll Nulwmml is il 4-ll:ll'lvr lm-llllwr. H3 1 . Tllv l"ool,llglll Vlllll IS il an ll'-pl lpl lllllllllg' lmlly, :lml ils llll'llllN'I'Nlllp is lilllilvll lu lillvvll llppvrvlllss A 3 lTlCIl1lllfl wollwll. "ll ISllH'pllI'lNDSl'Ul'lll1'C'llll!lUlH'0tllH'llllll' vm-ry lwsl play s llull ilu- Slllmlvlll llolly vzlll pul, ull.' Illlllllil,lH'K'll1ll'l4'l'lll1'IlllN'l'S wurmlml lll1'll':lllIl, :lllll llthl' lXH'lllj'-Ulll' j'l'lll'S lllv Vuulliglll llllllll1ilS X if lJl'l'llSll'lVlllf.fl.0Illllllllillllll.'llll1 P001 hl.lgIlllg'l'1l1'lllll1'Nll!lX'l'lv ulll ll ll nlllpl ll ll lllv l-lull ill its vlmi.-v of l gf? plays, lllll Il.lSlOlN'llUlJ4'1l lllul llml Sllllllllull will Mmm lu- ll llll llu ll 'W 'l'lllsy1':ll',plzllls wwv III :mlm lUlll1N!lll llll'0l'lll1l.YN,ZllI4l lll1'l'llNllllll'llAX Nl'l'll'N uf Ulh' :lvl lllilf R. llllslvl' X llIl'JlllSIDll'1'S0llllt'lsiltblllpflll1 lull. 'lllll M HIM'-2l1'l pl:l-x N lu-lv Ibl'1'Nl'llli'1l Ill Ul'll1'l' llul1'lvl'llll1h' ilu- pl-tl-lltlall llflllllilllf'illJllll-YIll lll1'lIIl1ll'I'l'lJlNS1 llu-larsl plz:-x Ul.llN'j1':ll'XN'lNxX nllll ll lllxtllkullllllllllll Xpplvjall-ll H Y ,x 'g Tim llumlrwl l'fiy1lrlr'1'rr L31 J all ,ig W' ik? l l l 7 is lil 1' l r Jrjvzl xl ,' f I 1 4 il 1. 1 'Ili 5 I fr All 1 . xl ll rl , T ,lm f . 7 V l. l . A 'X -7"1.f"n-Efg-LQ'f'1,3f" wk '14, e X ffi"f's aff as if - we TTT' TT.. .,-v'xH:,,- ,gg if f1"..l:'A1 ,"44g l"ZiL'2II..4-'.L3Pr"1 ifiili- lfred niversity ibrary CORTEZ R. CLAWVSON, A. M. . , . . . Librarian MAYBELLE S- VVARREN, A- B- . Assistant Librarian NELLIE I. WARREN . . . . . Reading Room Assistant The present library building was donated by Andrew Carnegie and cost 2330.000 The corner stone was laid on September 19, 1912, and the building was formally opened to the public on August 14, 1913. According to its present arrangement, the building has three rooms on the upper floor devoted to library work, the pamphlet room containing between five and ten thousand pamphlets. the natural history room, and the history seminar room. The main floor contains the working collection of books, numbering about 12,000 volumes. The base- ment contains books less in demand and is the depository for magazines both bound and unbound. The reading room on the main floor is supplied with one hundred of the leading magazines and newspapers. At the present time, there are 41,000 volumes in the library. The library is the dynamic force in the educational system. All departments of the University make frequent use of its collections. The shelves are well supplied with books treating on all phases of college work. Students and teachers are constantly making use of its "treasures" Hundreds of reserve books pass over the desk each day. Five hundred books are kept on special shelves for ready reference. More than one thousand students, counting some twice, enter the library every week for study and reading. The library is open on the average about fifty-seven hours each week. It is liberal in its policy and serves no t only the immediate community in which it is located but other communities as well. Books and pamphlets are frequently sent to distant towns and States. "The most reading for the largest number at the least cost," may be said to be the library motto. l 1 , 1 y al l lY . I , li xl 3 iii it I .e if gxffg 1-Q' a'Y,.xC Y Y' -f ' Y gg K fe 4- 1 X - e ,QJ-Q Ae 9 Ti ,C , ,Cf T 'wo Hundred Nineteen X l x .pf If P eff? . 1 ii fl rf eflfif yr-'i5l1"wfl tiff... e. ore-fa f'e-Q55 My Men ls Glee Club PROFESSOR RAY W. VVINGATE ........ Director The College Glee Club has been a well-known organization on the campus since 1915. In that year, the Glee Club gave a series of concerts on a tour through this section of the country, and a trip has been taken by the club each year since that time. The College Orchestra accompanies the club on the trips. The tour now includes the States of New York, New Jersey, and Pennsylvania. The members of the club are chosen by competition and the number that make the trip each year is limited to sixteen. Last year, the club broadcasted a program over the radio from a Buffalo station. A The aim of the club is to train men in choral singing and to advertise Alfred University. 4' if 'V' ' , Y f. , , V I , ... , Aw, -- 'K 4 " 4 '1 "W, 5' x N' . .f ,Y , Tim ll ll mlrrzl 7'uv'nly ea. as af , 4. is oy, 45 e.: a is ff aft ff e ig: ' W- " ff ssc ea be Aff if .mc infill N15 l vl 4 1 r i i 1 1 P t Ladies, Glee Club PROFESSOR RAY W. WINGATE ........ Director w v nl The Ladies, Glee Club is a new organization on the campus this year. It was organized soon after school opened in the Fall of 1926 and has now approximately forty members. The first public appearance of the club was on F oundersi Day at assembly period. The organization is the youngest one on the campus, and the enthu- T siasm and ability shown by its members promise to make it a very popular one. T' The aim of the club is to train its members in choral singing and to give the Student Body opportunities to enjoy musical programs. lf 1 CQ Q . 1 K1 ' ' L. Y Y 7 , - 1 i ,- -Q Y q Sf h i V 1 Q1 ' W TC V ' , ' " eg ' ,,1f1 T e 5 All ' s s 1 t -,,iiyQ ,fQ f Y ff T 'wo H undlrecl Twenty-one J' x ,fff fps X 1. K' I Xian '-R N'rweendimwfmmewwryplithf-fpmkfffgiwffmgjtef' ffTQ4js"'.,5 'T.T'-w'iTTsffii1ifrsqf5'if-sf J -qi? A-ffso f"1f.,i1"e"-2. Ty. wwf- 4: , 1 , ,cfs A ,JR xx, N. .N fnfxaifxx Mxlxi ' . ,KT ,-., Nr, ,, . QR-7,LlW4. Q! fx ' ' R., 5 kv ftifit Jil ' .T 'T ii? iil-l. M94 1 2. ' i 1, 3 liifi S ' E i i W' l W. W i lily' ' t ' i ' i . in it 1 . li ig -if i T 1 ill- H iv ifgti . T I it 7 i , 'li i t , it 'Vt . l : .liliff ' f 1 i ii 2,1 :an ' ' i ' i i . i wi ii g ia z ,f iw pi-y "V ii i, t tf f i' ii i f 'L Yi IV .z N W ti T . if it 'fi' Mr 1'i3'.Q .gs .kit ut? li tl if iiffi, vt Hit E. l Nl li v ttf i ,Mt .i,,. ai, jig 1. tif . M ff? lift '. 5 r, it . 1.- rf FP t li of t',' '15 rl, F. ,N ij 'I ii 1 l . T e ntramural Association W l 1. F. MARVIN INGOLDSBY . President NORMAN H. STOLTE . Vive-Presidellf CLAUDE H. VooR1-IBIS . . Secretary The Intramural Association was founded early in the Fall of 1925 by Coach Heers. It was the out- growth of a feeling that some unification was needed for athletics among men who were not of Varsity caliber, and to develop some of these men into Varsity caliber. The first step in this direction was to form a league in basketball. Twelve teams entered the league the first year. As a reward for the winning team. and to create more interest in the sport, a cup was offered. The winning of this cup for three successive years by one team entitles that team to permanent. possession of it. This year, cross country has been added to the intramural sports. a plaque being offered for the winning team. It is planned to extend the scope of association to include wrestling and tennis. Two men representing each team are elected to the association. From these men. a. president. vice- president, and secretary are elected who act. in conjunction with Coach lleers as the ofiieiating body. Any group of men may band together and, by sending members to the association. may enter a team in the league. A set of rules governing the association and the teams represented was drawn up by the first body. Since then, these rules have been added to and altered in such a way as to better benefit the organization. The association is altogether a success, and it is planned to make it one of the most active on the campus. 'l'uio II II n flrcfl TII'I'IIf.11efll'U ,Xp 1.1 11, I 1 1 1 l 3 .nt ' uw .l,, 1 1:9 1 -l , , ,.., N his AX' . X . if-Q...g:4fjlf!Sii' SNi1T-it-eqf...'iXf'iT'.s?f1: -.sf-ee-...,,g E, ..- A rerr x l . W 9 1 . 1 1 A 2 A il ll lk l 1 l l 1 W Ii T. l X 1 1 1 ft hs' 1 1 A A YQXW1 1- ,, A pf HK 1 Y il lgll 1 A A l lilzlli l 1 l it fi 11? p ll 1 1 fl 5 1 1 . B 1 rd! 1 ' ll " 1 3 l 'lxfl 1: lla l l X 1 1 , ' 1 .fl 1 5 I il X 'fll A fl li ' - A A1 5 , e Student Athletic Council 5 1 1 ' X. , A 1 OFFICERS , 1 p I 1 A ' WALTER L. M. GIBBS . . . . . President lx 1 RAYMOND C. FULMER . 1 If,'0e-pm3id0,,, 1 A lk 1 5 JANET DECKER . . . . Secretary A fl p K -, g GEORGE W. BLISS . . . Treasurer 1l A A ll. ff' A 1 ,Ella MEMBERS 1 1 ...M F V lv? 1927 1 V1 'll DANIEL CARUSO LOUISE COTTRELL AN.-XLTER L. M. Gnsiss fl 1 2. 1 7. 51, RAYMOND C. FULMER fly? 1928- lm 1 GEORGE W. BLISS JANET DECKER DESBIOND DEX'ITT W. FRANK LAMPMAN gf, 'lf ' 1 'fl A my 1929 1 lg 1 l lX1 l THEODORE ANDERSON ADELAIDE VORES 1 ,iffy 1933 LEE ARMSTRONG R.A1'MoND GERR1' 4 XA l',.l1if11l li f ' 1 liltlll The Athletic Council was founded in the year 1915-16, to act as an executive board of the Athletic A A 1. 1 . . . 171 lf' 5' Association. The members consisted of twelve councilors-eight from the college and four from the A ri- 1 11 J . . g 1 11X-3 cultural School. Recently, this has been changed so that the board IS composed of twelve members elected 51 ll from the college Student Body. A fl The council has done 1nucl1 in tl1e way of encouraging and promoting athletics in the University. The lx aim of the organization is to so regulate sports in the school that the greatest :mmunt of good will result 1 'jlq from them and that tl1e highest degree of sportsiiizmsliip possible will be attained. VW 1 . , 1 J 1 --- .-1-- 'Rf ' ff' V f' ' fi' TRS" f' if f ' E' ff Y ' W ' l A l lxf?fi?L1Tfie??'3f'+'R avg' 1 'im ifrxxfbkf ESXCJST f S' Q' in Xxx ECO Rf-:"'n 1? Wi CT T 'zro H zznclred T wenty-three G rts - QQ, ss T et ' I f -,,,,,-w,f1,f1L- l l i l v l r ' l l, it he Ceramic Guild i VIOLA BUHRMASTER . President l ELIZABETH SELKIRK . Vice-President RUTH LYON . . . Secretary l p ALTANA CLAIRE . . Treasurer to The Ceramic Guild was organized in ltlarch of the year 1917, its charter meni- F bers numbering twenty-four. The Guild enjoys the old English custom of afternoon d f ll x shi m and to keep its members in touch with ' tea, which serves to promote goo e o V- 1 l the outside World of craftsmen and industrial workers through readings and A discussions. The Guild conducts sales und exhibitions which :ire planned priinurily to secure i interest in, and ztppreciution T ing of :L delegate to the "Ainu1u ol. Guild work. Une of the newest projects is the send- l Nutionul C'onvention ol' the .Xinerieun Ceramic l, TI Society." This provides still lurlher eontuet with the outer eerannie world. li The :Lim of the tlerznnie Guild is lo slinuilute interest in iotterv :ind the :illied lp i . ,T arts. In years to eoine, il nniy he lhut the ineinory ol' hours spent in friendly exelninge l of spirit, or in united ellorls lowurd u delinile uiin. will he eounted not the lezist of VA the benefits derived lroin the Guild. lic! all Wil lil N Two II'll'llIl'l'l'll 'l'i1v'i1ly--foilr K lui r l l E. l l l 1 i .li l, it f ll' T Kill f l I . ,N li il Y 5 I i A. i l l 1 L , A llg i tilx 'i if lxlgm films N. i I 5 H s, ,gr ,i ' Q - - S I, ,,V- fff3l""i1fi15'f1s f gig- f 3, 7 ,.1"j,-fg-Qfjlfgfkggiplf--:QQQf,.IfQl1ig3g4 --.Q --,,,.,+-.I I if W rf' u -Q:--1-eff' ga- I V W 'IF' r N W I ,N 5 i ltd 5 l l il i ,K If l A i M a I ll A j lg j 1 l A r , 4 I I l , 9 Students Campus Court I V OFFICERS 4' p DANIEL CARUSO, '27 . . . J fudge i ROSS ROBBINS, '28 . . Examiner if GEORGE BLISS, '28 . . . . . . Examiner I l j j, Arising from a popular demand as a substitute for the former methods of dealing I , ' With violators of campus rules, the Student Campus Court was organized in the Fall pq of the year of 1925-26, and has become a powerful and efficient organization of the ip 3 campus. pl j fl The court is composed of a Senior judge, two Junior examiners, and a Sopho- I ll, more jury. Its purpose is to uphold Alfred traditions and the campus rules by bring- j ing male offenders and underclassmen violating the rules and traditions up for trial, ' lr l and to prosecute such offenders by suitable and just punishment. j lk In its sentences the court aims to make the delinquent ashamed of his misde- lf, I meanor. Only in the most extreme cases is physical punishment resorted to. All I I ll decisions rendered in the quiet of the court room are fair and llllpilftlal. p Xrll ll tdifi-,?1?25e?Q-?'?'e'1a ,Q 1, I ,A ,I so s I , T 'wo H fundired T fwenty-fZ've I like you and your book, ingenious Hone ! In whose capacious all-embracing leaves The very marrow of traditionfs sliowng 99 And all that history, much that fiction weaves. l"harIc's Lamb I I I lllll Illl Hlllllllll ll llllhllllllllllllllllllllllllllllflIIIINIIIIIIIIIII ll IlllllllIIIIIIIIIIIIIIIIIII1 X w ND s, ' I L r ,- W w 1 , 1 'S 1 ir 2 I 1 'S 4 LW N ixxjif XX EQZQ- Qff Qllllllllllllllll lllllllllll iillllllllllllllllllllllfl Ill llllil IIIIII llllllllllllllllllllllllllllll fllll lllllllllllllllllilllllillllillll lllsll-Ill Ill 55 X6-SQYQ X ii QE? Q2 W -1 P 11 MF may WF ' A 1 X Anvil 'Y lfh fk 4-Sli TQQQ- 'Nf2'1Ss iSs,3Si Nggj ll I IllllllIllllllllllllllnllliiilllnlllIlllllll I llll ll lllll I llllllll l l lllllllllllllllllllll ,oil-X ' ' ' L i Iiiiiiiimllliilli lliil ll lliiillliiilfliiifiii"ill lliilfi'ill un ITT' l ii'iiTiiiil iTi1i iwHl1'MWTHMl'ilfiilillP ' "li'i'll"" ' A' l HH'Hfff1fffffffff' fg A ,l""lu0?,'Tk in 1 A A E Fr' A A4 W hgll 'MA' Z' 'si X 'f-, K g' :QSN ,iw A J 1.5 lizifif -7 : J XNQ9 N 3,7 74i T , V, 1 - .,.,.y-,V ..,f,,fp, rx 1 L -C M llll lllllllllllllz EllrllllllllllllllIllllllll IIHlllllllllllllllllllllllllllllllllllllllll IlllllllllllllliIllllllIllIIIIllllllllllllllllllllllll ' X "X 1 ' E sonulIulIIllllllilllnllllmulm r.ulu I llnln Ilnmu nlul :ml nn limun 'llllllllllmn.Illllllllllllllalllnlflnl llll lI'HIlllAIlIHlIII Illllll lIInHI.II.lllllllnl AullllllnH1llulnvllnlflnvlflnmn,Iva 'J tl Al A1 - W 5 v A ' Q' A . K :- . V 1. E 51 4 3 P Q- 1 E Q T h ,JA H . A Q E lvfj Q It ng A mil' E - "' ' WJ +Qs f . 'N 9' ' U E Q ' Ns : E xxx xx! ' ,' , : S 5 fx xk X A ? V, 05 E ...,QQ.. E 3 A lg Q 7 H ."' Q", Q f E L I' Q X fx E - ' QI. A 5 " Q 2 g 5 5 . fVfJ2SQ,l" 553 5 k 5 E 'QI . lx w a . - A1 , : 5 0 , 3 5 . . - 1 E 5 I. , QQ- - J, X ' E A 4. ' : i '-N "" ,g '- 1 Q '. , E . "B E ' - if -q . 5 , 'A-51 g A E B F-,4"J, 0 flex I , 5 ' - s ' ' 4 2 S ff-F n ' 5 A A ya ? X'-iu3fs1-f 2 - H 'ls E 5 ..-, 42 E 0 J Q A A 4 A ii? V , Hi 4 1 ' - . P 5 . f N ' I ' ' .' . h lllllllllllllllllli ZllllljllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllIIlllllllllllllllllllillllllll lllllllllllllllllllll ' V A v , U L F , , llllu..'.h,f':: 3 , - I A . . I . D ,-"N A55 f Cp J " W Y K V '7'2'x 1 ' , 1 l f 0 xx Q X XE:-,Q . j ff, 9, 1 WN I 1 I.. . ' - - .I M 2 X- A 54 - A I A S-, . ,flllllln-9l:i: X lllllllllllllllIllllllllllllllllllllllllllllllllllllllllllllllIllllllllllllllllillllllllllllllllll llllllllllll I ll m 2 c WE 3 5 45 ?ff ' 5 2 45 5 E innummmuummmmuunummnnuummmmummmmummumuunnmumummmmmum: e E f K fa -Vx-.Q A E , f , f7 I fy P f f EX gf! .iliizfd , E gllllllllllllllllllIIIllllllllllllllllIllmlIllIllllllllllmlllllllllIllllllllllllllllllllllllllIllllllllllllllllllllllllllllllllllllllllllillllllllllllllllllllll . I nniumm. f 1 VA ,V p iiirr Ba s is - - Y, v l i l i V t 7 li ,, l .li t F 7 l i l T t I i i i i 1 4 t I fi it ,. .4 5 1,,- .4 . Ev ounders Day rs a 'o a Group of thirtv-seven students gathered together to Ninety-one yea g , D . . - h organize Alfred Academy. There, 'gunder the watcheare of sentinel pines. the pioneer v ' " - ' -- r l fa se of .Knowledge and Truth. college of Western New York vt as dedicated to t ie L in "She was founded in toil. ee . l t And nurtured through yearnings and tears. Her treasures the hearts of brave heroes who stood fl Undaunted throughout trying years 1 d fi belief in their standards. these noble men tri- v mented with blood. I With staunch hearts, an a rm A A . . uinphed over disappointment. discouragement and misfortune. They gave their lives. T i unseltishly, to the service of their Alma Mater. g "Each stone was a prayer and her battlenients thene Have mcm'ries of purposes strong. 'i Staunch daughters and sous are her monument fair. ffit And they lift up the grateful song." The beautiful campus and the buildings of the modern .Xlfn-d. with her loyal 'Aft Alumni and students, are a. living monument to the devotion and self saeritiee of ,v those who were the nucleus of the Vniversity. "Kenyon and .Xllen and Blain. and Q the sallam Ymllltl ll'1lll0l',"lloothe t'. llavis. are but a fexv of the honored and wvened men whose faithful toil and able guidanee have made .Xlfn-d the xv onderful institution i that it is today. it to ii r 1 - , . l , . lhe ceremony ol lfounders llay ls nmrlved by the debnt of the Seniors ni aea- gi demic costume. As the long line of eaps and gowns ninds its stately nay into the .A assemblage ol uuderelassmen, it a'7fords a vivid t-ultlt':isl ln the thought uf that origi- nal small company. Tie vivid impression is ably expr.-to-tl bv, ".Xlfred's pride lies in nianlioodk 1'll'1H'l'Nl'N lv 'xml wfllllilllllilllilk ltlgli. stainless name." Etsl -.. A its In, I , W T 'L , , 1, V Two llunflrefl 'l'll'l'Hf-ll'-I'tigflf Y Va A - - - HOLLIS HERRICK The Loyalty Medal It is impossible to express in mere words the influence which the character and personality of Hollis F. Herrick have had upon Alfred. In appreciation of his splendid example of true manhood, the University has bestowed upon him the greatest honor in its power. Herrick has won fame for himself as well as for his Alma lVIater by his excellent records in cross country and track. For two years, he was captain of the former and, at the end of the second year, led his team to an overwhelming victory in the Middle Atlantic States Championship Meet. There, he also established a new cross-country record and became nationally known as the new champion. Athletics, however, were not Herrickis only accomplishments. He was a good student and was a member of the menis Honorary Fraternity, Phi Psi Omega, Klan Alpine Fraternity, Varsity "A" Club, Student Senate, and the Athletic Council. In spite of the great number of his activities, he proved himself capable of doing every- thing well. Contrary to what might be expected from a man with so many merits, Hollis was very conservative and quiet. His modest, unassuming manner was one of his most attractive characteristics. He imparted a feeling of friendship and clean sports- manship to everyone with whom he came in contact. Although Herrick has left us, the spirit he has created here will remain forever. In order to show their love and respect, the students of Alfred have awarded to him the symbol of their highest esteem-the Loyalty lVIedal. f Q 4. T wo Hundred Twenty-nine x. , Q- ' V I, , Wg., 5 1' Va WN Q1'iFf f ' 4' Y Q cl ss . , - - - , 4 l r l l r 9 st i i l n 'Q t, if C+ R," NM' --s--W- F 15' v THE SCRAP Procs The night is black as ebony. The campus is hushed. Over all, hangs an air of intense excitement. Silent iigures slowly travel around everywhere, following the thin, piercing rays which dart from their flashlights. "A Procln The cry resounds through the stillness. Instantly the campus is :aroused to activity. Eyes, heavy from lack of sleep, open wider so that their vision ' ' - ' c " Tl be 'il' may be keener. Feet, tired from wearv tramping, hasten their progress. me xx dered Freshmen feverishly searc 1 or 1 l f the Jroclamations posted by the domineermg Sophomores. "Frosh! Frosh!" A single voice raises its call for aid. A gron m of So ihomores ra . has attacked a solitary Frosh. "Frosh!" Others take up the ery. In answer to the agonized cries, Freshmen run to the assistance of their eaptnretl hrother. They are too late. "Splash!" The waters of l'rexy's liathtnh open to reeeive the liotly of the unfor- tunate boy. The Frosh seek revenge. They rush upon the enemy the Sophomores. Thereupon ensues a Proc Fight, far-tained in song and story. Meanwvliile, the Frosh girls are husily oeeupietl in searehing for "l'roes." .Ks a rule, they do not enter into the strenuous fighting. llowever. not many years ago, a "19Q9', hanner chaneed to fall into the outstretched arms of a eo-ed of the t'lass of 1928. Because ol this, ISHS and 19129 elailn the honor and tlistinetion of staging Alfrcd's first and only girls' l'roe Fight. Ding! Dong! The chapel hell proelaiins to the lighters that it is 63:30, Pros VVcek1s over for another year nnl il other l"rosh and other Soplis renew their relations as friendly enemies. ...,-W.. ,X ,,.-. --, .-f-"W-' ,,f""" 1--., .,..-M ,V--X , 4' f -..,.,,.f-is i, WWI., ,.,-..,r ffwwkv I K A N-,-WQX ' 1 Q, tk-N 'SX 5 e. ' Two Ilumlrwl 'l'lu'rly V s N T cv The Legend ofthe Black Knight Once upon a time, many years ago, there stood in a corner of the library annex of Alfred, an old black stove. It was just an ordinary old thing with nothing remark- able about it except that it had an unusual and solitary decoration. On the top of the pointed hood of the old stove stood a small figure of a knight in armor. When the ancient heater was discarded, the proud little image disappeared from its accustomed position and, when it returned to public view, it was in the possession of two room- mates-one, an odd, and the other, an even classman. There the legend becomes very vague and nothing more is known of the history of the unassuming object until it has been raised from its lowly station to the high office of the recognized mascot of the even classes. It is known to the students of the college as the "Black Knight," and is the symbol of the spirit of the even classes. Throughout the years, the Black Knight has been the object of great contention between the odd and the even classes. The former have continuously sought to obtain possession of the mascot of their rivals. Many hard struggles have been inspired by this desire for possession, but for a long time the enemy failed utterly to lay hands on the zealously-guarded figure. However, a few years ago, during the strenuous fight- ing of the annual conflict, a small piece of the statue was broken off and captured by the forces of the odd classes. Since that last great ight, at the request of Prexy the antagonism has ceased. Nevertheless, the Black Knight still remains the mascot of the even classes, to be handed down to the "Little Sister" class as representative of the ideals and the spirit left as a legacy from those who have gone bCfOI'e- ig, i if ,Y -W , Tzro H zmdred T lzirty-one 'Q 4 e ' v v-9 l l t The Last Moving-Up Night The Class of 1928 guards among its most cherished possessions the memory of th t hilarious event-the last Moving-Up Night in the history of Alfred. After a numerous vivid accounts of what had been done in previous years, the enthusiastic Freshmen, in an attempt to make a better job of "painting the town red,'! over- stepped the boundaries of sport and entered the realms of destruction. Therefore, an old tradition ceased to exist. as the exciting event which marked . for the Freshmen the breaking of the shackles of lowly servitude. To take its place, Alfred has adopted a new institution. and the C 'lass of 1929 presented to the college- xl V v l 1' '1 ' 9 The lr' irst bpring Day 5 Like the calm which follows a storm, or like creative spring which buds forth 1 from a destructive winter, Spring Day is the peaceful successor of the chaotic llov- y 1fl8'UP Nlghts of former years. The central idea of the whole celebration is one of f construction and tranquillit y. Q r The new custom was inaugurated by the lfreslunen of ISN!! in the spring of I9-36. llhe programuof the day's events included the presentation uf the Loyalty Medal at 1 all IISSLC-:xmblyi 111 the morning, a sport schedule in the afternoon. including a Frosh- Soph lug 0 VVar, and a "Block Dance" at night. l Spring Day, altsl.ioug.5li in its infancy. has already proved itself worthy of a place H among Alfred s traditions and long.: may it alvide! 1 T 'TZTYYE4 'e'e ff-'7fT:':--if 'P so 'c,, fl pV-c T ., 1576 Two llwmlrefl Th itrly-I wo 't M x 1 K. T , X? x +w,'.kkx -W4-'-.aw ,...-...,,,n D-Almbxs A 'Q -X . V ""21A'g.i.......'QTf'bT""--,,,f"-'--f--4-,q,,u--+ f. x, -q ff -1 NYM- ' X , P , Q ' Q. m"'A'J'i.?13 X 'QSM """IL1jj?1'w X . I , - -Q .1--M1-......,.,--' ......,,, -,Q , l mf fl X A s H 1 r' i ix r A ff ,K 1 Y X A K v' AX in ' i v , J w ul 1 x , 1 L .ml A1 X W W Xxx, 1 x A E Q Q ' x rw W ixxi I www y 'L-'L i xy 1 v' . :X 1 Ui W ' N Z Vx 4 W I M H J ,': Y -4 I 11 Vi gps v V ' Y W I Pm iff + l , -1 1 lik Exe? W I F- I FW 2 ' A AA, f: 1 4 . 1 , A73 WM , Hx! f tk A 1 N ,gl w x, , Q5 W QW 1 w in 15 fd? " W 4 ' M313 4 Iv 'I it ji, ag E A A 5 137 ! if 1, N lg HV? W H - ' , , A A, , J X, 1' 15. -42 ,M ,, .f----yr-fm-ip' NC NK -5 'f if imi: E - - fffjif xffx i' " ,ff ' fn. , "',4f"livQ3w'f u .,,. D--'iff ,,,-:Q-2, N- -- " , fi.QfA-'fy Aff! Two Humlmz Thmy-fhfee I 1 A gg gf gg . g g- Debate Delivered on July ll, 1926 Place: Hall of Mirrors. Versailles, France RESOLVED: That the Alfred co-ed is not lowering the index of the Alfred male under- graduate. . The Affirmative Speaks "Honorable judges, VVorthy opponents, Ladies and gentlemen. I shall attempt o-ed has in no manner lowered the index of the Alfred male to prove that the Alfred c under raduate. That is the great problem confronting us today, it is a very serious S ideration. The world watches our assemblage one, and requires our most earnest cons and awaits our decision with bated breath. lVIy time being limited, I shall begin at once with my defense of the co-ed. "The co-ed, like the rest of us, is human. The spirit within her cries for companionship, and that ery must be answered. She craves her Lochinvar, garbed in a football uniform and riding a fiery collegiate Ford. 4QThe dis- sffgjziae tinguished delegates give vent to long and prolonged cheersj "Statistics show that it is actually im possible for the co-ed to lower the index of the average male student. because the lowest obtainable index of any student. male or xtlwy female, is minus two, and the index of anyone foolish enough to consort with co-eds will be, if it is not already, minus two. Therefore. since he will inevitably achieve that index, how can she, our serene, sedately-dimpled little co-ed, lower his index any mo re? Then, too, how could anyone so weak, so defenseless. so puny as a co-ed generally is, lower anyone's index? Quoting from the same statistics. we find that nine ty-nine and forty-four hnndredths per cent of all men who go out with eo-eds have dropsy and heart-failure--when they drop in a chair. they haven't the heart to get up. QThe assembled judges nod their gray heads in agreement.l "And, gentlemen. isn't it. love for thc Alina Mater that keeps the co-ed in the stands at a football game? It is her vim, her vigor. her vitality that in reality give our boys the strength to go on with football. How could we have a college without foot- ball? Indeed. I advocate very strongly that we increase the number of co-eds. so that there be enough to go round. This would eliminate working in shifts. and by a judicious system of exchanges Qwhich our Student Senate could work outl. we would be able to get that variety which is the spice of life. t'l'he audience unanimously rises and gives a long, long yell for more wonien.l "We of the Aflirniative will have to admit that some of our co-cds aren't so much from the neck np. and tial others aren't so ninch from the neck down. hut ,........ OH 'l50Y,'l'IIOSl+1 NICVKS! ! ! Y ! 3 !" 'A' e e HC' eNiQ,1-ff'-sigl:--.f ees.,-----.----Ks- .-W-N ..-Ng .-.aft .- T r ' - 'x 7 Ps. - . 1"I-'ruse "1-- -fdww-. '-r"f"v- 'L Hs- 'Y 'ra ...4.. .-, ""N.-f" M A' " i X.. ,. 9' KT?-9' - 2- .. - 1-75 f . -s X P' Y "' s ' ' "TK ff A '- 'Q-e11fe'f2-941-ff534fffi3f'1T13llfLi:i?i-- ...fi lg. .- Two llmulrczl 7'ln'rly1f'our ,WX -E . .. X 'E , 1 513? , .., . NW A if s " 4. ' .nv E it 1141 Th N . -. . 1 1 x 10" f S k ll "ll 11 - 1 L A L M1116 'Q pea S V fi- I "mlm H' JW "PS l'ulies -11111 uellllu i i 11 4 5 1 1 . 4 I .x , 2' ll! lowereal the llltll'X 111' uw Mf,.,.,1 m-110 :I A1 1. H mi people- Has the Alfred co-ed N1 H X . Q u - 1 111 elgiaduate. She certainly has. B f L A uuliug to pmxe that point. l would lil'e to - 11- ' . 6 Ore PTO iw let me define the term eo-1-rl .X A. x'i -X I .dbx a question- Why IS a co-ed? First, it 'f l"lll ll'lX'l' 111o1'1- 1l'1t1 rl-1 - i i to-U lb 'I glrl that goes to 3 b0YS, SCh001S0 that She 1 A H x i x U x i ll K lx 5 ou can all plainly see, 1S the beginning of the Start of I It tllllllllt 1111 uxeul ol the huul c11lu1111at1on. which is the end CA Sal , f I A Wai SIFISCS from the 11eg:1ti1'e I'1lllliS.l i lo O app ause ll "Doe: the 1' 1- 'I 1' ' -. ' wg r - ' A4 mum to 1 In r f itil T0 mit Q11 athletics. ho, only for athletes! Does she go to the W 1 gl x i xxx 5 ii . A 1, . 1 gl 1. 11 1 1111 1 o. only to see the pretty uniforms. Does she ever know 1 J p w mt the game is all about? Hardly. At 3 basket 11 hall game. she sweetly suggests that the men be y XIVCII two lmsketlmlls so that they will not have to y Q1 fight for one. 'ls that littlef g ellow there the quarter- A back? Do they have to add up all the numbers 1 1 he is yelling? lYhy Cl l i o t iey all get down on their p knees 111 the dirty mud? Aren't they foolish?' A Is tl ' - ' '- ' ' ' lere .1 111.111 111 this great institution of ours Who .1 has never caught cold from sitting on the steps of. tl1e Stelllllellll in the cool night air? Or is there a y man who has not gone out expecting a hot date, and was left cold? To paraphrase in better Words 1 than the original: Breathes there a stude with soul so dead, Wiho never to himself has said, 'Darn that little F rosh co-ed?,, p COceans of applause. The audience rushes down and embraces the genius who is so l nobly defending a great cause.D i "And so we suggest our solution to this great and trying problem. It would be 1 l 1 better, physically, mentally, and morally, for the Alfredmale, instead of taking if 1 courses in astronomy by moonlight, or courses on the topography of the Alfred land- 1 1 ' scape, to take a correspondence course With some buxom, corn-fed, unsophisticated lass back home. Fifteen minutes a day could certainly be more easily spared than 1 two hours every night. A kiss by proxy Cdesignated by XD f'CI't-SLIUIQ' .caffleus less disease germs than any other kindf, CThe crowd 8095 mad In a df-fllflous not of 1 7 enthusiasmj Affirmative Rebuttal H "Here's to the fair co-ed, long may she 001116, and Well may She Wed- Negative Rebuttal on 1 "There goes the poor co-ed Cif the good die YOUHSJ, Why have the dead' A The judges consult and then decide ' ' t0 Inumg up the question at the next meefine of the World Courf. I , i iiii Two Hundred T1l1'l'fy:fi1'9 14. ff-ff.,N ,.. rf 'X xx . '.f2""-x f 1 yi 2 V ,X , u E ,lf l r X " " .-f""- f W -fi Aww.-Y aww f'--,-f"""f, ' 'ff K 'Nl fi"'K"AffQQTf,T""ff-are-i,i fwfr' fffw-,fT1Q,Nr --4-f " -' A Q' ,N Wg' ,Q ppki 7 ,--1L""j3f'56 s -gf-, 'ffzl-ATTQZQQH' . Har'-171fx - X! .X RQ- '- V'-ix N --A Nwxx ff . ' - '12 N, - - , v ' 7 Y I ,Q P , N W L ET, f X 25' SY 2 N i ,V ,1 a V1 1 VF 'EJ 21, fffy 2 1 j ly ' ix' , 55 W VO' 5 K I' i 1 l f .1 + 4 J fyj 5 fy 1 U ' , I ,avi ? x i1 14 , P332 ' wg I 3 fr - J V, i Ni wr, Ik PA ll f ' f' fl 1 'ww , F53 H 5 ri vf- ? ,. fry! z' a W V? , ,lx 1 :X ' uv fx kim mi , NX yi '45 S E" 33 Aa, P Hi fa A 5 'HN ,xx hx! fx, A wif z L nf, gk A fi 4 M 3, 1 X fax! ,x 'Q fi, X. ix' xii Q A ,' A 1 ' Ai? K 2,1453 XFX A ii x 3 , URI III Lfxx wr, 1' LK 1 fm H5111 J , Klux' 1' 'nj QQ 3 x 1 .4141 gl -E it ESX xi' X 3 .1315 , W ki-hifi x fi mf 5 U! fy :U 'r ,. 'L fi. Tun llllllllffll 'fflrrl-If .-.'1.:' S K, K 1 QNWA m w if 1144 , X-., , -..A -f --'f'y-fly... Nw---.,,,., 44 1i'A:QT4'3jj,Ai x N-Qu'-' -fu,-gnrfygi' 1 v 1 . 1 1 1 NV1 E V E .A .M X N 1 xg 'K JK RW: , 51 XX, W 13 14' 1 1 1 T 1 1 . , W F , 1x11 N .1 1 xrif 1 K 'I 1 1 1:11 V 1,,'1 1 ., 1 ' , I N . , 1. 1 H. , :fi . 1 1,3 J ,jx i Q W1 1 , , Y 1 N 71 ,iz f , 1 xii. 11.1 41 1 Y 1 ffffi 1 A, 'iii yr? 1 1,-' 1 f"'1 47' wif 1 1 A 1,75 aff f1 RL ' 1 Ai? .ji 1 Mi N H1 lr fa 5 Mg 1 1 1 ,fi ij ', 1 S s, J 1' i f mia' 'f' f P ? ' -. 7 E ' , 1: I' X f 'R 1 ?-1 if 1 1 Y. '?,-AY' n11"""""' ,,, L' 'ww I ' ' " "'-f"""""4""'.'.',?"ff' Y "'-Q:'f""N-cj' L, if A ' ' X b " 'W -' NH'Q,Q15f'JiY3X Qiiwiw Y A Y W - , ' 1 ' - 7 1 ,I ,.-. Jfdw. j,,,f:,:L f,,5,,,yy..v-,, . L. 4 U40 , ., ,. ,- . ,.,'-'W 1 1 " 4 , 'g"'i'-- ...-X' --x -..N-. fu..- Two H zmdred T lzirfy-seven 1 vm ll ' I v 5+ I tw ' 1 3, M N fl r 14 f Q 4 1 ij! M A '-3 Q. x 1 Q gf it Al RX XY Rx . X .L X! V E':, N lllIll'l'll 'l'lll4I'f.l1 rig A JK ,? V! Wx R 4 fi1 f-fA .,1,1f-MQ., U r J' ,444 ,V Jg. fflf-'2,f..a:g':x, ' .v v.........' . 4, ,,. Y , J 1 ,........v .,uN,,,A, 'lu-Q,,m:Th3 V4 , x 3 1 rj 1 I .K u X ! V! A - ' 'V A1 SX I 1 W 1 XL KV -, r N 1 , wk K fi Q , giw f 4 W Q , :X,:! W . XV , ,V 115 , .+g A ft ilxji QW If I ,vw 1. mg M 4 'xy' Tv 5? UM! f lj' f 2 1' 'J i QW 3 Nfl s , X fi 1 iw fab + 4 M 12 9 , x x 1 , .I fb v fl. if A if' Wi i 5? All xg X N 1 555 , s is! I I , + Q : E7 Y ' 5 w Y J ' ' 1 I A I .ff ' W. 2 1 U AQ' rv- , ... ,, , W ...W-f.,, ---- W--uf-"""'Mf':fi:Tg11-'lf'iixkffll- 1 aj ,M b , Y .,. W L f N -- , , -f F. , ' ,-f', -x j---f1-j- ,Nix L 11: . V" -""f""'f': g. , ' -' jfg .,- ' ' ' '. ' " ' VMM'Y M ! ' ' "'f M T200 Hzmclrefl T lzzrty-MN6 ' 1 The End 'U D M ' 1 F 0 I, ol Ku 0 :J 99? 0 00 Y CHICK' ALFRED CCJLLEGE COLLEGE of standard courses in Liberal Arts. Science, Applied Art, and Ceramic Engineering As good as the lies! For iiifoi'imtimi i'cg.ii'diiig ciiiiiwx in l.iiwi.il .'Xih.Syicim'.l7vI.i1 Enginccring. Appliixl XXII'-, Simiiiici Srlii-i-1, viii. .iiiiiicw WALIUQB A. TITSXVURTH ' R Iii I I STR A R ZXIVRIAIW 3: Nixx' Your i 'I H New York State School of Clay Working cmd Ceramics at ALFRED UNIVERSITY ALFRED, NEW YORK Q Cowrses in CERAMIC ENGINEERING and APPLIED ART Tuition Free to Residents of New 'York State CATALOG UPON APPLICATION TO CHARLES E. BINNS, DIRECTOR 243 NEW YORK STATE SCHCCL of AGRICULTURE 6112 ALFRED UNIVERSITY THREE 'YEAR AGRICULTURAL COU RSE Home Study Courses in Agriculture ONEfYEAR RURAL TEACHERS COURSE A. E. CHAMPLIN, Director as E T ,,..............- MQ. Suret Bo , ' ' ', y mfs V Casualty Insurance surf f vhixq? N , M N 1 i 'x li RESOURCES OVER 550,000,000 ESTABLISHED 1896 UNITED STATES EIDELITY AND GUARANTY COMPANY ALoNzo GORE OAKLEY AND EDWARD R. LEWIS, Managers NEW YCRK, N. Y. Guaranteed Attorneys and Agents in I7,000 Cities and Towns 75 WILLIAM STREET EQUIPPED With many years' experience for makmg photographs of all sorts, desirable for illustrating College Annuals. ss- Best obtamable artists, workmanship, and the capacity for prompt and unequaled service. ' Photographers to 1928 KANAKAD EA 220 WEST 42D STREET, NEW YORK Q45 Compliments of i The Collegiate Restaurant i i1l....l.-1 FIAT LUX UNIVERSITY BANK 42 ON TIME DEPGSITS "9'G1z.u5't The University Paper ALFRED, New YORK The right electrical appliance makes your housework easier A 1 94 1' - ppefnav Jernre g Z, gxwcf' N' N X ff 'i ii' 'T Q Ill"'llil:p- -nllh. A SMITH ELECTRIC STORE 190 MAIN STREET PHONE 31 HORNELL, NEW YORK HoRNELLfALLEoANY TRANSPORTATION COMPANY 'Wm Q Auto Bus Service To Hornell, Almond, Andover and Wellsville. Brings you to center of the town. No long walks or expenf sive taxis to hire to and from rail' road station. Through service now from Alfred to all points between Wellsville and Hornell. 9 cd If '-fvvv"zJ Z,',,o' , Ili? ' 5 E BI P1oT1oN B1oGRAPHY PoErRY oH1LDREN's BOOKS TEXT' BOOKS ALFRED TELEPHONE AND TELEGRAPH OO. -e 9- Local and Long'Distance ' 'Gelephone Service -Q - ALFRED :: NEW YORK i 3 i r I I I I I 4 i I I I I I 1 1 1 F 5 4 I 1 I I z I I 4 i r I I I 1 E. C. WILLARD GENERAL MERCHANDISE Better Goods at Better Prices 640 ALFRED STATION, NEW YORK FOR Dance Invitations, Programs, Stationery, Menus, etc., go to THE "SUN" OFFICE 006 ALFRED, NEW YORK HILLS COFFEE AND GIFT SHOPPE ALFRED, NEW YORK Special Attention Given to 'Geas and Parties MRS. J. HAr.1lL'roN HILLS, Hostess R. K. ORMSBY GRDCERIES AND MEATS INQLTLQA: ALFRED STATION, NEW YORK R. A. ARMSTRONG T H E AND co. CORNER STORE EVERYTTSS QXISQSRIDIVME Groceries. Fruits and Vegetables Remington Portable 'C3ypcwrircrs CO7lfeCtio7'L,7-ies ALFRED- NEW YGRK G. A. C-onx Airnw. N. Y 'Your satisfaction makes our success JACOX CROCERY Groceries, Nfcats and Fruits AI"'lU5D. Nnw Yami: F. H. ELLIS P H A R M A C I S T I'rxrlqvv'. Mmm' .md Wan-nnavi Foimmin Pens AI I RH' NI W YORK ,.,,......-1--ll" B. S. BASSETT Kuppenheimer Clothes, Walk-Over Shogs Hi'Lo Hats, Spalding Sweaters and jerseys, Arrow Shirts and Collars and all other finngs that College Men demand ALFRED, NEW YORK 3 DR. W. W. COON DENTIST OFFICE f , , 55Y4 HOME 4 ' f 9F111 ' ALFRED, NEW YORK ALF RED BAKERY Fancy Baked Goods and . Confectionery 'P+ H. E. PIETBRS ALFRED, N. An Ideal Savings Institution- ALFRED MUTUAL LOAN ASSOCIATION ALFRED II NEW YORK Assets 3423,000 COMPLIMENTS OF Plaza and Belmont Restaurants HORNELL, NEW YORK C. C. WH1TEff Corner Store Cigars by the boxg Candy by the boxg Ice Cream and Hot Chocof late. Come in and wait for the buses. Leave your packages and eat while you Wait. Corner Store. HORN ELL, NEW YORK For Photograph Work, see RALPH L. BROOKS ALFRED, NEW YoRK W. H. BASSETT TAILOR SHOP so- TELEPHONE OFFICE Dry Cleaning and Pressing ALFRED, NEW YORK BILL BROWN ff Your Tailor C. L. E. LEWIS UPfTO 'DATE BARBER ALFRED, NEW YORK PARLOR UNDER Posr OFFICE ff ALFRED, N- Y- Students are cordially invited to visit THE JEWEL BOX Diamonds, Silver, Watches, Jewelry Novelties from the WorIc1's Artisans CONDERMAN BROS. ff jewelers AT 12 CANISTEO STREET. HORNELL, N. Y. THOS. F. LEAHY Dry Goods +4- Women's Ready' to fWear Garments and Millinery, Rugs and Curtains HORNELL. NEW YCRK "Say It With Flowers" WETTLIN LEADING FLORIST We never send out what we wouldwft send home HCRNELL, NEW YORK STAR CLCTHING I-ICUSE Home of Hart, Schafvier if Marx Clothes 'P+ MAIN STREET AT CHURCH HORNELL. Y. JQE DAGCSTINO Govisorial Parlors We specialize in Bobbing, Iviussaging and Manicuring. Three Expert Barbers and Lady Attenclzmts. HORNELL, NEW YORK CHARLES-I. Mclxrvse -' H. PRESTON WHITE ' fffsrrii THE McINTYREf WHITE CRCHESTRA fiblzcsic of Qllclll-lj' IOZOXV Hosxsu. N. Y. PECICS HARDWARE 'elf it's Hcrrclzocwe, tliivzlq of Peelis' ? 113 MAIN STREET, HORNELI., N.Y. MAJESTIC THEATRE THE PICK UF TIII? PICTURES AND Y.-Xl'IWIiX'll.l-Ii Sperm! Rates for 'Tlmzm' Ilamcs HURNI'l,l.NI1XX' YORK Gardner E99 Gallagher Charter House, English University Clothing Styles HORNELL, NEW YORK In Hornell and vicinity it's JAMES' FLOWERS Why? QUALITY, SERVICE, RELIABILITY The Largest Floral Establishment In This Locality HORNELL, NEW YORK Chas. Dean Drug CO. Drugs, Stationery, Dotlet Articles, Photo Supplies, Cameras, Candy, etc. 3 WELLSVILLE, NEW YORK THE BABCOCK THEATRE WELLSVILLE THE BEST IN PHOTOPLAYS AND ENTERTAINMENT WELLSVILLE, NEW YORK PECK MOTOR SALES Lincoln 0? Fordsolx CARS ' TRUCKS - TRACTORS FREEMAN ELECTRIC COMPANY ELECTRIC FIXTURES AND SUPPLIES Ph n BROADWAY GARAGE I O C 340 90,98 BRQADWAY HORNELL, N. Y. 40 OANISTEO STREET HORNELL, NEW YORK BASSETTS O. E. BABCOCK OO.,1NC. TONSORIAL PARLOR WE SPECIALIZE IN LADIES' AND GENTLEMEN'S HAIR CUTTING I as HWE TRIM YOUR HAIR-NOT YOU 12 Church Street Hornell, New York "The Department Store Where Style and Quality Reign Supreme" - HORNELL, N. Y. HOTEL SHERWO OD E. M. CHASE PROPRIETOR Banquets and Parties . a Specialty La 'J P HORNELL, NEW YORK SOHAUL Es-9 ROOSA CO. The Store of .Quality STEINfBLOCH CLOTHES, KNOX HATS MANHATTAN SHIRTS 117 Main Street HOrnell, N. Y A. MOHENRY E99 CO. "Jewelers for Seventyffour Years" HORNELL, N. Y. A Longines and Bulova Watches All that is Fine in jewelry MARTIN'S BEAUTY AND BARBER SHOP Shampooing, Marcelling Manicuring and Facials PHONE 94 EOE APPOINTMENT 153 MAIN STREET, HORNELL, NEW YORK HORNELL WHOLESALE GROOERY CO. MAXWELL HOUSE COFFEE "Good to the last drop" -I-I' HORNELL. NEW YORK More than Eight Hundred Stores in Fortyfsix States J CPEWEYCS OPPOSITE THE PARK HORNELL, NEW YORK DI!-I N NA975 R t'GeP wo and what does it mean to yguv KANAKADEA l 928. Thousands 2 will read it and pronounce it interesting u and clever. .Hundreds will read it with C' - vivid attention because it is an historical record of a living year in their college activities. Many will read it in future years and live again in memory the days that are now so real. Some -those who have Worked so arduously to make this book a success-will turn its pages with jus' tinable pride in this noteworthy product of their efforts. GC It has been, indeed, an 'apprecif ated privilege for us to be again associated with the production of this book, even in the humble capacity of publishers. The volume which we shall place upon our shelves will be a permanent reminder of the interesting relations we have enjoyed with the officers and staff of the l 928 KANAKADEA. GC We wish them, and all the mem, bers of the outgoing class, the best that the world has to offer. May the enthusiasm which they have shown in their application to this important Work be the means of their gaining many other laurels in the years that are ahead. BAKER-JONES -HAUSAUER- INC. fBuilde'rs of Distinctive Qollege AWHUCIZS 4561 CARROLL STREET BUFFALO, NEW YORK 253 CTQII 2? 1 AUTOGRAPHS fx I7 x w ,4V.,,, f It '-I '7'A ff"V'f ,ff if W ' ff? y " M Q dd A .. L3 ,, Z Cc. JZ ' 39 " j ., 3 . My '17 . Y -YVX ' 'S 0 ' ...LI 5 ' I Zami .54 . .LJ ai ln 3' if A iii l-95 uf" Km X -V ,ig 2 A , A ,: 1' '-'f'5f.x